5EYAF

Trim25 ring domain in complex with ubc13-ub conjugate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
b'PLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQARPQLHKNTVLCNVVEQFLQADL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 N
publication title Mechanism of TRIM25 Catalytic Activation in the Antiviral RIG-I Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 21
structure length 76
sequence length 76
chains with identical sequence G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5eyaF00
4QF3A 1JM7A 5DKAA 3HTKC 2MUMA 4GNGA 5AITA 5KH9A 4AYCB 2ECTA 3EB6A 4S3OB 2ECGA 3SOWA 2C2VS 3T7LA 2FSAA 4B7YC 1E4UA 3C6WA 5AIUA 5B8DA 3PURA 4IC3A 3ZPV1 3ZPVE 5B79A 5D1LB 3ZVZB 5B75A 3RPGB 2LXPC 3VK6A 4YATA 3U5MA 4A49A 2YREA 1HYIA 3ZNIA 2YHNA 1LDJB 4R7EA 2Y43A 1DVPA 5FERA 3O37A 4V3LC 1T1HA 1X4IA 2HYED 5D1KB 3M99A 4L7XA 4FIPA 2JRJA 5TBNA 2YYRA 4MSXA 2UZGA 5G0FA 2KYUA 3KV5A 4QF2A 3GL6A 4GNDA 5TDRA 4V3KC 1WE9A 1WESA 1WEWA 2L80A 4LK9A 2M6MA 4I7DA 2L75A 2Y1MA 2LGLA 2LRIC 5LKTA 5J3XA 2LGVA 3O35A 2F6NA 5G04B 5FB1A 2MA5A 4YBMA 2CSZA 3N9OA 4Q6FA 4YAXA 3DQVR 2ECWA 2H0DA 5TABA 3N9QA 4I7CA 1WEOA 3KQIA 3KV6A 4AYCA 3V43A 1F62A 1VYXA 3LQIA 3M63A 4S3OC 3O7AA 2VPEA 2NAAA 1WEVA 3U5PA 2PNXA 5EYAF 4GB0A 1X4JA 4F52B 4AP4A 5LKZA 4YABA 3O36A 3SHBA 3RPGC 3MHHA 2YQMA 4FO9A 2YURA 2KGGA 4I7BA 4P5OB 2KWJA 2VJEB 4BHWA 1V87A 2D8SA 1JM7B 3HCTA 4N3WA 4W4UA 3N9LA 2RI7A 2L43A 2CKLA 2IDAA 1K2FA 2LGKA 5B77A 5JG6A 3GV4A 2ECNA 5KH7A 5H9MA 3HCSA 5TRBA 2G6QA 2VNFA 3IHPA 2YSMA 1WFKA 2K1JA 4PTBA 2QIZA 4CCGX 2KU3A 3MHSA 1JOCA 2KGIA 2F42A 2VJFA 4UI9B 4WZ2A 3NG2A 4C9ZA 2MIQA 4AUQB 3HCUA 2KFTA 2FUIA 2ZETC 1WEUA 2KE1A 4A4BA 2DX8A 4UP5A 2KWKA 2LV9A 1U6GB 3N9NA 2K17A 4N4FA 4AVXA 1ZBDB 5KH3A 3T6RA 1WEQA 2LQ6A 1IYMA 5TDWA 3L1ZB 2ECVA 4ZDTA 2XEUA 4O64A 1LDKC 2Y1NA 2MT5A 2YHOA 2VP7A 2M3HA 4TKPB 2MNYA 2E6SA 1RMDA 2QICA 5C11A 4A4CA 3L11A 2MNZA 2F6JA 3ZTGA 4B86C 1XWHA 4LADB 1Z2QA 1WEMA 2L0BA 2YU4A 4A0CD 1G25A 2MD7B 1WIMA 3C5KA 3ZVYA 5LKUA 3PUQA 3L1XA 4NN2A 2LN0A 3O70A 1WEEA 4LJNA 2K16A 1HYJA 2ECJA 2LDRA 5B78A 2YQLA 