5EYAF

Trim25 ring domain in complex with ubc13-ub conjugate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
PLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQARPQLHKNTVLCNVVEQFLQADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of TRIM25 Catalytic Activation in the Antiviral RIG-I Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
molecule keywords Ubiquitin-conjugating enzyme E2 N
total genus 21
structure length 76
sequence length 76
chains with identical sequence G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5eyaF00
3N9NA 2NAAA 5KH7A 4YBSA 3QZVA 2PNXA 5FEYA 1WE9A 4MVTA 2EA6A 5B79A 4AP4A 3PHDA 4NN2A 3T6RA 2HDPA 1U6GB 4PTBA 3O7AA 2QJ0A 2HYED 2MA6A 5H1VA 5G04B 4B86C 3MHSA 5FB1A 3EB6A 2MD7B 2VJEA 4W4UA 2H0DA 1LDJB 2LV9A 3O33A 5DKAA 4I7CA 2KWJA 3GV4A 3L11A 3LRQA 2MNZA 3KV5A 4S3OC 3N9OA 3M99A 3ZYQA 5AIUA 5KH9A 4L7XA 2YW8A 4N4FA 5H9MA 3U5NA 2MUMA 4YBTA 2QIZA 5B8DA 3HCUA 2FSAA 2G6QA 1X4UA 2L43A 1Z2QA 3RTRB 2ZETC 4A0CD 5TABA 4A4CA 1JM7A 2YSJA 4C9ZA 5LKXA 5LKZA 5I3LA 3ZPVE 2QICA 3LQIA 5LKTA 2MNYA 3KV6A 2YURA 2KWKA 4YATA 2YQMA 2VP7A 2ECVA 3ZPV1 2G45A 4AVXA 5EYAF 2VJFB 2KWNA 2JMIA 2K16A 4I7BA 5LKUA 2CSYA 3I2DA 2KE1A 3GL6A 1X4JA 4R7EA 4UP5A 5H1UA 2M6MA 4CCGX 3V43A 4ZQLA 4FO9A 4LKAA 4LADB 5B75A 4AYCB 5KH3A 3HCTA 1WEUA 2Y1NA 2L0BA 4BBQA 3U5MA 2F42A 4FIPA 2YUCA 4YADA 3DPLR 1FBVA 5H1TA 2ECWA 4A49A 1WILA 1T1HA 4LK9A 2H0DB 1MM3A 4UP0A 2JMDA 2MIQA 5D1KB 2CKLB 1VYXA 2VJFA 1CHCA 3O70A 2IDAA 1HYJA 5D1LB 3C6WA 4IC2A 1WGMA 1DVPA 2YHOA 4FK5A 3M62A 4GB0A 1F62A 3RPGC 1MM2A 1WEWA 5TDWA 4L58A 2JRJA 3HCSA 4YC9A 2CSZA 3FL2A 1K2FA 2RI7A 2Y1MA 3DQVR 2L75A 2KWOA 1N87A 4MSXA 2LGGA 2LQ6A 2Y43A 3LQJA 4GNDA 3RPGB 4LLBA 4GNGA 5FB0A 2KR4A 3U5PA 1VD4A 1ZBDB 3ZVYA 2M85A 1WFKA 2M3HA 2K4DA 2YSMA 3O34A 1V87A 2FUIA 2YYRA 5G05B 4QF3A 3SOWA 5LCWB 2K17A 2F6JA 2XB1A 2ECGA 2KGGA 2MA5A 3N9MA 3L1XA 3O36A 2YT5A 4QF2A 2ECJA 3L1ZB 1WEOA 2PUYA 2XEUA 4WZ2A 2LGVA 5D1MB 3ZNIA 4LJNA 3EB5A 2G43A 4XI1A 2L5UA 2YHNA 4AYCA 2BAYA 2MT5A 5TDRA 5JG6A 4R2YA 5C11A 1HYIA 2AN6A 5J3XA 2E6SA 3PUQA 4BHWA 2M1RA 2F6NA 5C13A 3ZTGA 3N9LA 4GNEA 4YAXA 1G25A 3KQIA 5TBNA 4FJCA 4S3OB 2DX8A 2YU4A 1JOCA 1WIMA 3IHPA 4UI9B 3M63A 3SHBA 4V3LC 2CKLA 2YREA 4I7DA 4PPEA 4AUQB 4CA1A 3C5KA 5B77A 1FP0A 3O35A 1Z6UA 4P5OB 3SOUA 2KIZA 2ECIA 3NG2A 3T7LA 2ECTA 2KREA 4WA6A 2KYUA 2VPGA 5B76A 4O64A 5G0FA 2C2LA 4IC3A 4V3KC 1JM7B 2RSDA 1WEVA 1WEPA 5DINA 2E6RA 