4IC3A

Crystal structure of the f495l mutant xiap ring domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
EISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKILM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase XIAP
publication title Regulation of ubiquitin transfer by XIAP, a dimeric RING E3 ligase
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ic3A00
2KR4A 4AVXA 1BORA 1DVPA 4BHWA 2H0DB 1WEOA 2L0BA 1JM7A 4GNDA 3M62A 4B7YC 2VJFA 2Y43A 4YBMA 2M1RA 2QICA 2XB1A 1VFYA 4L7XA 4P5OB 3L1XA 2MT5A 1WFKA 4A0CD 4UP0A 1X4JA 2L43A 2VPDA 4YBSA 4GB0A 2VNFA 2CKLA 2IDAA 2I50A 3C6WA 3N9MA 3QZVA 4AYCB 4LKAA 5D1KB 3FL2A 4ZDTA 4CA1A 3N9NA 2FUIA 3I2DA 3L1ZB 3T7LA 4YC9A 2H0DA 3MHHA 5LCWB 2MIQA 3LQHA 4WZ0A 2D8SA 1V87A 2E6RA 2M3HA 2LGGA 2YUCA 5H9MA 1HYJA 1LDJB 2L75A 4O64A 5TRBA 2PNXA 4YATA 1JM7B 4FO9A 2ECNA 3V43A 2KWOA 4R7EA 1X4UA 3O37A 4B86C 2VP7A 2L5UA 5LKUA 2DX8A 4YADA 2VPEA 3GV4A 3O34A 4A49A 1FP0A 3N9QA 2KFTA 1X4IA 3KV5A 1WESA 2EGPA 2LXHC 5FB1A 3NG2A 5J3XA 4GNGA 2AN6A 2YHNA 3LQJA 4AYCA 1HYIA 2JMIA 2Y1MA 2YW8A 2KWKA 4MVTA 5FB0A 1RMDA 3HCUA 2ECJA 5G05B 2Y1NA 3O33A 5KH3A 2CSZA 2C2LA 4TKPB 4FIPA 1WEVA 4I7DA 5C13A 5KH7A 5EYAF 2BAYA 3ZVZB 1WEUA 4IC2A 1U6GB 3VK6A 3EB6A 4R2YA 5AITA 2K4DA 5G0FA 4N4FA 2YQMA 4GNFA 1Z60A 2MNYA 2F6NA 4Q6FA 3N9LA 2G45A 2F6JA 3PUQA 4UI9B 1FBVA 5I3LA 5LKXA 1WILA 3ZVYA 3PURA 1Z6UA 2QJ0A 3M99A 2KWJA 2KWNA 5H1VA 1WEQA 5D1LB 4AUQB 5TABA 5B79A 3ZPV1 3HTKC 3M63A 4X3GA 3U5NA 3C5KA 4I7CA 3T6RA 4W4UA 2E6SA 3MHSA 5TDRA 4A4BA 3SOWA 1G25A 4AP4A 3N9OA 3N9PA 2YHOA 2LRIC 4CCGX 3RPGB 3ZYQA 4YBTA 3ZPVE 5H1UA 3IHPA 3O35A 2CSYA 3EB5A 4ZUXU 1WEPA 1VYXA 2FSAA 2NAAA 1WIMA 2LQ6A 4QF2A 2ZETC 1WEWA 4S3OC 2QIZA 2HDPA 1MM3A 5C11A 2ECGA 1WGMA 2G43A 5FEYA 2F42A 2RSDA 3DPLR 1ZBDB 2LN0A 4C9ZA 3U5PA 5TBNA 2YU4A 4S3OB 1CHCA 2MA5A 4MSXA 2LGLA 2OXQC 1VD4A 2KGGA 1E4UA 4NN2A 5LKTA 4I7BA 2LDRA 3HCSA 3O70A 5DKAA 5H1TA 2KREA 5LKZA 1WENA 2JRJA 4LK9A 2G6QA 5B75A 1WEEA 4F52B 1WEMA 3RTRB 4IC3A 3PHDA 2K16A 2MUMA 3SHBA 3SOUA 4PTBA 5JG6A 1WE9A 1N87A 2YT5A 4ZQLA 4V3LC 2ECWA 1F62A 3HCTA 2JMJA 2JMDA 3KV6A 4WZ3B 4A4CA 2MD7B 4R8PK 4L58A 3RPGC 2VJEA 1K2FA 2EODA 3SOXA 3U5MA 3KQIA 3LRQA 1XWHA 3U5OA 2YSJA 1T1HA 4QF3A 4LJNA 2YSMA 3ZTGA 2YYRA 2M85A 4N3WA 2MNZA 3O7AA 3DQVR 2C2VS 5TDWA 5KH9A 3ASLA 4LADB 2KGIA 5B78A 2KIZA 3L11A 2PUYA 1IYMA 5D1MB 2KU3A 1LDKC 5B8DA 3LQIA 3ZNIA 4V3KC 2MA6A 1JOCA 5AIUA 2KYUA 2M6MA 2KE1A 2ECIA 4YAXA 2K1JA 2VJFB 3KNVA 5DINA 2K17A 4YABA 2YREA 2LV9A 2YURA 2FUUA 4FJCA 1Z2QA 2XEUA 5G04B 2ECVA 2HYED 2VJEB 2L80A 4XI1A 2LXPC 4PPEA 3GL6A 2CT2A 4LLBA 2LGVA 3O36A 2RI7A 2VPBA 5B76A 5B77A 2CKLB 4GNEA 2MD8C 4UP5A 2ECTA 4BBQA 4WA6A 2UZGA 5FERA 2LGKA 2VPGA 2YQLA 4FK5A 2EA6A 1MM2A 4WZ2A
