4IC3A

Crystal structure of the f495l mutant xiap ring domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
EISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKILM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase XIAP
publication title Regulation of ubiquitin transfer by XIAP, a dimeric RING E3 ligase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ic3A00
3QZVA 3ASLA 1RMDA 4BBQA 4N4FA 2JRJA 2RSDA 1WEPA 1LDJB 2YUCA 5B77A 4F52B 4AVXA 5LKXA 3U5MA 1T1HA 3PUQA 4GNEA 5C11A 5TBNA 2LGGA 1WEUA 2ECTA 5FERA 2RI7A 2FSAA 4A4CA 3N9MA 1HYIA 4AYCA 2JMJA 1FP0A 3PHDA 2F6NA 3PURA 3SHBA 2ECNA 2JMDA 2KGIA 1WFKA 1BORA 5D1LB 5FEYA 4YC9A 4PTBA 4FIPA 3O70A 2L43A 2HYED 5B75A 5DINA 1JOCA 3M63A 4W4UA 2VJEA 3C5KA 3MHHA 4AYCB 4YATA 2K16A 2ECGA 3ZPV1 4WA6A 5TRBA 2MA5A 1WEMA 4I7DA 3GL6A 4ZUXU 4FK5A 4UP5A 4WZ0A 4LK9A 4NN2A 4R2YA 4I7BA 1WESA 2VP7A 4C9ZA 1LDKC 4X3GA 5G0FA 4XI1A 2VJEB 4GNFA 5G05B 3O34A 2FUUA 1WILA 3U5PA 2ECJA 2M1RA 4GB0A 1FBVA 3U5OA 3V43A 5FB1A 2ZETC 2C2LA 3N9NA 1Z2QA 5H9MA 2LQ6A 3N9OA 2CT2A 2IDAA 3L1ZB 4GNDA 2CSZA 3O36A 3SOWA 1MM3A 4B86C 1WEQA 3FL2A 4R8PK 3KV5A 2LGLA 5B79A 4UP0A 4QF2A 4YBSA 4GNGA 2QICA 5FB0A 4QF3A 3T6RA 2Y43A 3RPGC 2YREA 5G04B 2KWJA 1IYMA 2KREA 3VK6A 3L11A 5J3XA 2KYUA 4IC3A 2LV9A 1VD4A 3ZYQA 4Q6FA 1WIMA 1Z60A 1WEVA 2HDPA 2D8SA 2KE1A 1E4UA 2K4DA 3NG2A 5H1TA 2EA6A 2L0BA 3O7AA 2LXPC 5DKAA 4FJCA 4B7YC 2XEUA 4N3WA 2LGKA 2YHOA 3KQIA 3U5NA 3SOXA 4LLBA 2KWOA 4LADB 2KU3A 5B8DA 1MM2A 3O35A 2H0DA 3HTKC 2MD7B 3LRQA 2UZGA 4S3OC 2YQLA 3M99A 3RTRB 2KFTA 2VPDA 5D1KB 1WEEA 3SOUA 2MNZA 4ZDTA 2NAAA 4FO9A 3LQIA 2C2VS 5EYAF 1JM7A 5C13A 1X4UA 5TDRA 4YBMA 2K1JA 4BHWA 3ZTGA 2MNYA 4O64A 2Y1NA 5KH9A 2H0DB 3M62A 2OXQC 1N87A 4CA1A 5KH7A 2YSMA 4YBTA 2XB1A 3T7LA 5LKZA 5AITA 3I2DA 5LCWB 1X4JA 4I7CA 1WEOA 5TDWA 2BAYA 1JM7B 3O37A 2KWNA 2LDRA 2E6SA 3MHSA 4R7EA 3ZVZB 3KV6A 1WENA 1X4IA 4A49A 2L75A 4MSXA 4AUQB 2PNXA 2K17A 2L5UA 2MD8C 4AP4A 2YT5A 4PPEA 2AN6A 2MUMA 2LRIC 3ZVYA 2YHNA 5I3LA 1CHCA 2MT5A 3C6WA 1G25A 1XWHA 2YURA 2CKLA 2EODA 2YQMA 4CCGX 2LGVA 2LXHC 3DQVR 1WGMA 3EB5A 5H1VA 5LKTA 2L80A 4WZ2A 1VFYA 2EGPA 2DX8A 3HCTA 5KH3A 1K2FA 4WZ3B 2CKLB 1U6GB 4MVTA 2M6MA 2E6RA 1DVPA 2YYRA 5B76A 2VNFA 4YAXA 2G6QA 4LJNA 4P5OB 4L7XA 2VJFA 2KGGA 2YSJA 3GV4A 5LKUA 2YW8A 1V87A 2VPEA 3RPGB 2M85A 3LQJA 3KNVA 2MA6A 3LQHA 3N9QA 2JMIA 3HCSA 2ECIA 2ECWA 4ZQLA 2QIZA 2KWKA 2VJFB 4TKPB 3ZPVE 3HCUA 4A0CD 2ECVA 3N9LA 1F62A 2CSYA 4IC2A 2KR4A 5B78A 2G43A 2VPGA 3L1XA 2VPBA 4YABA 2QJ0A 3ZNIA 1Z6UA 4V3LC 1VYXA 4LKAA 2I50A 4A4BA 2F42A 4YADA 5AIUA 4V3KC 1ZBDB 1WE9A 4S3OB 3IHPA 2Y1MA 4UI9B 5JG6A 5H1UA 2G45A 3DPLR 2F6JA 2PUYA 2KIZA 2M3HA 3O33A 3N9PA 1HYJA 2MIQA 2YU4A 1WEWA 5D1MB 4L58A 2FUIA 5TABA 2LN0A 3EB6A