3SOXA 3O37A 1WENA 3U5OA 1VFYA 1Z60A 4WZ0A 2YQLA 2VJEB 2LGLA 4YABA 2LRIC 2MD8C 3VK6A 1E4UA 5FERA 2KFTA 2FUUA 3KNVA 2JMJA 2LDRA 4YBMA 5AITA 1RMDA 1BORA 4R8PK 3HTKC 2I50A 2C2VS 2LXHC 4TKPB 2KU3A 4X3GA 4ZDTA 2D8SA 2UZGA 2VPDA 4Q6FA 2LGKA 1XWHA 2L80A 3N9PA 3PURA 1WEQA 2OXQC 2LXPC 2CT2A 2K1JA 3ASLA 4GNFA 3LQHA 4WZ3B 2LN0A 2KGIA 2EODA 3N9QA 2VPEA 2VNFA 4ZUXU 1IYMA 5B78A 1WEEA 1LDKC 1WEMA 1X4IA 5TRBA 1WESA 4N3WA 2ECNA 4B7YC 4A4BA 3ZVZB 2EGPA 2VPBA 3MHHA 4F52B
chains in the Genus database with same CATH superfamily
3N9NA 2OWAA 2NAAA 5KH7A 4YBSA 3QZVA 2PNXA 5FEYA 1WE9A 4MVTA 2EA6A 5B79A 4AP4A 3PHDA 3JUEA 4NN2A 3T6RA 2HDPA 1U6GB 4PTBA 3O7AA 2QJ0A 2HYED 2MA6A 5H1VA 5G04B 4B86C 3MHSA 5FB1A 3EB6A 2MD7B 2VJEA 2EGMA 2CSVA 4W4UA 2H0DA 1LDJB 2LV9A 3O33A 1DCQA 5DKAA 4I7CA 2KWJA 3GV4A 2XP0A 3L11A 3LRQA 2DSMA 2MNZA 3KV5A 5SVYA 3FJUB 4S3OC 3N9OA 3M99A 5AIUA 3ZYQA 5KH9A 4L7XA 4Z0OA 2YW8A 4N4FA 5H9MA 3U5NA 2MUMA 4YBTA 2QIZA 2EXUA 5B8DA 3HCUA 2FSAA 2G6QA 1X4UA 2L43A 1Z2QA 2FD4A 3RTRB 2ZETC 4A0CD 5TABA 4A4CA 2KKXA 1JM7A 2XOZA 2YSJA 4C9ZA 5LKXA 2E61A 5LKZA 5I3LA 3ZPVE 2JUNA 2QICA 3LQIA 2YVRA 5LKTA 2MNYA 3KV6A 2YURA 2KWKA 4YATA 2YQMA 2VP7A 2ECVA 3ZPV1 2G45A 4AVXA 2XOCA 5EYAF 2VJFB 2KWNA 2CONA 3LDYA 2JMIA 2K16A 4I7BA 4H9DA 5LKUA 2CSYA 3I2DA 2KE1A 2JM3A 3GL6A 1X4JA 4R7EA 4UP5A 5H1UA 2M6MA 4CCGX 3V43A 4ZQLA 5SVIB 4FO9A 4LKAA 2LAUA 4OGEA 4LADB 5B75A 4AYCB 5KH3A 3HCTA 1WEUA 2Y1NA 2L0BA 3H7HA 4BBQA 3U5MA 2F42A 4FIPA 2YUCA 4YADA 3DPLR 1FBVA 5H1TA 2ECWA 4A49A 1WILA 1T1HA 4LK9A 2H0DB 3FM8C 1MM3A 4UP0A 2JMDA 2MIQA 5D1KB 2CKLB 1VYXA 3KDEC 2VJFA 1CHCA 4F1PA 3O70A 2IDAA 1HYJA 3LJUX 4OGCA 5D1LB 3C6WA 4IC2A 1WGMA 1DVPA 2YHOA 4FK5A 3M62A 4GB0A 1F62A 3RPGC 1MM2A 1WEWA 5TDWA 4O62A 4L58A 2JRJA 3HCSA 4YC9A 2CSZA 2B0OE 3FL2A 1K2FA 2RI7A 2Y1MA 3DQVR 2L75A 5SVXA 2KWOA 1N87A 4MSXA 2LGGA 2LQ6A 5SVIA 2Y43A 3LQJA 4GNDA 3RPGB 4LLBA 4GNGA 3LVRE 5FB0A 2KR4A 3U5PA 1VD4A 1ZBDB 3ZVYA 3E2DA 2M85A 1WFKA 2M3HA 2K4DA 2YSMA 3O34A 1V87A 3FANA 2FUIA 2YYRA 5G05B 4QF3A 3SOWA 4QQ4A 5LCWB 2K17A 2F6JA 2XB1A 2ECGA 2KGGA 2MA5A 3N9MA 3L1XA 2DJAA 3O36A 2YT5A 2L7PA 4QF2A 2ECJA 3L1ZB 1WEOA 2PUYA 2XEUA 4WZ2A 5D1MB 3ZNIA 4LJNA 3EB5A 2G43A 3FAOA 2L5UA 4XI1A 2YHNA 2XOYA 4AYCA 2BAYA 2MT5A 5TDRA 5JG6A 4R2YA 5C11A 1HYIA 2AN6A 5J3XA 3DDTA 4Z0RA 2CRRA 2E6SA 3PUQA 4BHWA 2M1RA 3DWDA 2F6NA 5C13A 2KKYA 3ZTGA 3N9LA 4GNEA 4YAXA 1G25A 3KQIA 5TBNA 4FJCA 4S3OB 2DX8A 2YU4A 1JOCA 