chains in the Genus database with same CATH superfamily
2KR4A 3JUEA 3T9KA 4AVXA 1BORA 1DVPA 3FEHA 4BHWA 3LVRE 2CRRA 2H0DB 1WEOA 2L0BA 1JM7A 4GNDA 3M62A 4B7YC 2VJFA 2Y43A 2XP0A 4YBMA 2M1RA 2QICA 2XB1A 1VFYA 4L7XA 4P5OB 3L1XA 2MT5A 1WFKA 5K3QA 4A0CD 5SVIA 4UP0A 1X4JA 2L43A 2VPDA 4YBSA 2EXUA 4GB0A 2VNFA 2CKLA 2IDAA 2I50A 3C6WA 3N9MA 3QZVA 4AYCB 4LKAA 5D1KB 3DDTA 2IQJA 3FL2A 4ZDTA 4CA1A 3N9NA 2FUIA 3I2DA 3L1ZB 2D8UA 3T7LA 4YC9A 2H0DA 3MHHA 5LCWB 2EGMA 2MIQA 3LQHA 4WZ0A 2D8SA 1V87A 2E6RA 2M3HA 2LGGA 2YUCA 5H9MA 1HYJA 1LDJB 2L75A 4O64A 5TRBA 2PNXA 4YATA 1JM7B 4FO9A 2ECNA 3V43A 2KWOA 4R7EA 1X4UA 3O37A 4B86C 2VP7A 2L5UA 5LKUA 2DX8A 2KKXA 4YADA 2VPEA 3GV4A 3O34A 4A49A 1FP0A 3N9QA 2KFTA 1X4IA 2XOCA 3KV5A 1DCQA 1WESA 2EGPA 2LXHC 5FB1A 3NG2A 5J3XA 4GNGA 2P57A 2AN6A 2YHNA 3LQJA 4AYCA 1HYIA 2JMIA 2Y1MA 2YW8A 2KWKA 4MVTA 5FB0A 1RMDA 3HCUA 2ECJA 5SVXA 3DWDA 5G05B 3FJUB 2Y1NA 3O33A 5KH3A 2CSZA 2C2LA 4TKPB 4FIPA 2RR4A 1WEVA 4I7DA 5C13A 2JM3A 5KH7A 5EYAF 2BAYA 3ZVZB 1WEUA 4IC2A 1U6GB 3VK6A 2CONA 3EB6A 4R2YA 5AITA 2K4DA 5G0FA 4N4FA 2YQMA 4GNFA 1Z60A 2MNYA 2F6NA 2CRWA 3N9LA 4Q6FA 4OGCA 2G45A 2F6JA 3PUQA 4UI9B 1FBVA 5I3LA 5LKXA 1WILA 3ZVYA 3PURA 1Z6UA 2QJ0A 3M99A 2B0OE 2KWJA 2KWNA 5H1VA 1WEQA 5D1LB 4AUQB 5TABA 5B79A 3ZPV1 3HTKC 3M63A 3PLWA 4X3GA 3U5NA 3C5KA 4I7CA 3T6RA 4W4UA 2E6SA 3MHSA 5TDRA 4A4BA 3SOWA 1G25A 4AP4A 3N9OA 3N9PA 2YHOA 2LRIC 4CCGX 3RPGB 3ZYQA 4YBTA 3ZPVE 5H1UA 2FD4A 3IHPA 3O35A 4Z0OA 2CSYA 3EB5A 4ZUXU 1WEPA 3M7KA 1VYXA 2FSAA 2NAAA 1WIMA 2LQ6A 4QF2A 2ZETC 1WEWA 4S3OC 2QIZA 2HDPA 2XOYA 1MM3A 5C11A 2ECGA 1WGMA 2G43A 5FEYA 2F42A 2RSDA 3DPLR 3FANA 1ZBDB 2LN0A 4C9ZA 3U5PA 5TBNA 2YU4A 4Z0RA 4S3OB 1CHCA 2E61A 2DJAA 2MA5A 4MSXA 2LGLA 2OXQC 1VD4A 2KGGA 1E4UA 4NN2A 5LKTA 4I7BA 2KKYA 3SUBA 2LDRA 4QQ4A 4O62A 3HCSA 3O70A 5DKAA 5H1TA 2KREA 5LKZA 1WENA 2JRJA 4LK9A 2G6QA 5B75A 1WEEA 4F52B 2CSVA 1WEMA 2LAUA 3O47A 3Q1DA 3RTRB 4IC3A 3PHDA 2K16A 2MUMA 3SHBA 3SOUA 2DSMA 4PTBA 2OWAA 5JG6A 1WE9A 1N87A 4OGEA 3FM8C 2YT5A 4ZQLA 4V3LC 2ECWA 1F62A 3HCTA 2JMJA 2JMDA 3KV6A 4WZ3B 4A4CA 2MD7B 4R8PK 