chains in the Genus database with same CATH superfamily
3MDBC 3QZVA 3ASLA 1RMDA 4BBQA 4N4FA 1DCQA 2JRJA 4Z0RA 2RSDA 1WEPA 1LDJB 2YUCA 5B77A 4F52B 4AVXA 5LKXA 3U5MA 1T1HA 3PUQA 4GNEA 5C11A 5TBNA 2LGGA 1WEUA 2ECTA 5FERA 2RI7A 2FSAA 4A4CA 3N9MA 1HYIA 4AYCA 2JMJA 1FP0A 3PHDA 2F6NA 3PURA 3SHBA 2ECNA 2JMDA 2KGIA 3DWDA 1WFKA 1BORA 5D1LB 5FEYA 4YC9A 4PTBA 4FIPA 3O70A 2M13A 2L43A 2HYED 5B75A 5DINA 1JOCA 3FANA 3M63A 4W4UA 2VJEA 3C5KA 3MHHA 4AYCB 4YATA 2DSMA 2K16A 2ECGA 2XOZA 5SVIA 3ZPV1 4WA6A 5TRBA 3LVQE 2FD4A 2MA5A 1WEMA 4I7DA 3GL6A 4ZUXU 4FK5A 4UP5A 4QQ4A 3SUBA 4WZ0A 4LK9A 2LAUA 4NN2A 4R2YA 4I7BA 1WESA 2VP7A 4C9ZA 1LDKC 4X3GA 5G0FA 3FJUB 4XI1A 2OWAA 2VJEB 4GNFA 5G05B 3O34A 4Z0OA 2FUUA 5SVIB 3PLWA 1WILA 3U5PA 2ECJA 2EXUA 2EGMA 2M1RA 2RR4A 2YVRA 4GB0A 1FBVA 3U5OA 5SVYA 3V43A 1MBMA 5K3QA 5FB1A 2ZETC 2C2LA 3N9NA 1Z2QA 5H9MA 2DJAA 2LQ6A 3N9OA 2CT2A 2IDAA 2CONA 4F1PA 3L1ZB 4GNDA 2CRWA 2CSZA 3O36A 3SOWA 1MM3A 4B86C 1WEQA 3FL2A 4R8PK 3KV5A 4H9DA 2LGLA 5B79A 4UP0A 4QF2A 4YBSA 4GNGA 2QICA 5FB0A 4QF3A 3T6RA 2Y43A 3RPGC 2YREA 5G04B 2KWJA 1IYMA 3Q1DA 2KREA 3VK6A 3L11A 5J3XA 2KYUA 4IC3A 2LV9A 1VD4A 3ZYQA 4Q6FA 2L7PA 1WIMA 1Z60A 1WEVA 2HDPA 2D8SA 2KE1A 1E4UA 2K4DA 3NG2A 5H1TA 2EA6A 2L0BA 3O7AA 2LXPC 2XP0A 5DKAA 4FJCA 4B7YC 2KKXA 2XEUA 4N3WA 2LGKA 2YHOA 3KQIA 3U5NA 3SOXA 4LLBA 2KWOA 3FEHA 3O47A 4LADB 2KU3A 5B8DA 2P57A 1MM2A 3O35A 2H0DA 3HTKC 2MD7B 3LRQA 2UZGA 3T9KA 4S3OC 2YQLA 3M99A 3RTRB 3M7KA 2KFTA 2VPDA 5D1KB 1WEEA 2CSVA 3SOUA 2MNZA 4ZDTA 2NAAA 4FO9A 3LQIA 2C2VS 5EYAF 1JM7A 5C13A 1X4UA 5TDRA 4YBMA 2K1JA 4BHWA 3ZTGA 2MNYA 4O64A 2Y1NA 5KH9A 2H0DB 3M62A 2OXQC 2B0OE 1N87A 4CA1A 5KH7A 2YSMA 4YBTA 2XB1A 2XOCA 3T7LA 5LKZA 5AITA 3I2DA 5LCWB 4O62A 1X4JA 2MKEA 4I7CA 1WEOA 5TDWA 2BAYA 1JM7B 3O37A 2D8UA 2KWNA 3FAOA 2LDRA 2E6SA 3MHSA 4R7EA 3ZVZB 3KV6A 1WENA 1X4IA 4A49A 2KKYA 2L75A 4MSXA 4AUQB 2PNXA 2K17A 2L5UA 2MD8C 4AP4A 2YT5A 4PPEA 2AN6A 3H7HA 2MUMA 2LRIC 3ZVYA 2YHNA 5I3LA 1CHCA 2MT5A 4OGEA 3C6WA 3LJUX 1G25A 1XWHA 2YURA 2CKLA 2FFWA 5SVXA 3LVRE 2EODA 2YQMA 4CCGX 2LGVA 2LXHC 3DQVR 1WGMA 3EB5A 