3ASLA 3SOXA 4CA1A 1CHCA 2KWOA 2M85A 2ECIA 5H1UA 4X3GA 2FUUA 2KR4A 3LQHA 1WENA 4UP0A 3DPLR 2KIZA 2QJ0A 2H0DB 3O33A 3M62A 2PUYA 5D1MB 5FB0A 3EB5A 2JMJA 2G45A 3QZVA 2VPGA 4YBSA 4YADA 1FBVA 5DINA 4FJCA 4PPEA 4WZ0A 5H1VA 4FK5A 4R2YA 4LKAA 1BORA 3PHDA 2EODA 2G43A 2HDPA 2KWNA 2M1RA 2JMDA 3LRQA 2AN6A 4GNFA 5G05B 4IC2A 1FP0A 4XI1A 4YBTA 2MD8C 3ZYQA 3LQJA 2E6RA 1WEPA 1Z60A 2EGPA 1MM2A 2MA6A 4ZQLA 2CKLB 3O34A 5I3LA 4WZ3B 2I50A 2EA6A 2K4DA 2VPDA 2YW8A 2VPBA 4YC9A 2CT2A 1WGMA 5C13A 3RTRB 5H1TA 2OXQC 2KREA 2L5UA 4WA6A 2VJFB 1WILA 4R8PK 4LLBA 2YUCA 4L58A 5B76A 2YT5A 4BBQA 4ZUXU 2BAYA 2LGGA 3SOUA 2LXHC 4MVTA 4GNEA 2YSJA 5LKXA 2RSDA 1VD4A 3N9PA 2JMIA 3I2DA 3U5NA 3N9MA 1Z6UA 3KNVA 1X4UA 2C2LA 3U5OA 1VFYA 1MM3A 2XB1A 2CSYA 5LCWB 3FL2A 2VJEA 5FEYA 1N87A
chains in the Genus database with same CATH superfamily
4QF3A 1JM7A 5DKAA 3HTKC 2M13A 2MUMA 4GNGA 5AITA 5KH9A 4AYCB 2ECTA 3EB6A 4S3OB 2ECGA 3E2DA 2OWAA 3SOWA 2C2VS 3FJUB 3T7LA 2FSAA 4B7YC 2IQJA 1E4UA 3C6WA 5AIUA 5B8DA 3PURA 3LVRE 4IC3A 4OGEA 3ZPV1 3ZPVE 5B79A 5D1LB 3ZVZB 5B75A 5SVXA 3RPGB 2LXPC 3VK6A 4YATA 3U5MA 4A49A 2YREA 1HYIA 3ZNIA 2YHNA 1LDJB 4R7EA 2Y43A 1DVPA 5FERA 3O37A 4V3LC 1T1HA 1X4IA 2HYED 5D1KB 3M99A 4L7XA 4FIPA 2JRJA 5TBNA 2YYRA 4MSXA 2UZGA 5G0FA 2KYUA 3KV5A 4QF2A 3GL6A 4GNDA 2CONA 5TDRA 4V3KC 1WE9A 1WESA 1WEWA 2L80A 4LK9A 2M6MA 4I7DA 2L75A 2Y1MA 2LGLA 2LRIC 5LKTA 5J3XA 3FM8C 2LGVA 3T9KA 2KKYA 3O35A 2F6NA 5G04B 5FB1A 2MA5A 4YBMA 2CSZA 3N9OA 4Q6FA 4YAXA 3DQVR 2P57A 2ECWA 2H0DA 5TABA 3N9QA 4I7CA 1WEOA 3KQIA 3LDYA 3KV6A 4AYCA 3V43A 1F62A 1VYXA 3LQIA 3H7HA 3M63A 4S3OC 3O7AA 2VPEA 2NAAA 1WEVA 3U5PA 2PNXA 3MDBC 5EYAF 2XOZA 4GB0A 1X4JA 2MKEA 3DWDA 4F52B 4AP4A 5LKZA 4YABA 3O36A 3SHBA 3RPGC 3MHHA 2YQMA 4FO9A 2YURA 2KGGA 4I7BA 4P5OB 2KWJA 2VJEB 4BHWA 1V87A 2D8SA 1JM7B 3HCTA 4N3WA 2YVRA 4W4UA 3N9LA 2RI7A 2L43A 2CKLA 2IDAA 1K2FA 2LGKA 5B77A 5JG6A 3GV4A 2ECNA 5KH7A 5H9MA 3HCSA 5TRBA 2G6QA 2VNFA 3IHPA 2YSMA 2XP0A 3KDEC 1WFKA 2E61A 2K1JA 4PTBA 2QIZA 4CCGX 2KU3A 3MHSA 1JOCA 2KGIA 2F42A 2VJFA 4UI9B 4WZ2A 3NG2A 4C9ZA 3DDTA 4H9DA 2FFWA 2MIQA 