4L58A 3RPGC 2VJEA 1K2FA 2EODA 3SOXA 3U5MA 3KQIA 3LRQA 1XWHA 3U5OA 2YSJA 1T1HA 3LJUX 4QF3A 4LJNA 2YSMA 3ZTGA 2JUNA 2YYRA 2M85A 4N3WA 2MNZA 5SVYA 3O7AA 3DQVR 2C2VS 5TDWA 2M13A 5KH9A 3LVQE 3ASLA 4LADB 2KGIA 5B78A 2KIZA 3E2DA 3L11A 4F1PA 2PUYA 2MKEA 1IYMA 5D1MB 2KU3A 1LDKC 5B8DA 3LQIA 3ZNIA 4H9DA 4V3KC 1MBMA 2MA6A 1JOCA 5AIUA 2KYUA 2L7PA 2M6MA 2KE1A 2ECIA 4YAXA 2K1JA 3KDEC 2VJFB 3KNVA 2FFWA 2YVRA 5DINA 2K17A 4YABA 2YREA 2LV9A 2YURA 2FUUA 4FJCA 1Z2QA 2XEUA 5G04B 5SVIB 2ECVA 2HYED 2VJEB 2L80A 4XI1A 2XOZA 2LXPC 4PPEA 3GL6A 2CT2A 3FAOA 4LLBA 2LGVA 3O36A 2RI7A 2VPBA 5B76A 5B77A 2CKLB 4GNEA 2MD8C 4UP5A 2ECTA 3MDBC 4BBQA 4WA6A 2UZGA 3LDYA 5FERA 2LGKA 2VPGA 2YQLA 4FK5A 2EA6A 3H7HA 1MM2A 4WZ2A
chains in the Genus database with same CATH topology
2KR4A 4AVXA 1BORA 1DVPA 4BHWA 2H0DB 1WEOA 2L0BA 1JM7A 4GNDA 3M62A 4B7YC 2VJFA 2Y43A 4YBMA 2M1RA 2QICA 2XB1A 1VFYA 4L7XA 4P5OB 3L1XA 2MT5A 1WFKA 4A0CD 4UP0A 1X4JA 2L43A 2VPDA 4YBSA 4GB0A 2VNFA 2CKLA 2IDAA 2I50A 3C6WA 3N9MA 3QZVA 4AYCB 4LKAA 5D1KB 3FL2A 4ZDTA 4CA1A 3N9NA 2FUIA 3I2DA 3L1ZB 3T7LA 4YC9A 2H0DA 3MHHA 5LCWB 2MIQA 3LQHA 4WZ0A 2D8SA 1V87A 2E6RA 2M3HA 2LGGA 2YUCA 5H9MA 1HYJA 1LDJB 2L75A 4O64A 5TRBA 2PNXA 4YATA 1JM7B 4FO9A 2ECNA 3V43A 2KWOA 4R7EA 1X4UA 3O37A 4B86C 2VP7A 2L5UA 5LKUA 2DX8A 4YADA 2VPEA 3GV4A 3O34A 4A49A 1FP0A 3N9QA 2KFTA 1X4IA 3KV5A 1WESA 2EGPA 2LXHC 5FB1A 3NG2A 5J3XA 4GNGA 2AN6A 2YHNA 3LQJA 4AYCA 1HYIA 2JMIA 2Y1MA 2YW8A 2KWKA 4MVTA 5FB0A 1RMDA 3HCUA 2ECJA 5G05B 2Y1NA 3O33A 5KH3A 2CSZA 2C2LA 4TKPB 4FIPA 1WEVA 4I7DA 5C13A 5KH7A 5EYAF 2BAYA 3ZVZB 1WEUA 4IC2A 1U6GB 3VK6A 3EB6A 4R2YA 5AITA 2K4DA 5G0FA 4N4FA 2YQMA 4GNFA 1Z60A 2MNYA 2F6NA 4Q6FA 3N9LA 2G45A 2F6JA 3PUQA 4UI9B 1FBVA 5I3LA 5LKXA 1WILA 3ZVYA 3PURA 1Z6UA 2QJ0A 3M99A 2KWJA 2KWNA 5H1VA 1WEQA 5D1LB 4AUQB 5TABA 5B79A 3ZPV1 3HTKC 3M63A 4X3GA 3U5NA 3C5KA 4I7CA 3T6RA 4W4UA 2E6SA 3MHSA 5TDRA 4A4BA 3SOWA 1G25A 4AP4A 3N9OA 3N9PA 2YHOA 2LRIC 4CCGX 3RPGB 3ZYQA 4YBTA 3ZPVE 5H1UA 3IHPA 3O35A 2CSYA 3EB5A 4ZUXU 1WEPA 1VYXA 2FSAA 2NAAA 1WIMA 2LQ6A 4QF2A 2ZETC 1WEWA 4S3OC 2QIZA 2HDPA 1MM3A 5C11A 2ECGA 1WGMA 2G43A 5FEYA 2F42A 2RSDA 3DPLR 1ZBDB 2LN0A 4C9ZA 3U5PA 5TBNA 2YU4A 4S3OB 1CHCA 2MA5A 4MSXA 2LGLA 2OXQC 1VD4A 2KGGA 1E4UA 4NN2A 5LKTA 4I7BA 2LDRA 3HCSA 3O70A 5DKAA 5H1TA 2KREA 5LKZA 1WENA 2JRJA 4LK9A 2G6QA 5B75A 1WEEA 4F52B 1WEMA 3RTRB 4IC3A 3PHDA 2K16A 2MUMA 3SHBA 3SOUA 