3E2DA 5H1VA 5LKTA 2L80A 4WZ2A 1VFYA 2EGPA 2DX8A 3HCTA 5KH3A 1K2FA 4WZ3B 2CKLB 1U6GB 4MVTA 2CRRA 2M6MA 2E6RA 1DVPA 2YYRA 5B76A 3DDTA 2VNFA 4YAXA 2G6QA 4LJNA 4P5OB 2JM3A 4L7XA 2VJFA 2KGGA 2YSJA 3KDEC 3GV4A 5LKUA 2YW8A 2XOYA 1V87A 2VPEA 3RPGB 2M85A 3FM8C 3LQJA 3KNVA 2MA6A 3LQHA 3N9QA 2JMIA 3HCSA 2ECIA 2ECWA 4ZQLA 2QIZA 2KWKA 2JUNA 2VJFB 4TKPB 3ZPVE 3HCUA 4A0CD 2ECVA 3N9LA 1F62A 2CSYA 4IC2A 2KR4A 2E61A 5B78A 2G43A 2VPGA 3LDYA 3L1XA 2VPBA 4YABA 2QJ0A 3ZNIA 1Z6UA 4V3LC 1VYXA 4LKAA 2I50A 4A4BA 2F42A 4YADA 5AIUA 4V3KC 1ZBDB 1WE9A 4OGCA 4S3OB 3IHPA 2Y1MA 4UI9B 5JG6A 5H1UA 2G45A 3DPLR 2F6JA 2PUYA 2KIZA 3JUEA 2M3HA 3O33A 3N9PA 1HYJA 2MIQA 2YU4A 1WEWA 5D1MB 4L58A 2FUIA 5TABA 2IQJA 2LN0A 3EB6A
chains in the Genus database with same CATH topology
3QZVA 3ASLA 1RMDA 4BBQA 4N4FA 2JRJA 2RSDA 1WEPA 1LDJB 2YUCA 5B77A 4F52B 4AVXA 5LKXA 3U5MA 1T1HA 3PUQA 4GNEA 5C11A 5TBNA 2LGGA 1WEUA 2ECTA 5FERA 2RI7A 2FSAA 4A4CA 3N9MA 1HYIA 4AYCA 2JMJA 1FP0A 3PHDA 2F6NA 3PURA 3SHBA 2ECNA 2JMDA 2KGIA 1WFKA 1BORA 5D1LB 5FEYA 4YC9A 4PTBA 4FIPA 3O70A 2L43A 2HYED 5B75A 5DINA 1JOCA 3M63A 4W4UA 2VJEA 3C5KA 3MHHA 4AYCB 4YATA 2K16A 2ECGA 3ZPV1 4WA6A 5TRBA 2MA5A 1WEMA 4I7DA 3GL6A 4ZUXU 4FK5A 4UP5A 4WZ0A 4LK9A 4NN2A 4R2YA 4I7BA 1WESA 2VP7A 4C9ZA 1LDKC 4X3GA 5G0FA 4XI1A 2VJEB 4GNFA 5G05B 3O34A 2FUUA 1WILA 3U5PA 2ECJA 2M1RA 4GB0A 1FBVA 3U5OA 3V43A 5FB1A 2ZETC 2C2LA 3N9NA 1Z2QA 5H9MA 2LQ6A 3N9OA 2CT2A 2IDAA 3L1ZB 4GNDA 2CSZA 3O36A 3SOWA 1MM3A 4B86C 1WEQA 3FL2A 4R8PK 3KV5A 2LGLA 5B79A 4UP0A 4QF2A 4YBSA 4GNGA 2QICA 5FB0A 4QF3A 3T6RA 2Y43A 3RPGC 2YREA 5G04B 2KWJA 1IYMA 2KREA 3VK6A 3L11A 5J3XA 2KYUA 4IC3A 2LV9A 1VD4A 3ZYQA 4Q6FA 1WIMA 1Z60A 1WEVA 2HDPA 2D8SA 2KE1A 1E4UA 2K4DA 3NG2A 5H1TA 2EA6A 2L0BA 3O7AA 2LXPC 5DKAA 4FJCA 4B7YC 2XEUA 4N3WA 2LGKA 2YHOA 3KQIA 3U5NA 3SOXA 4LLBA 2KWOA 4LADB 2KU3A 5B8DA 1MM2A 3O35A 2H0DA 3HTKC 2MD7B 3LRQA 2UZGA 4S3OC 2YQLA 3M99A 3RTRB 2KFTA 2VPDA 5D1KB 1WEEA 3SOUA 2MNZA 4ZDTA 2NAAA 4FO9A 3LQIA 2C2VS 5EYAF 1JM7A 5C13A 1X4UA 5TDRA 4YBMA 2K1JA 4BHWA 3ZTGA 2MNYA 4O64A 2Y1NA 5KH9A 2H0DB 3M62A 2OXQC 1N87A 4CA1A 5KH7A 2YSMA 4YBTA 2XB1A 3T7LA 5LKZA 5AITA 3I2DA 5LCWB 1X4JA 4I7CA 1WEOA 5TDWA 2BAYA 1JM7B 3O37A 2KWNA 2LDRA 2E6SA 3MHSA 4R7EA 3ZVZB 3KV6A 1WENA 1X4IA 4A49A 2L75A 4MSXA 4AUQB 2PNXA 2K17A 2L5UA 2MD8C 4AP4A 2YT5A 4PPEA 2AN6A 2MUMA 2LRIC 3ZVYA 2YHNA 5I3LA 1CHCA 2MT5A 3C6WA 1G25A 1XWHA 2YURA 