5SVIA 4AUQB 3HCUA 2KFTA 2D8UA 2FUIA 2ZETC 3PLWA 1WEUA 2KE1A 4A4BA 2DX8A 4UP5A 2KWKA 2LV9A 1U6GB 4OGCA 3N9NA 3Q1DA 2K17A 4N4FA 4AVXA 1ZBDB 5KH3A 3T6RA 1WEQA 3FAOA 2LQ6A 1IYMA 5TDWA 3L1ZB 2ECVA 4ZDTA 2XEUA 4O64A 1LDKC 1DCQA 2Y1NA 2MT5A 2YHOA 2VP7A 2L7PA 2M3HA 4TKPB 2MNYA 2E6SA 2CRRA 1RMDA 2QICA 5C11A 4A4CA 3L11A 2MNZA 2F6JA 3ZTGA 4B86C 1XWHA 4LADB 1Z2QA 1WEMA 2L0BA 2YU4A 4A0CD 1G25A 3LVQE 2MD7B 1WIMA 3C5KA 5SVYA 3ZVYA 5LKUA 3PUQA 3L1XA 4NN2A 2LN0A 3O70A 1WEEA 4LJNA 2K16A 3SUBA 2JUNA 1HYJA 2ECJA 2FD4A 2LDRA 5B78A 2YQLA 3FEHA 3LJUX 3ASLA 3SOXA 4CA1A 1CHCA 2KWOA 2M85A 2ECIA 5H1UA 4X3GA 2FUUA 2KR4A 3LQHA 1WENA 4UP0A 3DPLR 2KIZA 4O62A 2QJ0A 2H0DB 3O33A 3M62A 2PUYA 5D1MB 5FB0A 3EB5A 2JMJA 2G45A 3QZVA 2VPGA 4YBSA 4YADA 1FBVA 5DINA 4FJCA 4PPEA 1MBMA 2CRWA 4WZ0A 5H1VA 4FK5A 2LAUA 4R2YA 4LKAA 1BORA 3PHDA 2EODA 2G43A 2HDPA 2KWNA 2M1RA 2JMDA 3FANA 2EXUA 2B0OE 3LRQA 2AN6A 4GNFA 5G05B 4IC2A 1FP0A 4XI1A 4YBTA 2MD8C 3ZYQA 3LQJA 3JUEA 2E6RA 1WEPA 1Z60A 2EGPA 1MM2A 2MA6A 4ZQLA 2CKLB 2CSVA 3O34A 5I3LA 4WZ3B 2RR4A 2I50A 3O47A 2EA6A 2K4DA 2VPDA 2YW8A 2VPBA 4YC9A 4QQ4A 2CT2A 1WGMA 5C13A 3RTRB 4Z0RA 5H1TA 2OXQC 2KREA 2L5UA 4WA6A 2VJFB 1WILA 4R8PK 4LLBA 2YUCA 4L58A 5SVIB 2JM3A 5B76A 2YT5A 4BBQA 4ZUXU 2BAYA 2DJAA 2LGGA 3SOUA 2LXHC 4MVTA 4GNEA 2YSJA 5K3QA 5LKXA 2RSDA 4Z0OA 1VD4A 3N9PA 2JMIA 2KKXA 4F1PA 2XOCA 3I2DA 3U5NA 3N9MA 2EGMA 1Z6UA 3KNVA 1X4UA 2C2LA 3U5OA 1VFYA 1MM3A 2DSMA 3M7KA 2XB1A 2CSYA 2XOYA 5LCWB 3FL2A 2VJEA 5FEYA 1N87A
chains in the Genus database with same CATH topology
4QF3A 1JM7A 5DKAA 3HTKC 2MUMA 4GNGA 5AITA 5KH9A 4AYCB 2ECTA 3EB6A 4S3OB 2ECGA 3SOWA 2C2VS 3T7LA 2FSAA 4B7YC 1E4UA 3C6WA 5AIUA 5B8DA 3PURA 4IC3A 3ZPV1 3ZPVE 5B79A 5D1LB 3ZVZB 5B75A 3RPGB 2LXPC 3VK6A 4YATA 3U5MA 4A49A 2YREA 1HYIA 3ZNIA 2YHNA 1LDJB 4R7EA 2Y43A 1DVPA 5FERA 3O37A 4V3LC 1T1HA 1X4IA 2HYED 5D1KB 3M99A 4L7XA 4FIPA 2JRJA 5TBNA 2YYRA 4MSXA 2UZGA 5G0FA 2KYUA 3KV5A 4QF2A 3GL6A 4GNDA 5TDRA 4V3KC 1WE9A 1WESA 1WEWA 2L80A 4LK9A 2M6MA 4I7DA 2L75A 2Y1MA 2LGLA 2LRIC 5LKTA 5J3XA 2LGVA 3O35A 2F6NA 5G04B 5FB1A 2MA5A 4YBMA 