4PTBA 5JG6A 1WE9A 1N87A 2YT5A 4ZQLA 4V3LC 2ECWA 1F62A 3HCTA 2JMJA 2JMDA 3KV6A 4WZ3B 4A4CA 2MD7B 4R8PK 4L58A 3RPGC 2VJEA 1K2FA 2EODA 3SOXA 3U5MA 3KQIA 3LRQA 1XWHA 3U5OA 2YSJA 1T1HA 4QF3A 4LJNA 2YSMA 3ZTGA 2YYRA 2M85A 4N3WA 2MNZA 3O7AA 3DQVR 2C2VS 5TDWA 5KH9A 3ASLA 4LADB 2KGIA 5B78A 2KIZA 3L11A 2PUYA 1IYMA 5D1MB 2KU3A 1LDKC 5B8DA 3LQIA 3ZNIA 4V3KC 2MA6A 1JOCA 5AIUA 2KYUA 2M6MA 2KE1A 2ECIA 4YAXA 2K1JA 2VJFB 3KNVA 5DINA 2K17A 4YABA 2YREA 2LV9A 2YURA 2FUUA 4FJCA 1Z2QA 2XEUA 5G04B 2ECVA 2HYED 2VJEB 2L80A 4XI1A 2LXPC 4PPEA 3GL6A 2CT2A 4LLBA 2LGVA 3O36A 2RI7A 2VPBA 5B76A 5B77A 2CKLB 4GNEA 2MD8C 4UP5A 2ECTA 4BBQA 4WA6A 2UZGA 5FERA 2LGKA 2VPGA 2YQLA 4FK5A 2EA6A 1MM2A 4WZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR4 A;  4AVX A;  1BOR A;  1DVP A;  4BHW A;  2H0D B;  1WEO A;  2L0B A;  1JM7 A;  4GND A;  3M62 A;  4B7Y C;  2VJF A;  2Y43 A;  4YBM A;  2M1R A;  2QIC A;  2XB1 A;  1VFY A;  4L7X A;  4P5O B;  3L1X A;  2MT5 A;  1WFK A;  4A0C D;  4UP0 A;  1X4J A;  2L43 A;  2VPD A;  4YBS A;  4GB0 A;  2VNF A;  2CKL A;  2IDA A;  2I50 A;  3C6W A;  3N9M A;  3QZV A;  4AYC B;  4LKA A;  5D1K B;  3FL2 A;  4ZDT A;  4CA1 A;  3N9N A;  2FUI A;  3I2D A;  3L1Z B;  3T7L A;  4YC9 A;  2H0D A;  3MHH A;  5LCW B;  2MIQ A;  3LQH A;  4WZ0 A;  2D8S A;  1V87 A;  2E6R A;  2M3H A;  2LGG A;  2YUC A;  5H9M A;  1HYJ A;  1LDJ B;  2L75 A;  4O64 A;  5TRB A;  2PNX A;  4YAT A;  1JM7 B;  4FO9 A;  2ECN A;  3V43 A;  2KWO A;  4R7E A;  1X4U A;  3O37 A;  4B86 C;  2VP7 A;  2L5U A;  5LKU A;  2DX8 A;  4YAD A;  2VPE A;  3GV4 A;  3O34 A;  4A49 A;  1FP0 A;  3N9Q A;  2KFT A;  1X4I A;  3KV5 A;  1WES A;  2EGP A;  2LXH C;  5FB1 A;  3NG2 A;  5J3X A;  4GNG A;  2AN6 A;  2YHN A;  3LQJ A;  4AYC A;  1HYI A;  2JMI A;  2Y1M A;  2YW8 A;  2KWK A;  4MVT A;  5FB0 A;  1RMD A;  3HCU A;  2ECJ A;  5G05 B;  2Y1N A;  3O33 A;  5KH3 A;  2CSZ A;  2C2L A;  4TKP B;  4FIP A;  1WEV A;  4I7D A;  5C13 A;  5KH7 A;  5EYA F;  2BAY A;  3ZVZ B;  1WEU A;  4IC2 A;  1U6G B;  3VK6 A;  3EB6 A;  4R2Y A;  5AIT A;  2K4D A;  5G0F A;  4N4F A;  2YQM A;  4GNF A;  1Z60 A;  2MNY A;  2F6N A;  4Q6F A;  3N9L A;  2G45 A;  2F6J A;  3PUQ A;  4UI9 B;  1FBV A;  5I3L A;  5LKX A;  1WIL A;  3ZVY A;  3PUR A;  1Z6U A;  2QJ0 A;  3M99 A;  2KWJ A;  2KWN A;  5H1V A;  1WEQ A;  5D1L B;  4AUQ B;  5TAB A;  5B79 A;  3ZPV 1;  3HTK C;  3M63 A;  4X3G A;  3U5N A;  3C5K A;  4I7C A;  3T6R A;  4W4U