2CKLA 2EODA 2YQMA 4CCGX 2LGVA 2LXHC 3DQVR 1WGMA 3EB5A 5H1VA 5LKTA 2L80A 4WZ2A 1VFYA 2EGPA 2DX8A 3HCTA 5KH3A 1K2FA 4WZ3B 2CKLB 1U6GB 4MVTA 2M6MA 2E6RA 1DVPA 2YYRA 5B76A 2VNFA 4YAXA 2G6QA 4LJNA 4P5OB 4L7XA 2VJFA 2KGGA 2YSJA 3GV4A 5LKUA 2YW8A 1V87A 2VPEA 3RPGB 2M85A 3LQJA 3KNVA 2MA6A 3LQHA 3N9QA 2JMIA 3HCSA 2ECIA 2ECWA 4ZQLA 2QIZA 2KWKA 2VJFB 4TKPB 3ZPVE 3HCUA 4A0CD 2ECVA 3N9LA 1F62A 2CSYA 4IC2A 2KR4A 5B78A 2G43A 2VPGA 3L1XA 2VPBA 4YABA 2QJ0A 3ZNIA 1Z6UA 4V3LC 1VYXA 4LKAA 2I50A 4A4BA 2F42A 4YADA 5AIUA 4V3KC 1ZBDB 1WE9A 4S3OB 3IHPA 2Y1MA 4UI9B 5JG6A 5H1UA 2G45A 3DPLR 2F6JA 2PUYA 2KIZA 2M3HA 3O33A 3N9PA 1HYJA 2MIQA 2YU4A 1WEWA 5D1MB 4L58A 2FUIA 5TABA 2LN0A 3EB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZV A;  3ASL A;  1RMD A;  4BBQ A;  4N4F A;  2JRJ A;  2RSD A;  1WEP A;  1LDJ B;  2YUC A;  5B77 A;  4F52 B;  4AVX A;  5LKX A;  3U5M A;  1T1H A;  3PUQ A;  4GNE A;  5C11 A;  5TBN A;  2LGG A;  1WEU A;  2ECT A;  5FER A;  2RI7 A;  2FSA A;  4A4C A;  3N9M A;  1HYI A;  4AYC A;  2JMJ A;  1FP0 A;  3PHD A;  2F6N A;  3PUR A;  3SHB A;  2ECN A;  2JMD A;  2KGI A;  1WFK A;  1BOR A;  5D1L B;  5FEY A;  4YC9 A;  4PTB A;  4FIP A;  3O70 A;  2L43 A;  2HYE D;  5B75 A;  5DIN A;  1JOC A;  3M63 A;  4W4U A;  2VJE A;  3C5K A;  3MHH A;  4AYC B;  4YAT A;  2K16 A;  2ECG A;  3ZPV 1;  4WA6 A;  5TRB A;  2MA5 A;  1WEM A;  4I7D A;  3GL6 A;  4ZUX U;  4FK5 A;  4UP5 A;  4WZ0 A;  4LK9 A;  4NN2 A;  4R2Y A;  4I7B A;  1WES A;  2VP7 A;  4C9Z A;  1LDK C;  4X3G A;  5G0F A;  4XI1 A;  2VJE B;  4GNF A;  5G05 B;  3O34 A;  2FUU A;  1WIL A;  3U5P A;  2ECJ A;  2M1R A;  4GB0 A;  1FBV A;  3U5O A;  3V43 A;  5FB1 A;  2ZET C;  2C2L A;  3N9N A;  1Z2Q A;  5H9M A;  2LQ6 A;  3N9O A;  2CT2 A;  2IDA A;  3L1Z B;  4GND A;  2CSZ A;  3O36 A;  3SOW A;  1MM3 A;  4B86 C;  1WEQ A;  3FL2 A;  4R8P K;  3KV5 A;  2LGL A;  5B79 A;  4UP0 A;  4QF2 A;  4YBS A;  4GNG A;  2QIC A;  5FB0 A;  4QF3 A;  3T6R A;  2Y43 A;  3RPG C;  2YRE A;  5G04 B;  2KWJ A;  1IYM A;  2KRE A;  3VK6 A;  3L11 A;  5J3X A;  2KYU A;  4IC3 A;  2LV9 A;  1VD4 A;  3ZYQ A;  4Q6F A;  1WIM A;  1Z60 A;  1WEV A;  2HDP A;  2D8S A;  2KE1 A;  1E4U A;  2K4D A;  3NG2 A;  5H1T A;  2EA6 A;  2L0B A;  3O7A A;  2LXP C;  5DKA A;  4FJC A;  4B7Y C;  2XEU A;  4N3W A;  2LGK A;  2YHO A;  3KQI A;  3U5N A;  3SOX A;  4LLB A;  2KWO A;  4LAD B;  2KU3 A;  5B8D A;  1MM2 A;  3O35 A;  2H0D A;  3HTK C;  