1WIMA 3IHPA 4UI9B 3M63A 3SHBA 4V3LC 2CKLA 2YREA 4I7DA 4PPEA 4AUQB 3LVQE 4CA1A 3C5KA 5B77A 3T9KA 1FP0A 3O35A 1Z6UA 4P5OB 3SOUA 2KIZA 2ECIA 3NG2A 3T7LA 2ECTA 2M13A 2KREA 4WA6A 2KYUA 2VPGA 1MBMA 5B76A 4O64A 5G0FA 2C2LA 4IC3A 4V3KC 1JM7B 2RSDA 1WEVA 1WEPA 5DINA 2E6RA 2MKEA 3PLWA 3SOXA 3O37A 1WENA 3U5OA 1VFYA 1Z60A 4WZ0A 2YQLA 2VJEB 2LGLA 2FFWA 5K3QA 4YABA 2LRIC 3MDBC 2MD8C 3VK6A 1E4UA 5FERA 2CRWA 2D8UA 2KFTA 2FUUA 3KNVA 2JMJA 2LDRA 4YBMA 5AITA 1RMDA 1BORA 2IQJA 3O47A 4R8PK 3HTKC 2I50A 2C2VS 2LXHC 3FEHA 4TKPB 2KU3A 4X3GA 2RR4A 4ZDTA 2D8SA 2UZGA 2VPDA 4Q6FA 2LGKA 1XWHA 2L80A 3N9PA 3PURA 1WEQA 2OXQC 2LXPC 3M7KA 2CT2A 2K1JA 3ASLA 4GNFA 3LQHA 4WZ3B 2LN0A 2KGIA 2EODA 3N9QA 2VPEA 2VNFA 4ZUXU 1IYMA 3SUBA 5B78A 2P57A 1WEEA 1LDKC 1WEMA 1X4IA 5TRBA 3Q1DA 1WESA 4N3WA 2ECNA 3MHHA 4B7YC 4A4BA 3ZVZB 2EGPA 2VPBA 2LGVA 4F52B
chains in the Genus database with same CATH topology
3N9NA 2NAAA 5KH7A 4YBSA 3QZVA 2PNXA 5FEYA 1WE9A 4MVTA 2EA6A 5B79A 4AP4A 3PHDA 4NN2A 3T6RA 2HDPA 1U6GB 4PTBA 3O7AA 2QJ0A 2HYED 2MA6A 5H1VA 5G04B 4B86C 3MHSA 5FB1A 3EB6A 2MD7B 2VJEA 4W4UA 2H0DA 1LDJB 2LV9A 3O33A 5DKAA 4I7CA 2KWJA 3GV4A 3L11A 3LRQA 2MNZA 3KV5A 4S3OC 3N9OA 3M99A 3ZYQA 5AIUA 5KH9A 4L7XA 2YW8A 4N4FA 5H9MA 3U5NA 2MUMA 4YBTA 2QIZA 5B8DA 3HCUA 2FSAA 2G6QA 1X4UA 2L43A 1Z2QA 3RTRB 2ZETC 4A0CD 5TABA 4A4CA 1JM7A 2YSJA 4C9ZA 5LKXA 5LKZA 5I3LA 3ZPVE 2QICA 3LQIA 5LKTA 2MNYA 3KV6A 2YURA 2KWKA 4YATA 2YQMA 2VP7A 2ECVA 3ZPV1 2G45A 4AVXA 5EYAF 2VJFB 2KWNA 2JMIA 2K16A 4I7BA 5LKUA 2CSYA 3I2DA 2KE1A 3GL6A 1X4JA 4R7EA 4UP5A 5H1UA 2M6MA 4CCGX 3V43A 4ZQLA 4FO9A 4LKAA 4LADB 5B75A 4AYCB 5KH3A 3HCTA 1WEUA 2Y1NA 2L0BA 4BBQA 3U5MA 2F42A 4FIPA 2YUCA 4YADA 3DPLR 1FBVA 5H1TA 2ECWA 4A49A 1WILA 1T1HA 4LK9A 2H0DB 1MM3A 4UP0A 2JMDA 2MIQA 5D1KB 2CKLB 1VYXA 2VJFA 1CHCA 3O70A 2IDAA 1HYJA 5D1LB 3C6WA 4IC2A 1WGMA 1DVPA 2YHOA 4FK5A 3M62A 4GB0A 1F62A 3RPGC 1MM2A 1WEWA 5TDWA 4L58A 2JRJA 3HCSA 4YC9A 2CSZA 3FL2A 1K2FA 2RI7A 2Y1MA 3DQVR 2L75A 2KWOA 1N87A 4MSXA 2LGGA 2LQ6A 2Y43A 3LQJA 4GNDA 3RPGB 4LLBA 4GNGA 5FB0A 2KR4A 3U5PA 1VD4A 1ZBDB 3ZVYA 2M85A 1WFKA 2M3HA 2K4DA 2YSMA 3O34A 1V87A 2FUIA 2YYRA 5G05B 4QF3A 3SOWA 5LCWB 2K17A 2F6JA 2XB1A 2ECGA 2KGGA 2MA5A 3N9MA 3L1XA 3O36A 2YT5A 4QF2A 2ECJA 3L1ZB 1WEOA 2PUYA 2XEUA 4WZ2A 2LGVA 5D1MB 3ZNIA 4LJNA 3EB5A 2G43A 4XI1A 2L5UA 2YHNA 4AYCA 2BAYA 2MT5A 5TDRA 5JG6A 4R2YA 5C11A 1HYIA 2AN6A 5J3XA 2E6SA 3PUQA 4BHWA 2M1RA 2F6NA 