2CSZA 3N9OA 4Q6FA 4YAXA 3DQVR 2ECWA 2H0DA 5TABA 3N9QA 4I7CA 1WEOA 3KQIA 3KV6A 4AYCA 3V43A 1F62A 1VYXA 3LQIA 3M63A 4S3OC 3O7AA 2VPEA 2NAAA 1WEVA 3U5PA 2PNXA 5EYAF 4GB0A 1X4JA 4F52B 4AP4A 5LKZA 4YABA 3O36A 3SHBA 3RPGC 3MHHA 2YQMA 4FO9A 2YURA 2KGGA 4I7BA 4P5OB 2KWJA 2VJEB 4BHWA 1V87A 2D8SA 1JM7B 3HCTA 4N3WA 4W4UA 3N9LA 2RI7A 2L43A 2CKLA 2IDAA 1K2FA 2LGKA 5B77A 5JG6A 3GV4A 2ECNA 5KH7A 5H9MA 3HCSA 5TRBA 2G6QA 2VNFA 3IHPA 2YSMA 1WFKA 2K1JA 4PTBA 2QIZA 4CCGX 2KU3A 3MHSA 1JOCA 2KGIA 2F42A 2VJFA 4UI9B 4WZ2A 3NG2A 4C9ZA 2MIQA 4AUQB 3HCUA 2KFTA 2FUIA 2ZETC 1WEUA 2KE1A 4A4BA 2DX8A 4UP5A 2KWKA 2LV9A 1U6GB 3N9NA 2K17A 4N4FA 4AVXA 1ZBDB 5KH3A 3T6RA 1WEQA 2LQ6A 1IYMA 5TDWA 3L1ZB 2ECVA 4ZDTA 2XEUA 4O64A 1LDKC 2Y1NA 2MT5A 2YHOA 2VP7A 2M3HA 4TKPB 2MNYA 2E6SA 1RMDA 2QICA 5C11A 4A4CA 3L11A 2MNZA 2F6JA 3ZTGA 4B86C 1XWHA 4LADB 1Z2QA 1WEMA 2L0BA 2YU4A 4A0CD 1G25A 2MD7B 1WIMA 3C5KA 3ZVYA 5LKUA 3PUQA 3L1XA 4NN2A 2LN0A 3O70A 1WEEA 4LJNA 2K16A 1HYJA 2ECJA 2LDRA 5B78A 2YQLA 3ASLA 3SOXA 4CA1A 1CHCA 2KWOA 2M85A 2ECIA 5H1UA 4X3GA 2FUUA 2KR4A 3LQHA 1WENA 4UP0A 3DPLR 2KIZA 2QJ0A 2H0DB 3O33A 3M62A 2PUYA 5D1MB 5FB0A 3EB5A 2JMJA 2G45A 3QZVA 2VPGA 4YBSA 4YADA 1FBVA 5DINA 4FJCA 4PPEA 4WZ0A 5H1VA 4FK5A 4R2YA 4LKAA 1BORA 3PHDA 2EODA 2G43A 2HDPA 2KWNA 2M1RA 2JMDA 3LRQA 2AN6A 4GNFA 5G05B 4IC2A 1FP0A 4XI1A 4YBTA 2MD8C 3ZYQA 3LQJA 2E6RA 1WEPA 1Z60A 2EGPA 1MM2A 2MA6A 4ZQLA 2CKLB 3O34A 5I3LA 4WZ3B 2I50A 2EA6A 2K4DA 2VPDA 2YW8A 2VPBA 4YC9A 2CT2A 1WGMA 5C13A 3RTRB 5H1TA 2OXQC 2KREA 2L5UA 4WA6A 2VJFB 1WILA 4R8PK 4LLBA 2YUCA 4L58A 5B76A 2YT5A 4BBQA 4ZUXU 2BAYA 2LGGA 3SOUA 2LXHC 4MVTA 4GNEA 2YSJA 5LKXA 2RSDA 1VD4A 3N9PA 2JMIA 3I2DA 3U5NA 3N9MA 1Z6UA 3KNVA 1X4UA 2C2LA 3U5OA 1VFYA 1MM3A 2XB1A 2CSYA 5LCWB 3FL2A 2VJEA 5FEYA 1N87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QF3 A;  1JM7 A;  5DKA A;  3HTK C;  2MUM A;  4GNG A;  5AIT A;  5KH9 A;  4AYC B;  2ECT A;  3EB6 A;  4S3O B;  2ECG A;  3SOW A;  2C2V S;  3T7L A;  2FSA A;  4B7Y C;  1E4U A;  3C6W A;  5AIU A;  5B8D A;  3PUR A;  4IC3 A;  3ZPV 1;  3ZPV E;  5B79 A;  5D1L