2MD7 B;  3LRQ A;  2UZG A;  4S3O C;  2YQL A;  3M99 A;  3RTR B;  2KFT A;  2VPD A;  5D1K B;  1WEE A;  3SOU A;  2MNZ A;  4ZDT A;  2NAA A;  4FO9 A;  3LQI A;  2C2V S;  5EYA F;  1JM7 A;  5C13 A;  1X4U A;  5TDR A;  4YBM A;  2K1J A;  4BHW A;  3ZTG A;  2MNY A;  4O64 A;  2Y1N A;  5KH9 A;  2H0D B;  3M62 A;  2OXQ C;  1N87 A;  4CA1 A;  5KH7 A;  2YSM A;  4YBT A;  2XB1 A;  3T7L A;  5LKZ A;  5AIT A;  3I2D A;  5LCW B;  1X4J A;  4I7C A;  1WEO A;  5TDW A;  2BAY A;  1JM7 B;  3O37 A;  2KWN A;  2LDR A;  2E6S A;  3MHS A;  4R7E A;  3ZVZ B;  3KV6 A;  1WEN A;  1X4I A;  4A49 A;  2L75 A;  4MSX A;  4AUQ B;  2PNX A;  2K17 A;  2L5U A;  2MD8 C;  4AP4 A;  2YT5 A;  4PPE A;  2AN6 A;  2MUM A;  2LRI C;  3ZVY A;  2YHN A;  5I3L A;  1CHC A;  2MT5 A;  3C6W A;  1G25 A;  1XWH A;  2YUR A;  2CKL A;  2EOD A;  2YQM A;  4CCG X;  2LGV A;  2LXH C;  3DQV R;  1WGM A;  3EB5 A;  5H1V A;  5LKT A;  2L80 A;  4WZ2 A;  1VFY A;  2EGP A;  2DX8 A;  3HCT A;  5KH3 A;  1K2F A;  4WZ3 B;  2CKL B;  1U6G B;  4MVT A;  2M6M A;  2E6R A;  1DVP A;  2YYR A;  5B76 A;  2VNF A;  4YAX A;  2G6Q A;  4LJN A;  4P5O B;  4L7X A;  2VJF A;  2KGG A;  2YSJ A;  3GV4 A;  5LKU A;  2YW8 A;  1V87 A;  2VPE A;  3RPG B;  2M85 A;  3LQJ A;  3KNV A;  2MA6 A;  3LQH A;  3N9Q A;  2JMI A;  3HCS A;  2ECI A;  2ECW A;  4ZQL A;  2QIZ A;  2KWK A;  2VJF B;  4TKP B;  3ZPV E;  3HCU A;  4A0C D;  2ECV A;  3N9L A;  1F62 A;  2CSY A;  4IC2 A;  2KR4 A;  5B78 A;  2G43 A;  2VPG A;  3L1X A;  2VPB A;  4YAB A;  2QJ0 A;  3ZNI A;  1Z6U A;  4V3L C;  1VYX A;  4LKA A;  2I50 A;  4A4B A;  2F42 A;  4YAD A;  5AIU A;  4V3K C;  1ZBD B;  1WE9 A;  4S3O B;  3IHP A;  2Y1M A;  4UI9 B;  5JG6 A;  5H1U A;  2G45 A;  3DPL R;  2F6J A;  2PUY A;  2KIZ A;  2M3H A;  3O33 A;  3N9P A;  1HYJ A;  2MIQ A;  2YU4 A;  1WEW A;  5D1M B;  4L58 A;  2FUI A;  5TAB A;  2LN0 A;  3EB6 A; 
#chains in the Genus database with same CATH topology
 3MDB C;  3QZV A;  3ASL A;  1RMD A;  4BBQ A;  4N4F A;  1DCQ A;  2JRJ A;  4Z0R A;  2RSD A;  1WEP A;  1LDJ B;  2YUC A;  5B77 A;  4F52 B;  4AVX A;  5LKX A;  3U5M A;  1T1H A;  3PUQ A;  4GNE A;  5C11 A;  5TBN A;  2LGG A;  1WEU A;  2ECT A;  5FER A;  2RI7 A;  2FSA A;  4A4C A;  3N9M A;  1HYI A;  4AYC A;  2JMJ A;  1FP0 A;  3PHD A;  2F6N A;  3PUR A;  3SHB A;  2ECN A;  2JMD A;  2KGI A;  3DWD A;  1WFK A;  1BOR A;  5D1L B;  5FEY A;  4YC9 A;  4PTB A;  4FIP A;  3O70 A;  2M13 A;  2L43 A;  2HYE D;  