5C13A 3ZTGA 3N9LA 4GNEA 4YAXA 1G25A 3KQIA 5TBNA 4FJCA 4S3OB 2DX8A 2YU4A 1JOCA 1WIMA 3IHPA 4UI9B 3M63A 3SHBA 4V3LC 2CKLA 2YREA 4I7DA 4PPEA 4AUQB 4CA1A 3C5KA 5B77A 1FP0A 3O35A 1Z6UA 4P5OB 3SOUA 2KIZA 2ECIA 3NG2A 3T7LA 2ECTA 2KREA 4WA6A 2KYUA 2VPGA 5B76A 4O64A 5G0FA 2C2LA 4IC3A 4V3KC 1JM7B 2RSDA 1WEVA 1WEPA 5DINA 2E6RA 3SOXA 3O37A 1WENA 3U5OA 1VFYA 1Z60A 4WZ0A 2YQLA 2VJEB 2LGLA 4YABA 2LRIC 2MD8C 3VK6A 1E4UA 5FERA 2KFTA 2FUUA 3KNVA 2JMJA 2LDRA 4YBMA 5AITA 1RMDA 1BORA 4R8PK 3HTKC 2I50A 2C2VS 2LXHC 4TKPB 2KU3A 4X3GA 4ZDTA 2D8SA 2UZGA 2VPDA 4Q6FA 2LGKA 1XWHA 2L80A 3N9PA 3PURA 1WEQA 2OXQC 2LXPC 2CT2A 2K1JA 3ASLA 4GNFA 3LQHA 4WZ3B 2LN0A 2KGIA 2EODA 3N9QA 2VPEA 2VNFA 4ZUXU 1IYMA 5B78A 1WEEA 1LDKC 1WEMA 1X4IA 5TRBA 1WESA 4N3WA 2ECNA 4B7YC 4A4BA 3ZVZB 2EGPA 2VPBA 3MHHA 4F52B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9N A;  2NAA A;  5KH7 A;  4YBS A;  3QZV A;  2PNX A;  5FEY A;  1WE9 A;  4MVT A;  2EA6 A;  5B79 A;  4AP4 A;  3PHD A;  4NN2 A;  3T6R A;  2HDP A;  1U6G B;  4PTB A;  3O7A A;  2QJ0 A;  2HYE D;  2MA6 A;  5H1V A;  5G04 B;  4B86 C;  3MHS A;  5FB1 A;  3EB6 A;  2MD7 B;  2VJE A;  4W4U A;  2H0D A;  1LDJ B;  2LV9 A;  3O33 A;  5DKA A;  4I7C A;  2KWJ A;  3GV4 A;  3L11 A;  3LRQ A;  2MNZ A;  3KV5 A;  4S3O C;  3N9O A;  3M99 A;  3ZYQ A;  5AIU A;  5KH9 A;  4L7X A;  2YW8 A;  4N4F A;  5H9M A;  3U5N A;  2MUM A;  4YBT A;  2QIZ A;  5B8D A;  3HCU A;  2FSA A;  2G6Q A;  1X4U A;  2L43 A;  1Z2Q A;  3RTR B;  2ZET C;  4A0C D;  5TAB A;  4A4C A;  1JM7 A;  2YSJ A;  4C9Z A;  5LKX A;  5LKZ A;  5I3L A;  3ZPV E;  2QIC A;  3LQI A;  5LKT A;  2MNY A;  3KV6 A;  2YUR A;  2KWK A;  4YAT A;  2YQM A;  2VP7 A;  2ECV A;  3ZPV 1;  2G45 A;  4AVX A;  5EYA F;  2VJF B;  2KWN A;  2JMI A;  2K16 A;  4I7B A;  5LKU A;  2CSY A;  3I2D A;  2KE1 A;  3GL6 A;  1X4J A;  4R7E A;  4UP5 A;  5H1U A;  2M6M A;  4CCG X;  3V43 A;  4ZQL A;  4FO9 A;  4LKA A;  4LAD B;  5B75 A;  4AYC B;  5KH3 A;  3HCT A;  1WEU A;  2Y1N A;  2L0B A;  4BBQ A;  3U5M A;  2F42 A;  4FIP A;  2YUC A;  4YAD A;  3DPL R;  1FBV A;  5H1T A;  2ECW A;  4A49 A;  1WIL A;  1T1H A;  4LK9 A;  2H0D B;  1MM3 A;  4UP0 A;  2JMD A;  2MIQ A;  5D1K B;  2CKL B;  1VYX A;  2VJF A;  1CHC A;  3O70 A;  2IDA A;  1HYJ A;  5D1L B;  3C6W A;  4IC2 A;  1WGM A;  1DVP A;  2YHO A;  4FK5 A;  3M62 A;  4GB0 A;  1F62 A;  3RPG C;  1MM2 A;  1WEW A;  5TDW A;  4L58 A;  2JRJ A;  3HCS A;  4YC9 A;  2CSZ A;  3FL2 A;  