B;  3ZVZ B;  5B75 A;  3RPG B;  2LXP C;  3VK6 A;  4YAT A;  3U5M A;  4A49 A;  2YRE A;  1HYI A;  3ZNI A;  2YHN A;  1LDJ B;  4R7E A;  2Y43 A;  1DVP A;  5FER A;  3O37 A;  4V3L C;  1T1H A;  1X4I A;  2HYE D;  5D1K B;  3M99 A;  4L7X A;  4FIP A;  2JRJ A;  5TBN A;  2YYR A;  4MSX A;  2UZG A;  5G0F A;  2KYU A;  3KV5 A;  4QF2 A;  3GL6 A;  4GND A;  5TDR A;  4V3K C;  1WE9 A;  1WES A;  1WEW A;  2L80 A;  4LK9 A;  2M6M A;  4I7D A;  2L75 A;  2Y1M A;  2LGL A;  2LRI C;  5LKT A;  5J3X A;  2LGV A;  3O35 A;  2F6N A;  5G04 B;  5FB1 A;  2MA5 A;  4YBM A;  2CSZ A;  3N9O A;  4Q6F A;  4YAX A;  3DQV R;  2ECW A;  2H0D A;  5TAB A;  3N9Q A;  4I7C A;  1WEO A;  3KQI A;  3KV6 A;  4AYC A;  3V43 A;  1F62 A;  1VYX A;  3LQI A;  3M63 A;  4S3O C;  3O7A A;  2VPE A;  2NAA A;  1WEV A;  3U5P A;  2PNX A;  5EYA F;  4GB0 A;  1X4J A;  4F52 B;  4AP4 A;  5LKZ A;  4YAB A;  3O36 A;  3SHB A;  3RPG C;  3MHH A;  2YQM A;  4FO9 A;  2YUR A;  2KGG A;  4I7B A;  4P5O B;  2KWJ A;  2VJE B;  4BHW A;  1V87 A;  2D8S A;  1JM7 B;  3HCT A;  4N3W A;  4W4U A;  3N9L A;  2RI7 A;  2L43 A;  2CKL A;  2IDA A;  1K2F A;  2LGK A;  5B77 A;  5JG6 A;  3GV4 A;  2ECN A;  5KH7 A;  5H9M A;  3HCS A;  5TRB A;  2G6Q A;  2VNF A;  3IHP A;  2YSM A;  1WFK A;  2K1J A;  4PTB A;  2QIZ A;  4CCG X;  2KU3 A;  3MHS A;  1JOC A;  2KGI A;  2F42 A;  2VJF A;  4UI9 B;  4WZ2 A;  3NG2 A;  4C9Z A;  2MIQ A;  4AUQ B;  3HCU A;  2KFT A;  2FUI A;  2ZET C;  1WEU A;  2KE1 A;  4A4B A;  2DX8 A;  4UP5 A;  2KWK A;  2LV9 A;  1U6G B;  3N9N A;  2K17 A;  4N4F A;  4AVX A;  1ZBD B;  5KH3 A;  3T6R A;  1WEQ A;  2LQ6 A;  1IYM A;  5TDW A;  3L1Z B;  2ECV A;  4ZDT A;  2XEU A;  4O64 A;  1LDK C;  2Y1N A;  2MT5 A;  2YHO A;  2VP7 A;  2M3H A;  4TKP B;  2MNY A;  2E6S A;  1RMD A;  2QIC A;  5C11 A;  4A4C A;  3L11 A;  2MNZ A;  2F6J A;  3ZTG A;  4B86 C;  1XWH A;  4LAD B;  1Z2Q A;  1WEM A;  2L0B A;  2YU4 A;  4A0C D;  1G25 A;  2MD7 B;  1WIM A;  3C5K A;  3ZVY A;  5LKU A;  3PUQ A;  3L1X A;  4NN2 A;  2LN0 A;  3O70 A;  1WEE A;  4LJN A;  2K16 A;  1HYJ A;  2ECJ A;  2LDR A;  5B78 A;  2YQL A;  3ASL A;  3SOX A;  4CA1 A;  