5B75 A;  5DIN A;  1JOC A;  3FAN A;  3M63 A;  4W4U A;  2VJE A;  3C5K A;  3MHH A;  4AYC B;  4YAT A;  2DSM A;  2K16 A;  2ECG A;  2XOZ A;  5SVI A;  3ZPV 1;  4WA6 A;  5TRB A;  3LVQ E;  2FD4 A;  2MA5 A;  1WEM A;  4I7D A;  3GL6 A;  4ZUX U;  4FK5 A;  4UP5 A;  4QQ4 A;  3SUB A;  4WZ0 A;  4LK9 A;  2LAU A;  4NN2 A;  4R2Y A;  4I7B A;  1WES A;  2VP7 A;  4C9Z A;  1LDK C;  4X3G A;  5G0F A;  3FJU B;  4XI1 A;  2OWA A;  2VJE B;  4GNF A;  5G05 B;  3O34 A;  4Z0O A;  2FUU A;  5SVI B;  3PLW A;  1WIL A;  3U5P A;  2ECJ A;  2EXU A;  2EGM A;  2M1R A;  2RR4 A;  2YVR A;  4GB0 A;  1FBV A;  3U5O A;  5SVY A;  3V43 A;  1MBM A;  5K3Q A;  5FB1 A;  2ZET C;  2C2L A;  3N9N A;  1Z2Q A;  5H9M A;  2DJA A;  2LQ6 A;  3N9O A;  2CT2 A;  2IDA A;  2CON A;  4F1P A;  3L1Z B;  4GND A;  2CRW A;  2CSZ A;  3O36 A;  3SOW A;  1MM3 A;  4B86 C;  1WEQ A;  3FL2 A;  4R8P K;  3KV5 A;  4H9D A;  2LGL A;  5B79 A;  4UP0 A;  4QF2 A;  4YBS A;  4GNG A;  2QIC A;  5FB0 A;  4QF3 A;  3T6R A;  2Y43 A;  3RPG C;  2YRE A;  5G04 B;  2KWJ A;  1IYM A;  3Q1D A;  2KRE A;  3VK6 A;  3L11 A;  5J3X A;  2KYU A;  4IC3 A;  2LV9 A;  1VD4 A;  3ZYQ A;  4Q6F A;  2L7P A;  1WIM A;  1Z60 A;  1WEV A;  2HDP A;  2D8S A;  2KE1 A;  1E4U A;  2K4D A;  3NG2 A;  5H1T A;  2EA6 A;  2L0B A;  3O7A A;  2LXP C;  2XP0 A;  5DKA A;  4FJC A;  4B7Y C;  2KKX A;  2XEU A;  4N3W A;  2LGK A;  2YHO A;  3KQI A;  3U5N A;  3SOX A;  4LLB A;  2KWO A;  3FEH A;  3O47 A;  4LAD B;  2KU3 A;  5B8D A;  2P57 A;  1MM2 A;  3O35 A;  2H0D A;  3HTK C;  2MD7 B;  3LRQ A;  2UZG A;  3T9K A;  4S3O C;  2YQL A;  3M99 A;  3RTR B;  3M7K A;  2KFT A;  2VPD A;  5D1K B;  1WEE A;  2CSV A;  3SOU A;  2MNZ A;  4ZDT A;  2NAA A;  4FO9 A;  3LQI A;  2C2V S;  5EYA F;  1JM7 A;  5C13 A;  1X4U A;  5TDR A;  4YBM A;  2K1J A;  4BHW A;  3ZTG A;  2MNY A;  4O64 A;  2Y1N A;  5KH9 A;  2H0D B;  3M62 A;  2OXQ C;  2B0O E;  1N87 A;  4CA1 A;  5KH7 A;  2YSM A;  4YBT A;  2XB1 A;  2XOC A;  3T7L A;  5LKZ A;  5AIT A;  3I2D A;  5LCW B;  4O62 A;  1X4J A;  2MKE A;  4I7C A;  1WEO A;  5TDW A;  2BAY A;  1JM7 B;  3O37 A;  2D8U A;  2KWN A;  3FAO A;  2LDR A;  2E6S A;  3MHS A;  4R7E A;  3ZVZ B;  3KV6 A;  1WEN A;  1X4I A;  4A49 A;  2KKY A;  2L75 A;  4MSX A;  4AUQ B;  2PNX A;  2K17 A;  2L5U A;  2MD8 C;  4AP4 A;  2YT5 A;  4PPE A;  2AN6 A;  3H7H A;  2MUM A;  2LRI C;  3ZVY A;  2YHN A;  5I3L A;  1CHC A;  2MT5 A;  4OGE A;  3C6W A;  3LJU X;  1G25 A;  1XWH