1K2F A;  2RI7 A;  2Y1M A;  3DQV R;  2L75 A;  2KWO A;  1N87 A;  4MSX A;  2LGG A;  2LQ6 A;  2Y43 A;  3LQJ A;  4GND A;  3RPG B;  4LLB A;  4GNG A;  5FB0 A;  2KR4 A;  3U5P A;  1VD4 A;  1ZBD B;  3ZVY A;  2M85 A;  1WFK A;  2M3H A;  2K4D A;  2YSM A;  3O34 A;  1V87 A;  2FUI A;  2YYR A;  5G05 B;  4QF3 A;  3SOW A;  5LCW B;  2K17 A;  2F6J A;  2XB1 A;  2ECG A;  2KGG A;  2MA5 A;  3N9M A;  3L1X A;  3O36 A;  2YT5 A;  4QF2 A;  2ECJ A;  3L1Z B;  1WEO A;  2PUY A;  2XEU A;  4WZ2 A;  2LGV A;  5D1M B;  3ZNI A;  4LJN A;  3EB5 A;  2G43 A;  4XI1 A;  2L5U A;  2YHN A;  4AYC A;  2BAY A;  2MT5 A;  5TDR A;  5JG6 A;  4R2Y A;  5C11 A;  1HYI A;  2AN6 A;  5J3X A;  2E6S A;  3PUQ A;  4BHW A;  2M1R A;  2F6N A;  5C13 A;  3ZTG A;  3N9L A;  4GNE A;  4YAX A;  1G25 A;  3KQI A;  5TBN A;  4FJC A;  4S3O B;  2DX8 A;  2YU4 A;  1JOC A;  1WIM A;  3IHP A;  4UI9 B;  3M63 A;  3SHB A;  4V3L C;  2CKL A;  2YRE A;  4I7D A;  4PPE A;  4AUQ B;  4CA1 A;  3C5K A;  5B77 A;  1FP0 A;  3O35 A;  1Z6U A;  4P5O B;  3SOU A;  2KIZ A;  2ECI A;  3NG2 A;  3T7L A;  2ECT A;  2KRE A;  4WA6 A;  2KYU A;  2VPG A;  5B76 A;  4O64 A;  5G0F A;  2C2L A;  4IC3 A;  4V3K C;  1JM7 B;  2RSD A;  1WEV A;  1WEP A;  5DIN A;  2E6R A;  3SOX A;  3O37 A;  1WEN A;  3U5O A;  1VFY A;  1Z60 A;  4WZ0 A;  2YQL A;  2VJE B;  2LGL A;  4YAB A;  2LRI C;  2MD8 C;  3VK6 A;  1E4U A;  5FER A;  2KFT A;  2FUU A;  3KNV A;  2JMJ A;  2LDR A;  4YBM A;  5AIT A;  1RMD A;  1BOR A;  4R8P K;  3HTK C;  2I50 A;  2C2V S;  2LXH C;  4TKP B;  2KU3 A;  4X3G A;  4ZDT A;  2D8S A;  2UZG A;  2VPD A;  4Q6F A;  2LGK A;  1XWH A;  2L80 A;  3N9P A;  3PUR A;  1WEQ A;  2OXQ C;  2LXP C;  2CT2 A;  2K1J A;  3ASL A;  4GNF A;  3LQH A;  4WZ3 B;  2LN0 A;  2KGI A;  2EOD A;  3N9Q A;  2VPE A;  2VNF A;  4ZUX U;  1IYM A;  5B78 A;  1WEE A;  1LDK C;  1WEM A;  1X4I A;  5TRB A;  1WES A;  4N3W A;  2ECN A;  4B7Y C;  4A4B A;  3ZVZ B;  2EGP A;  2VPB A;  3MHH A;  4F52 B; 
#chains in the Genus database with same CATH topology
 3N9N A;  2OWA A;  2NAA A;  5KH7 A;  4YBS A;  3QZV A;  2PNX A;  5FEY A;  1WE9 A;  4MVT A;  2EA6 A;  5B79 A;  4AP4 A;  3PHD A;  3JUE A;  4NN2 A;  3T6R A;  2HDP A;  1U6G B;  4PTB A;  3O7A A;  2QJ0 A;  2HYE D;  2MA6 A;  5H1V A;  5G04 B;  4B86 C;  3MHS A;  5FB1 A;  3EB6 A;  2MD7 B;  2VJE A;  2EGM A;  2CSV A;  4W4U A;  2H0D A;  1LDJ B;  2LV9 A;  3O33 A;  1DCQ A;  5DKA A;  4I7C A;  2KWJ A;  3GV4 A;  2XP0 A;  3L11 A;  3LRQ A;  