A;  2E6S A;  3MHS A;  5TDR A;  4A4B A;  3SOW A;  1G25 A;  4AP4 A;  3N9O A;  3N9P A;  2YHO A;  2LRI C;  4CCG X;  3RPG B;  3ZYQ A;  4YBT A;  3ZPV E;  5H1U A;  3IHP A;  3O35 A;  2CSY A;  3EB5 A;  4ZUX U;  1WEP A;  1VYX A;  2FSA A;  2NAA A;  1WIM A;  2LQ6 A;  4QF2 A;  2ZET C;  1WEW A;  4S3O C;  2QIZ A;  2HDP A;  1MM3 A;  5C11 A;  2ECG A;  1WGM A;  2G43 A;  5FEY A;  2F42 A;  2RSD A;  3DPL R;  1ZBD B;  2LN0 A;  4C9Z A;  3U5P A;  5TBN A;  2YU4 A;  4S3O B;  1CHC A;  2MA5 A;  4MSX A;  2LGL A;  2OXQ C;  1VD4 A;  2KGG A;  1E4U A;  4NN2 A;  5LKT A;  4I7B A;  2LDR A;  3HCS A;  3O70 A;  5DKA A;  5H1T A;  2KRE A;  5LKZ A;  1WEN A;  2JRJ A;  4LK9 A;  2G6Q A;  5B75 A;  1WEE A;  4F52 B;  1WEM A;  3RTR B;  4IC3 A;  3PHD A;  2K16 A;  2MUM A;  3SHB A;  3SOU A;  4PTB A;  5JG6 A;  1WE9 A;  1N87 A;  2YT5 A;  4ZQL A;  4V3L C;  2ECW A;  1F62 A;  3HCT A;  2JMJ A;  2JMD A;  3KV6 A;  4WZ3 B;  4A4C A;  2MD7 B;  4R8P K;  4L58 A;  3RPG C;  2VJE A;  1K2F A;  2EOD A;  3SOX A;  3U5M A;  3KQI A;  3LRQ A;  1XWH A;  3U5O A;  2YSJ A;  1T1H A;  4QF3 A;  4LJN A;  2YSM A;  3ZTG A;  2YYR A;  2M85 A;  4N3W A;  2MNZ A;  3O7A A;  3DQV R;  2C2V S;  5TDW A;  5KH9 A;  3ASL A;  4LAD B;  2KGI A;  5B78 A;  2KIZ A;  3L11 A;  2PUY A;  1IYM A;  5D1M B;  2KU3 A;  1LDK C;  5B8D A;  3LQI A;  3ZNI A;  4V3K C;  2MA6 A;  1JOC A;  5AIU A;  2KYU A;  2M6M A;  2KE1 A;  2ECI A;  4YAX A;  2K1J A;  2VJF B;  3KNV A;  5DIN A;  2K17 A;  4YAB A;  2YRE A;  2LV9 A;  2YUR A;  2FUU A;  4FJC A;  1Z2Q A;  2XEU A;  5G04 B;  2ECV A;  2HYE D;  2VJE B;  2L80 A;  4XI1 A;  2LXP C;  4PPE A;  3GL6 A;  2CT2 A;  4LLB A;  2LGV A;  3O36 A;  2RI7 A;  2VPB A;  5B76 A;  5B77 A;  2CKL B;  4GNE A;  2MD8 C;  4UP5 A;  2ECT A;  4BBQ A;  4WA6 A;  2UZG A;  5FER A;  2LGK A;  2VPG A;  2YQL A;  4FK5 A;  2EA6 A;  1MM2 A;  4WZ2 A; 
#chains in the Genus database with same CATH topology
 2KR4 A;  3JUE A;  3T9K A;  4AVX A;  1BOR A;  1DVP A;  3FEH A;  4BHW A;  3LVR E;  2CRR A;  2H0D B;  1WEO A;  2L0B A;  1JM7 A;  4GND A;  3M62 A;  4B7Y C;  2VJF A;  2Y43 A;  2XP0 A;  4YBM A;  2M1R A;  2QIC A;  2XB1 A;  1VFY A;  4L7X A;  4P5O B;  3L1X A;  2MT5 A;  1WFK A;  5K3Q A;  4A0C D;  5SVI A;  4UP0 A;  1X4J A;  2L43 A;  2VPD A;  4YBS A;  2EXU A;  4GB0 A;  2VNF A;  2CKL A;  2IDA A;  2I50 A;  3C6W A;  3N9M A;  3QZV A;  4AYC B;  4LKA A;  5D1K B;  3DDT A;  2IQJ A;  3FL2 A;  4ZDT A;  