A;  2YUR A;  2CKL A;  2FFW A;  5SVX A;  3LVR E;  2EOD A;  2YQM A;  4CCG X;  2LGV A;  2LXH C;  3DQV R;  1WGM A;  3EB5 A;  3E2D A;  5H1V A;  5LKT A;  2L80 A;  4WZ2 A;  1VFY A;  2EGP A;  2DX8 A;  3HCT A;  5KH3 A;  1K2F A;  4WZ3 B;  2CKL B;  1U6G B;  4MVT A;  2CRR A;  2M6M A;  2E6R A;  1DVP A;  2YYR A;  5B76 A;  3DDT A;  2VNF A;  4YAX A;  2G6Q A;  4LJN A;  4P5O B;  2JM3 A;  4L7X A;  2VJF A;  2KGG A;  2YSJ A;  3KDE C;  3GV4 A;  5LKU A;  2YW8 A;  2XOY A;  1V87 A;  2VPE A;  3RPG B;  2M85 A;  3FM8 C;  3LQJ A;  3KNV A;  2MA6 A;  3LQH A;  3N9Q A;  2JMI A;  3HCS A;  2ECI A;  2ECW A;  4ZQL A;  2QIZ A;  2KWK A;  2JUN A;  2VJF B;  4TKP B;  3ZPV E;  3HCU A;  4A0C D;  2ECV A;  3N9L A;  1F62 A;  2CSY A;  4IC2 A;  2KR4 A;  2E61 A;  5B78 A;  2G43 A;  2VPG A;  3LDY A;  3L1X A;  2VPB A;  4YAB A;  2QJ0 A;  3ZNI A;  1Z6U A;  4V3L C;  1VYX A;  4LKA A;  2I50 A;  4A4B A;  2F42 A;  4YAD A;  5AIU A;  4V3K C;  1ZBD B;  1WE9 A;  4OGC A;  4S3O B;  3IHP A;  2Y1M A;  4UI9 B;  5JG6 A;  5H1U A;  2G45 A;  3DPL R;  2F6J A;  2PUY A;  2KIZ A;  3JUE A;  2M3H A;  3O33 A;  3N9P A;  1HYJ A;  2MIQ A;  2YU4 A;  1WEW A;  5D1M B;  4L58 A;  2FUI A;  5TAB A;  2IQJ A;  2LN0 A;  3EB6 A; 
#chains in the Genus database with same CATH homology
 3QZV A;  3ASL A;  1RMD A;  4BBQ A;  4N4F A;  2JRJ A;  2RSD A;  1WEP A;  1LDJ B;  2YUC A;  5B77 A;  4F52 B;  4AVX A;  5LKX A;  3U5M A;  1T1H A;  3PUQ A;  4GNE A;  5C11 A;  5TBN A;  2LGG A;  1WEU A;  2ECT A;  5FER A;  2RI7 A;  2FSA A;  4A4C A;  3N9M A;  1HYI A;  4AYC A;  2JMJ A;  1FP0 A;  3PHD A;  2F6N A;  3PUR A;  3SHB A;  2ECN A;  2JMD A;  2KGI A;  1WFK A;  1BOR A;  5D1L B;  5FEY A;  4YC9 A;  4PTB A;  4FIP A;  3O70 A;  2L43 A;  2HYE D;  5B75 A;  5DIN A;  1JOC A;  3M63 A;  4W4U A;  2VJE A;  3C5K A;  3MHH A;  4AYC B;  4YAT A;  2K16 A;  2ECG A;  3ZPV 1;  4WA6 A;  5TRB A;  2MA5 A;  1WEM A;  4I7D A;  3GL6 A;  4ZUX U;  4FK5 A;  4UP5 A;  4WZ0 A;  4LK9 A;  4NN2 A;  4R2Y A;  4I7B A;  1WES A;  2VP7 A;  4C9Z A;  1LDK C;  4X3G A;  5G0F A;  4XI1 A;  2VJE B;  4GNF A;  5G05 B;  3O34 A;  2FUU A;  1WIL A;  3U5P A;  2ECJ A;  2M1R A;  4GB0 A;  1FBV A;  3U5O A;  3V43 A;  5FB1 A;  2ZET C;  2C2L A;  3N9N A;  1Z2Q A;  5H9M A;  2LQ6 A;  3N9O A;  2CT2 A;  2IDA A;  3L1Z B;  4GND A;  2CSZ A;  3O36 A;  3SOW A;  1MM3 A;  4B86 C;  1WEQ A;  3FL2 A;  4R8P K;  3KV5 A;  2LGL A;  5B79 A;  4UP0 A;  4QF2 A;  