1CHC A;  2KWO A;  2M85 A;  2ECI A;  5H1U A;  4X3G A;  2FUU A;  2KR4 A;  3LQH A;  1WEN A;  4UP0 A;  3DPL R;  2KIZ A;  2QJ0 A;  2H0D B;  3O33 A;  3M62 A;  2PUY A;  5D1M B;  5FB0 A;  3EB5 A;  2JMJ A;  2G45 A;  3QZV A;  2VPG A;  4YBS A;  4YAD A;  1FBV A;  5DIN A;  4FJC A;  4PPE A;  4WZ0 A;  5H1V A;  4FK5 A;  4R2Y A;  4LKA A;  1BOR A;  3PHD A;  2EOD A;  2G43 A;  2HDP A;  2KWN A;  2M1R A;  2JMD A;  3LRQ A;  2AN6 A;  4GNF A;  5G05 B;  4IC2 A;  1FP0 A;  4XI1 A;  4YBT A;  2MD8 C;  3ZYQ A;  3LQJ A;  2E6R A;  1WEP A;  1Z60 A;  2EGP A;  1MM2 A;  2MA6 A;  4ZQL A;  2CKL B;  3O34 A;  5I3L A;  4WZ3 B;  2I50 A;  2EA6 A;  2K4D A;  2VPD A;  2YW8 A;  2VPB A;  4YC9 A;  2CT2 A;  1WGM A;  5C13 A;  3RTR B;  5H1T A;  2OXQ C;  2KRE A;  2L5U A;  4WA6 A;  2VJF B;  1WIL A;  4R8P K;  4LLB A;  2YUC A;  4L58 A;  5B76 A;  2YT5 A;  4BBQ A;  4ZUX U;  2BAY A;  2LGG A;  3SOU A;  2LXH C;  4MVT A;  4GNE A;  2YSJ A;  5LKX A;  2RSD A;  1VD4 A;  3N9P A;  2JMI A;  3I2D A;  3U5N A;  3N9M A;  1Z6U A;  3KNV A;  1X4U A;  2C2L A;  3U5O A;  1VFY A;  1MM3 A;  2XB1 A;  2CSY A;  5LCW B;  3FL2 A;  2VJE A;  5FEY A;  1N87 A; 
#chains in the Genus database with same CATH topology
 4QF3 A;  1JM7 A;  5DKA A;  3HTK C;  2M13 A;  2MUM A;  4GNG A;  5AIT A;  5KH9 A;  4AYC B;  2ECT A;  3EB6 A;  4S3O B;  2ECG A;  3E2D A;  2OWA A;  3SOW A;  2C2V S;  3FJU B;  3T7L A;  2FSA A;  4B7Y C;  2IQJ A;  1E4U A;  3C6W A;  5AIU A;  5B8D A;  3PUR A;  3LVR E;  4IC3 A;  4OGE A;  3ZPV 1;  3ZPV E;  5B79 A;  5D1L B;  3ZVZ B;  5B75 A;  5SVX A;  3RPG B;  2LXP C;  3VK6 A;  4YAT A;  3U5M A;  4A49 A;  2YRE A;  1HYI A;  3ZNI A;  2YHN A;  1LDJ B;  4R7E A;  2Y43 A;  1DVP A;  5FER A;  3O37 A;  4V3L C;  1T1H A;  1X4I A;  2HYE D;  5D1K B;  3M99 A;  4L7X A;  4FIP A;  2JRJ A;  5TBN A;  2YYR A;  4MSX A;  2UZG A;  5G0F A;  2KYU A;  3KV5 A;  4QF2 A;  3GL6 A;  4GND A;  2CON A;  5TDR A;  4V3K C;  1WE9 A;  1WES A;  1WEW A;  2L80 A;  4LK9 A;  2M6M A;  4I7D A;  2L75 A;  2Y1M A;  2LGL A;  2LRI C;  5LKT A;  5J3X A;  3FM8 C;  2LGV A;  3T9K A;  2KKY A;  3O35 A;  2F6N A;  5G04 