4CA1 A;  3N9N A;  2FUI A;  3I2D A;  3L1Z B;  2D8U A;  3T7L A;  4YC9 A;  2H0D A;  3MHH A;  5LCW B;  2EGM A;  2MIQ A;  3LQH A;  4WZ0 A;  2D8S A;  1V87 A;  2E6R A;  2M3H A;  2LGG A;  2YUC A;  5H9M A;  1HYJ A;  1LDJ B;  2L75 A;  4O64 A;  5TRB A;  2PNX A;  4YAT A;  1JM7 B;  4FO9 A;  2ECN A;  3V43 A;  2KWO A;  4R7E A;  1X4U A;  3O37 A;  4B86 C;  2VP7 A;  2L5U A;  5LKU A;  2DX8 A;  2KKX A;  4YAD A;  2VPE A;  3GV4 A;  3O34 A;  4A49 A;  1FP0 A;  3N9Q A;  2KFT A;  1X4I A;  2XOC A;  3KV5 A;  1DCQ A;  1WES A;  2EGP A;  2LXH C;  5FB1 A;  3NG2 A;  5J3X A;  4GNG A;  2P57 A;  2AN6 A;  2YHN A;  3LQJ A;  4AYC A;  1HYI A;  2JMI A;  2Y1M A;  2YW8 A;  2KWK A;  4MVT A;  5FB0 A;  1RMD A;  3HCU A;  2ECJ A;  5SVX A;  3DWD A;  5G05 B;  3FJU B;  2Y1N A;  3O33 A;  5KH3 A;  2CSZ A;  2C2L A;  4TKP B;  4FIP A;  2RR4 A;  1WEV A;  4I7D A;  5C13 A;  2JM3 A;  5KH7 A;  5EYA F;  2BAY A;  3ZVZ B;  1WEU A;  4IC2 A;  1U6G B;  3VK6 A;  2CON A;  3EB6 A;  4R2Y A;  5AIT A;  2K4D A;  5G0F A;  4N4F A;  2YQM A;  4GNF A;  1Z60 A;  2MNY A;  2F6N A;  2CRW A;  3N9L A;  4Q6F A;  4OGC A;  2G45 A;  2F6J A;  3PUQ A;  4UI9 B;  1FBV A;  5I3L A;  5LKX A;  1WIL A;  3ZVY A;  3PUR A;  1Z6U A;  2QJ0 A;  3M99 A;  2B0O E;  2KWJ A;  2KWN A;  5H1V A;  1WEQ A;  5D1L B;  4AUQ B;  5TAB A;  5B79 A;  3ZPV 1;  3HTK C;  3M63 A;  3PLW A;  4X3G A;  3U5N A;  3C5K A;  4I7C A;  3T6R A;  4W4U A;  2E6S A;  3MHS A;  5TDR A;  4A4B A;  3SOW A;  1G25 A;  4AP4 A;  3N9O A;  3N9P A;  2YHO A;  2LRI C;  4CCG X;  3RPG B;  3ZYQ A;  4YBT A;  3ZPV E;  5H1U A;  2FD4 A;  3IHP A;  3O35 A;  4Z0O A;  2CSY A;  3EB5 A;  4ZUX U;  1WEP A;  3M7K A;  1VYX A;  2FSA A;  2NAA A;  1WIM A;  2LQ6 A;  4QF2 A;  2ZET C;  1WEW A;  4S3O C;  2QIZ A;  2HDP A;  2XOY A;  1MM3 A;  5C11 A;  2ECG A;  1WGM A;  2G43 A;  5FEY A;  2F42 A;  2RSD A;  3DPL R;  3FAN A;  1ZBD B;  2LN0 A;  4C9Z A;  3U5P A;  5TBN A;  2YU4 A;  4Z0R A;  4S3O B;  1CHC A;  2E61 A;  2DJA A;  2MA5 A;  4MSX A;  2LGL A;  2OXQ C;  1VD4 A;  2KGG A;  1E4U A;  4NN2 A;  5LKT A;  4I7B A;  2KKY A;  3SUB A;  2LDR A;  4QQ4 A;  4O62 A;  3HCS A;  3O70 A;  5DKA A;  5H1T A;  2KRE A;  5LKZ A;  1WEN A;  2JRJ A;  4LK9 A;  2G6Q A;  5B75 A;  1WEE A;  4F52 B;  2CSV A;  1WEM A;  2LAU A;  3O47 A;  3Q1D A;  3RTR B;  4IC3 A;  3PHD A;  2K16 A;  2MUM A;  3SHB A;  3SOU A;  2DSM A;  4PTB A;  2OWA A;  5JG6 A;  1WE9 A;  1N87 A;  4OGE A;  3FM8 