4YBS A;  4GNG A;  2QIC A;  5FB0 A;  4QF3 A;  3T6R A;  2Y43 A;  3RPG C;  2YRE A;  5G04 B;  2KWJ A;  1IYM A;  2KRE A;  3VK6 A;  3L11 A;  5J3X A;  2KYU A;  4IC3 A;  2LV9 A;  1VD4 A;  3ZYQ A;  4Q6F A;  1WIM A;  1Z60 A;  1WEV A;  2HDP A;  2D8S A;  2KE1 A;  1E4U A;  2K4D A;  3NG2 A;  5H1T A;  2EA6 A;  2L0B A;  3O7A A;  2LXP C;  5DKA A;  4FJC A;  4B7Y C;  2XEU A;  4N3W A;  2LGK A;  2YHO A;  3KQI A;  3U5N A;  3SOX A;  4LLB A;  2KWO A;  4LAD B;  2KU3 A;  5B8D A;  1MM2 A;  3O35 A;  2H0D A;  3HTK C;  2MD7 B;  3LRQ A;  2UZG A;  4S3O C;  2YQL A;  3M99 A;  3RTR B;  2KFT A;  2VPD A;  5D1K B;  1WEE A;  3SOU A;  2MNZ A;  4ZDT A;  2NAA A;  4FO9 A;  3LQI A;  2C2V S;  5EYA F;  1JM7 A;  5C13 A;  1X4U A;  5TDR A;  4YBM A;  2K1J A;  4BHW A;  3ZTG A;  2MNY A;  4O64 A;  2Y1N A;  5KH9 A;  2H0D B;  3M62 A;  2OXQ C;  1N87 A;  4CA1 A;  5KH7 A;  2YSM A;  4YBT A;  2XB1 A;  3T7L A;  5LKZ A;  5AIT A;  3I2D A;  5LCW B;  1X4J A;  4I7C A;  1WEO A;  5TDW A;  2BAY A;  1JM7 B;  3O37 A;  2KWN A;  2LDR A;  2E6S A;  3MHS A;  4R7E A;  3ZVZ B;  3KV6 A;  1WEN A;  1X4I A;  4A49 A;  2L75 A;  4MSX A;  4AUQ B;  2PNX A;  2K17 A;  2L5U A;  2MD8 C;  4AP4 A;  2YT5 A;  4PPE A;  2AN6 A;  2MUM A;  2LRI C;  3ZVY A;  2YHN A;  5I3L A;  1CHC A;  2MT5 A;  3C6W A;  1G25 A;  1XWH A;  2YUR A;  2CKL A;  2EOD A;  2YQM A;  4CCG X;  2LGV A;  2LXH C;  3DQV R;  1WGM A;  3EB5 A;  5H1V A;  5LKT A;  2L80 A;  4WZ2 A;  1VFY A;  2EGP A;  2DX8 A;  3HCT A;  5KH3 A;  1K2F A;  4WZ3 B;  2CKL B;  1U6G B;  4MVT A;  2M6M A;  2E6R A;  1DVP A;  2YYR A;  5B76 A;  2VNF A;  4YAX A;  2G6Q A;  4LJN A;  4P5O B;  4L7X A;  2VJF A;  2KGG A;  2YSJ A;  3GV4 A;  5LKU A;  2YW8 A;  1V87 A;  2VPE A;  3RPG B;  2M85 A;  3LQJ A;  3KNV A;  2MA6 A;  3LQH A;  3N9Q A;  2JMI A;  3HCS A;  2ECI A;  2ECW A;  4ZQL A;  2QIZ A;  2KWK A;  2VJF B;  4TKP B;  3ZPV E;  3HCU A;  4A0C D;  2ECV A;  3N9L A;  1F62 A;  2CSY A;  4IC2 A;  2KR4 A;  5B78 A;  2G43 A;  2VPG A;  3L1X A;  2VPB A;  4YAB A;  2QJ0 A;  3ZNI A;  1Z6U A;  4V3L C;  1VYX A;  4LKA A;  2I50 A;  4A4B A;  2F42 A;  4YAD A;  5AIU A;  4V3K C;  1ZBD B;  1WE9 A;  4S3O B;  3IHP A;  2Y1M A;  4UI9 B;  5JG6 A;  5H1U A;  2G45 A;  3DPL R;  2F6J A;  2PUY A;  2KIZ A;  2M3H A;  3O33 A;  3N9P A;  1HYJ A;  2MIQ A;  2YU4 A;  1WEW A;  5D1M B;  4L58 A;  2FUI A;  5TAB A;  2LN0 A;  3EB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...