2DSM A;  2MNZ A;  3KV5 A;  5SVY A;  3FJU B;  4S3O C;  3N9O A;  3M99 A;  5AIU A;  3ZYQ A;  5KH9 A;  4L7X A;  4Z0O A;  2YW8 A;  4N4F A;  5H9M A;  3U5N A;  2MUM A;  4YBT A;  2QIZ A;  2EXU A;  5B8D A;  3HCU A;  2FSA A;  2G6Q A;  1X4U A;  2L43 A;  1Z2Q A;  2FD4 A;  3RTR B;  2ZET C;  4A0C D;  5TAB A;  4A4C A;  2KKX A;  1JM7 A;  2XOZ A;  2YSJ A;  4C9Z A;  5LKX A;  2E61 A;  5LKZ A;  5I3L A;  3ZPV E;  2JUN A;  2QIC A;  3LQI A;  2YVR A;  5LKT A;  2MNY A;  3KV6 A;  2YUR A;  2KWK A;  4YAT A;  2YQM A;  2VP7 A;  2ECV A;  3ZPV 1;  2G45 A;  4AVX A;  2XOC A;  5EYA F;  2VJF B;  2KWN A;  2CON A;  3LDY A;  2JMI A;  2K16 A;  4I7B A;  4H9D A;  5LKU A;  2CSY A;  3I2D A;  2KE1 A;  2JM3 A;  3GL6 A;  1X4J A;  4R7E A;  4UP5 A;  5H1U A;  2M6M A;  4CCG X;  3V43 A;  4ZQL A;  5SVI B;  4FO9 A;  4LKA A;  2LAU A;  4OGE A;  4LAD B;  5B75 A;  4AYC B;  5KH3 A;  3HCT A;  1WEU A;  2Y1N A;  2L0B A;  3H7H A;  4BBQ A;  3U5M A;  2F42 A;  4FIP A;  2YUC A;  4YAD A;  3DPL R;  1FBV A;  5H1T A;  2ECW A;  4A49 A;  1WIL A;  1T1H A;  4LK9 A;  2H0D B;  3FM8 C;  1MM3 A;  4UP0 A;  2JMD A;  2MIQ A;  5D1K B;  2CKL B;  1VYX A;  3KDE C;  2VJF A;  1CHC A;  4F1P A;  3O70 A;  2IDA A;  1HYJ A;  3LJU X;  4OGC A;  5D1L B;  3C6W A;  4IC2 A;  1WGM A;  1DVP A;  2YHO A;  4FK5 A;  3M62 A;  4GB0 A;  1F62 A;  3RPG C;  1MM2 A;  1WEW A;  5TDW A;  4O62 A;  4L58 A;  2JRJ A;  3HCS A;  4YC9 A;  2CSZ A;  2B0O E;  3FL2 A;  1K2F A;  2RI7 A;  2Y1M A;  3DQV R;  2L75 A;  5SVX A;  2KWO A;  1N87 A;  4MSX A;  2LGG A;  2LQ6 A;  5SVI A;  2Y43 A;  3LQJ A;  4GND A;  3RPG B;  4LLB A;  4GNG A;  3LVR E;  5FB0 A;  2KR4 A;  3U5P A;  1VD4 A;  1ZBD B;  3ZVY A;  3E2D A;  2M85 A;  1WFK A;  2M3H A;  2K4D A;  2YSM A;  3O34 A;  1V87 A;  3FAN A;  2FUI A;  2YYR A;  5G05 B;  4QF3 A;  3SOW A;  4QQ4 A;  5LCW B;  2K17 A;  2F6J A;  2XB1 A;  2ECG A;  2KGG A;  2MA5 A;  3N9M A;  3L1X A;  2DJA A;  3O36 A;  2YT5 A;  2L7P A;  4QF2 A;  2ECJ A;  3L1Z B;  1WEO A;  2PUY A;  2XEU A;  4WZ2 A;  5D1M B;  3ZNI A;  4LJN A;  3EB5 A;  2G43 A;  3FAO A;  2L5U A;  4XI1 A;  2YHN A;  2XOY A;  4AYC A;  2BAY A;  2MT5 A;  5TDR A;  5JG6 A;  4R2Y A;  5C11 A;  1HYI A;  2AN6 A;  5J3X A;  3DDT A;  4Z0R A;  2CRR A;  2E6S A;  3PUQ A;  4BHW A;  2M1R A;  3DWD A;  2F6N A;  5C13 A;  2KKY A;  3ZTG A;  3N9L A;  4GNE A;  4YAX A;  1G25 A;  3KQI A;  5TBN A;  4FJC A;  4S3O B;  2DX8 A;  2YU4 A;  1JOC A;  1WIM A;  3IHP A;  4UI9 B;  