C;  2YT5 A;  4ZQL A;  4V3L C;  2ECW A;  1F62 A;  3HCT A;  2JMJ A;  2JMD A;  3KV6 A;  4WZ3 B;  4A4C A;  2MD7 B;  4R8P K;  4L58 A;  3RPG C;  2VJE A;  1K2F A;  2EOD A;  3SOX A;  3U5M A;  3KQI A;  3LRQ A;  1XWH A;  3U5O A;  2YSJ A;  1T1H A;  3LJU X;  4QF3 A;  4LJN A;  2YSM A;  3ZTG A;  2JUN A;  2YYR A;  2M85 A;  4N3W A;  2MNZ A;  5SVY A;  3O7A A;  3DQV R;  2C2V S;  5TDW A;  2M13 A;  5KH9 A;  3LVQ E;  3ASL A;  4LAD B;  2KGI A;  5B78 A;  2KIZ A;  3E2D A;  3L11 A;  4F1P A;  2PUY A;  2MKE A;  1IYM A;  5D1M B;  2KU3 A;  1LDK C;  5B8D A;  3LQI A;  3ZNI A;  4H9D A;  4V3K C;  1MBM A;  2MA6 A;  1JOC A;  5AIU A;  2KYU A;  2L7P A;  2M6M A;  2KE1 A;  2ECI A;  4YAX A;  2K1J A;  3KDE C;  2VJF B;  3KNV A;  2FFW A;  2YVR A;  5DIN A;  2K17 A;  4YAB A;  2YRE A;  2LV9 A;  2YUR A;  2FUU A;  4FJC A;  1Z2Q A;  2XEU A;  5G04 B;  5SVI B;  2ECV A;  2HYE D;  2VJE B;  2L80 A;  4XI1 A;  2XOZ A;  2LXP C;  4PPE A;  3GL6 A;  2CT2 A;  3FAO A;  4LLB A;  2LGV A;  3O36 A;  2RI7 A;  2VPB A;  5B76 A;  5B77 A;  2CKL B;  4GNE A;  2MD8 C;  4UP5 A;  2ECT A;  3MDB C;  4BBQ A;  4WA6 A;  2UZG A;  3LDY A;  5FER A;  2LGK A;  2VPG A;  2YQL A;  4FK5 A;  2EA6 A;  3H7H A;  1MM2 A;  4WZ2 A; 
#chains in the Genus database with same CATH homology
 2KR4 A;  4AVX A;  1BOR A;  1DVP A;  4BHW A;  2H0D B;  1WEO A;  2L0B A;  1JM7 A;  4GND A;  3M62 A;  4B7Y C;  2VJF A;  2Y43 A;  4YBM A;  2M1R A;  2QIC A;  2XB1 A;  1VFY A;  4L7X A;  4P5O B;  3L1X A;  2MT5 A;  1WFK A;  4A0C D;  4UP0 A;  1X4J A;  2L43 A;  2VPD A;  4YBS A;  4GB0 A;  2VNF A;  2CKL A;  2IDA A;  2I50 A;  3C6W A;  3N9M A;  3QZV A;  4AYC B;  4LKA A;  5D1K B;  3FL2 A;  4ZDT A;  4CA1 A;  3N9N A;  2FUI A;  3I2D A;  3L1Z B;  3T7L A;  4YC9 A;  2H0D A;  3MHH A;  5LCW B;  2MIQ A;  3LQH A;  4WZ0 A;  2D8S A;  1V87 A;  2E6R A;  2M3H A;  2LGG A;  2YUC A;  5H9M A;  1HYJ A;  1LDJ B;  2L75 A;  4O64 A;  5TRB A;  2PNX A;  4YAT A;  1JM7 B;  4FO9 A;  2ECN A;  3V43 A;  2KWO A;  4R7E A;  1X4U A;  3O37 A;  4B86 C;  2VP7 A;  2L5U A;  5LKU A;  2DX8 A;  4YAD A;  2VPE A;  3GV4 A;  3O34 A;  4A49 A;  1FP0 A;  3N9Q A;  2KFT A;  1X4I A;  3KV5 A;  1WES A;  2EGP A;  2LXH C;  5FB1 A;  3NG2 A;  5J3X A;  4GNG A;  2AN6 A;  2YHN A;  3LQJ A;  4AYC A;  1HYI A;  2JMI A;  2Y1M A;  2YW8 A;  2KWK A;  4MVT A;  5FB0 A;  1RMD A;  3HCU A;  2ECJ A;  5G05 B;  2Y1N A;  3O33 A;  5KH3 A;  2CSZ A;  2C2L A;  4TKP B;  