3M63 A;  3SHB A;  4V3L C;  2CKL A;  2YRE A;  4I7D A;  4PPE A;  4AUQ B;  3LVQ E;  4CA1 A;  3C5K A;  5B77 A;  3T9K A;  1FP0 A;  3O35 A;  1Z6U A;  4P5O B;  3SOU A;  2KIZ A;  2ECI A;  3NG2 A;  3T7L A;  2ECT A;  2M13 A;  2KRE A;  4WA6 A;  2KYU A;  2VPG A;  1MBM A;  5B76 A;  4O64 A;  5G0F A;  2C2L A;  4IC3 A;  4V3K C;  1JM7 B;  2RSD A;  1WEV A;  1WEP A;  5DIN A;  2E6R A;  2MKE A;  3PLW A;  3SOX A;  3O37 A;  1WEN A;  3U5O A;  1VFY A;  1Z60 A;  4WZ0 A;  2YQL A;  2VJE B;  2LGL A;  2FFW A;  5K3Q A;  4YAB A;  2LRI C;  3MDB C;  2MD8 C;  3VK6 A;  1E4U A;  5FER A;  2CRW A;  2D8U A;  2KFT A;  2FUU A;  3KNV A;  2JMJ A;  2LDR A;  4YBM A;  5AIT A;  1RMD A;  1BOR A;  2IQJ A;  3O47 A;  4R8P K;  3HTK C;  2I50 A;  2C2V S;  2LXH C;  3FEH A;  4TKP B;  2KU3 A;  4X3G A;  2RR4 A;  4ZDT A;  2D8S A;  2UZG A;  2VPD A;  4Q6F A;  2LGK A;  1XWH A;  2L80 A;  3N9P A;  3PUR A;  1WEQ A;  2OXQ C;  2LXP C;  3M7K A;  2CT2 A;  2K1J A;  3ASL A;  4GNF A;  3LQH A;  4WZ3 B;  2LN0 A;  2KGI A;  2EOD A;  3N9Q A;  2VPE A;  2VNF A;  4ZUX U;  1IYM A;  3SUB A;  5B78 A;  2P57 A;  1WEE A;  1LDK C;  1WEM A;  1X4I A;  5TRB A;  3Q1D A;  1WES A;  4N3W A;  2ECN A;  3MHH A;  4B7Y C;  4A4B A;  3ZVZ B;  2EGP A;  2VPB A;  2LGV A;  4F52 B; 
#chains in the Genus database with same CATH homology
 3N9N A;  2NAA A;  5KH7 A;  4YBS A;  3QZV A;  2PNX A;  5FEY A;  1WE9 A;  4MVT A;  2EA6 A;  5B79 A;  4AP4 A;  3PHD A;  4NN2 A;  3T6R A;  2HDP A;  1U6G B;  4PTB A;  3O7A A;  2QJ0 A;  2HYE D;  2MA6 A;  5H1V A;  5G04 B;  4B86 C;  3MHS A;  5FB1 A;  3EB6 A;  2MD7 B;  2VJE A;  4W4U A;  2H0D A;  1LDJ B;  2LV9 A;  3O33 A;  5DKA A;  4I7C A;  2KWJ A;  3GV4 A;  3L11 A;  3LRQ A;  2MNZ A;  3KV5 A;  4S3O C;  3N9O A;  3M99 A;  3ZYQ A;  5AIU A;  5KH9 A;  4L7X A;  2YW8 A;  4N4F A;  5H9M A;  3U5N A;  2MUM A;  4YBT A;  2QIZ A;  5B8D A;  3HCU A;  2FSA A;  2G6Q A;  1X4U A;  2L43 A;  1Z2Q A;  3RTR B;  2ZET C;  4A0C D;  5TAB A;  4A4C A;  1JM7 A;  2YSJ A;  4C9Z A;  5LKX A;  5LKZ A;  5I3L A;  3ZPV E;  2QIC A;  3LQI A;  5LKT A;  2MNY A;  3KV6 A;  2YUR A;  2KWK A;  4YAT A;  2YQM A;  2VP7 A;  2ECV A;  3ZPV 1;  2G45 A;  4AVX A;  5EYA F;  2VJF B;  2KWN A;  2JMI A;  2K16 A;  4I7B A;  5LKU A;  2CSY A;  3I2D A;  2KE1 A;  3GL6 A;  1X4J A;  4R7E A;  4UP5 A;  5H1U A;  2M6M A;  4CCG X;  3V43 A;  4ZQL A;  4FO9 A;  4LKA A;  4LAD B;  5B75 A;  4AYC B;  5KH3 A;  3HCT A;  1WEU A;  2Y1N A;  2L0B A;  4BBQ A;  3U5M A;  2F42 A;  4FIP A;  2YUC A;  4YAD A;  3DPL R;  1FBV A;  5H1T A;  2ECW A;  4A49 A;  1WIL A;  1T1H A;  4LK9 A;  2H0D B;  1MM3 A;  4UP0 A;  2JMD A;  2MIQ A;  5D1K B;  2CKL B;  1VYX A;  2VJF A;  1CHC A;  3O70 A;  2IDA A;  1HYJ A;  5D1L B;  3C6W A;  4IC2 A;  1WGM A;  1DVP A;  2YHO A;  4FK5 A;  3M62 A;  4GB0 A;  1F62 A;  3RPG C;  1MM2 A;  1WEW A;  5TDW A;  4L58 A;  2JRJ A;  3HCS A;  4YC9 A;  2CSZ A;  3FL2 A;  1K2F A;  2RI7 A;  2Y1M A;  3DQV R;  2L75 A;  2KWO A;  1N87 A;  4MSX A;  2LGG A;  2LQ6 A;  2Y43 A;  3LQJ A;  4GND A;  3RPG B;  4LLB A;  4GNG A;  5FB0 A;  2KR4 A;  3U5P A;  1VD4 A;  1ZBD B;  3ZVY A;  2M85 A;  1WFK A;  2M3H A;  2K4D A;  2YSM A;  3O34 A;  1V87 A;  2FUI A;  2YYR A;  5G05 B;  4QF3 A;  3SOW A;  5LCW B;  2K17 A;  2F6J A;  2XB1 A;  2ECG A;  2KGG A;  2MA5 A;  3N9M A;  3L1X A;  3O36 A;  2YT5 A;  4QF2 A;  2ECJ A;  3L1Z B;  1WEO A;  2PUY A;  2XEU A;  4WZ2 A;  2LGV A;  5D1M B;  3ZNI A;  4LJN A;  3EB5 A;  2G43 A;  4XI1 A;  2L5U A;  2YHN A;  4AYC A;  2BAY A;  2MT5 A;  5TDR A;  5JG6 A;  4R2Y A;  5C11 A;  1HYI A;  2AN6 A;  5J3X A;  2E6S A;  3PUQ A;  4BHW A;  2M1R A;  2F6N A;  5C13 A;  3ZTG A;  3N9L A;  4GNE A;  4YAX A;  1G25 A;  3KQI A;  5TBN A;  4FJC A;  4S3O B;  2DX8 A;  2YU4 A;  1JOC A;  1WIM A;  3IHP A;  4UI9 B;  3M63 A;  3SHB A;  4V3L C;  2CKL A;  2YRE A;  4I7D A;  4PPE A;  4AUQ B;  4CA1 A;  3C5K A;  5B77 A;  1FP0 A;  3O35 A;  1Z6U A;  4P5O B;  3SOU A;  2KIZ A;  2ECI A;  3NG2 A;  3T7L A;  2ECT A;  2KRE A;  4WA6 A;  2KYU A;  2VPG A;  5B76 A;  4O64 A;  5G0F A;  2C2L A;  4IC3 A;  4V3K C;  1JM7 B;  2RSD A;  1WEV A;  1WEP A;  5DIN A;  2E6R A;  3SOX A;  3O37 A;  1WEN A;  3U5O A;  1VFY A;  1Z60 A;  4WZ0 A;  2YQL A;  2VJE B;  2LGL A;  4YAB A;  2LRI C;  2MD8 C;  3VK6 A;  1E4U A;  5FER A;  2KFT A;  2FUU A;  3KNV A;  2JMJ A;  2LDR A;  4YBM A;  5AIT A;  1RMD A;  1BOR A;  4R8P K;  3HTK C;  2I50 A;  2C2V S;  2LXH C;  4TKP B;  2KU3 A;  4X3G A;  4ZDT A;  2D8S A;  2UZG A;  2VPD A;  4Q6F A;  2LGK A;  1XWH A;  2L80 A;  3N9P A;  3PUR A;  1WEQ A;  2OXQ C;  2LXP C;  2CT2 A;  2K1J A;  3ASL A;  4GNF A;  3LQH A;  4WZ3 B;  2LN0 A;  2KGI A;  2EOD A;  3N9Q A;  2VPE A;  2VNF A;  4ZUX U;  1IYM A;  5B78 A;  1WEE A;  1LDK C;  1WEM A;  1X4I A;  5TRB A;  1WES A;  4N3W A;  2ECN A;  4B7Y C;  4A4B A;  3ZVZ B;  2EGP A;  2VPB A;  3MHH A;  4F52 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...