4FIP A;  1WEV A;  4I7D A;  5C13 A;  5KH7 A;  5EYA F;  2BAY A;  3ZVZ B;  1WEU A;  4IC2 A;  1U6G B;  3VK6 A;  3EB6 A;  4R2Y A;  5AIT A;  2K4D A;  5G0F A;  4N4F A;  2YQM A;  4GNF A;  1Z60 A;  2MNY A;  2F6N A;  4Q6F A;  3N9L A;  2G45 A;  2F6J A;  3PUQ A;  4UI9 B;  1FBV A;  5I3L A;  5LKX A;  1WIL A;  3ZVY A;  3PUR A;  1Z6U A;  2QJ0 A;  3M99 A;  2KWJ A;  2KWN A;  5H1V A;  1WEQ A;  5D1L B;  4AUQ B;  5TAB A;  5B79 A;  3ZPV 1;  3HTK C;  3M63 A;  4X3G A;  3U5N A;  3C5K A;  4I7C A;  3T6R A;  4W4U A;  2E6S A;  3MHS A;  5TDR A;  4A4B A;  3SOW A;  1G25 A;  4AP4 A;  3N9O A;  3N9P A;  2YHO A;  2LRI C;  4CCG X;  3RPG B;  3ZYQ A;  4YBT A;  3ZPV E;  5H1U A;  3IHP A;  3O35 A;  2CSY A;  3EB5 A;  4ZUX U;  1WEP A;  1VYX A;  2FSA A;  2NAA A;  1WIM A;  2LQ6 A;  4QF2 A;  2ZET C;  1WEW A;  4S3O C;  2QIZ A;  2HDP A;  1MM3 A;  5C11 A;  2ECG A;  1WGM A;  2G43 A;  5FEY A;  2F42 A;  2RSD A;  3DPL R;  1ZBD B;  2LN0 A;  4C9Z A;  3U5P A;  5TBN A;  2YU4 A;  4S3O B;  1CHC A;  2MA5 A;  4MSX A;  2LGL A;  2OXQ C;  1VD4 A;  2KGG A;  1E4U A;  4NN2 A;  5LKT A;  4I7B A;  2LDR A;  3HCS A;  3O70 A;  5DKA A;  5H1T A;  2KRE A;  5LKZ A;  1WEN A;  2JRJ A;  4LK9 A;  2G6Q A;  5B75 A;  1WEE A;  4F52 B;  1WEM A;  3RTR B;  4IC3 A;  3PHD A;  2K16 A;  2MUM A;  3SHB A;  3SOU A;  4PTB A;  5JG6 A;  1WE9 A;  1N87 A;  2YT5 A;  4ZQL A;  4V3L C;  2ECW A;  1F62 A;  3HCT A;  2JMJ A;  2JMD A;  3KV6 A;  4WZ3 B;  4A4C A;  2MD7 B;  4R8P K;  4L58 A;  3RPG C;  2VJE A;  1K2F A;  2EOD A;  3SOX A;  3U5M A;  3KQI A;  3LRQ A;  1XWH A;  3U5O A;  2YSJ A;  1T1H A;  4QF3 A;  4LJN A;  2YSM A;  3ZTG A;  2YYR A;  2M85 A;  4N3W A;  2MNZ A;  3O7A A;  3DQV R;  2C2V S;  5TDW A;  5KH9 A;  3ASL A;  4LAD B;  2KGI A;  5B78 A;  2KIZ A;  3L11 A;  2PUY A;  1IYM A;  5D1M B;  2KU3 A;  1LDK C;  5B8D A;  3LQI A;  3ZNI A;  4V3K C;  2MA6 A;  1JOC A;  5AIU A;  2KYU A;  2M6M A;  2KE1 A;  2ECI A;  4YAX A;  2K1J A;  2VJF B;  3KNV A;  5DIN A;  2K17 A;  4YAB A;  2YRE A;  2LV9 A;  2YUR A;  2FUU A;  4FJC A;  1Z2Q A;  2XEU A;  5G04 B;  2ECV A;  2HYE D;  2VJE B;  2L80 A;  4XI1 A;  2LXP C;  4PPE A;  3GL6 A;  2CT2 A;  4LLB A;  2LGV A;  3O36 A;  2RI7 A;  2VPB A;  5B76 A;  5B77 A;  2CKL B;  4GNE A;  2MD8 C;  4UP5 A;  2ECT A;  4BBQ A;  4WA6 A;  2UZG A;  5FER A;  2LGK A;  2VPG A;  2YQL A;  4FK5 A;  2EA6 A;  1MM2 A;  4WZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...