B;  5FB1 A;  2MA5 A;  4YBM A;  2CSZ A;  3N9O A;  4Q6F A;  4YAX A;  3DQV R;  2P57 A;  2ECW A;  2H0D A;  5TAB A;  3N9Q A;  4I7C A;  1WEO A;  3KQI A;  3LDY A;  3KV6 A;  4AYC A;  3V43 A;  1F62 A;  1VYX A;  3LQI A;  3H7H A;  3M63 A;  4S3O C;  3O7A A;  2VPE A;  2NAA A;  1WEV A;  3U5P A;  2PNX A;  3MDB C;  5EYA F;  2XOZ A;  4GB0 A;  1X4J A;  2MKE A;  3DWD A;  4F52 B;  4AP4 A;  5LKZ A;  4YAB A;  3O36 A;  3SHB A;  3RPG C;  3MHH A;  2YQM A;  4FO9 A;  2YUR A;  2KGG A;  4I7B A;  4P5O B;  2KWJ A;  2VJE B;  4BHW A;  1V87 A;  2D8S A;  1JM7 B;  3HCT A;  4N3W A;  2YVR A;  4W4U A;  3N9L A;  2RI7 A;  2L43 A;  2CKL A;  2IDA A;  1K2F A;  2LGK A;  5B77 A;  5JG6 A;  3GV4 A;  2ECN A;  5KH7 A;  5H9M A;  3HCS A;  5TRB A;  2G6Q A;  2VNF A;  3IHP A;  2YSM A;  2XP0 A;  3KDE C;  1WFK A;  2E61 A;  2K1J A;  4PTB A;  2QIZ A;  4CCG X;  2KU3 A;  3MHS A;  1JOC A;  2KGI A;  2F42 A;  2VJF A;  4UI9 B;  4WZ2 A;  3NG2 A;  4C9Z A;  3DDT A;  4H9D A;  2FFW A;  2MIQ A;  5SVI A;  4AUQ B;  3HCU A;  2KFT A;  2D8U A;  2FUI A;  2ZET C;  3PLW A;  1WEU A;  2KE1 A;  4A4B A;  2DX8 A;  4UP5 A;  2KWK A;  2LV9 A;  1U6G B;  4OGC A;  3N9N A;  3Q1D A;  2K17 A;  4N4F A;  4AVX A;  1ZBD B;  5KH3 A;  3T6R A;  1WEQ A;  3FAO A;  2LQ6 A;  1IYM A;  5TDW A;  3L1Z B;  2ECV A;  4ZDT A;  2XEU A;  4O64 A;  1LDK C;  1DCQ A;  2Y1N A;  2MT5 A;  2YHO A;  2VP7 A;  2L7P A;  2M3H A;  4TKP B;  2MNY A;  2E6S A;  2CRR A;  1RMD A;  2QIC A;  5C11 A;  4A4C A;  3L11 A;  2MNZ A;  2F6J A;  3ZTG A;  4B86 C;  1XWH A;  4LAD B;  1Z2Q A;  1WEM A;  2L0B A;  2YU4 A;  4A0C D;  1G25 A;  3LVQ E;  2MD7 B;  1WIM A;  3C5K A;  5SVY A;  3ZVY A;  5LKU A;  3PUQ A;  3L1X A;  4NN2 A;  2LN0 A;  3O70 A;  1WEE A;  4LJN A;  2K16 A;  3SUB A;  2JUN A;  1HYJ A;  2ECJ A;  2FD4 A;  2LDR A;  5B78 A;  2YQL A;  3FEH A;  3LJU X;  3ASL A;  3SOX A;  4CA1 A;  1CHC A;  2KWO A;  2M85 A;  2ECI A;  5H1U A;  4X3G A;  2FUU A;  2KR4 A;  3LQH A;  1WEN A;  4UP0 A;  3DPL R;  2KIZ A;  4O62 A;  2QJ0 A;  2H0D B;  3O33 A;  3M62 A;  2PUY A;  5D1M B;  5FB0 A;  3EB5 A;  2JMJ A;  2G45 A;  3QZV A;  2VPG A;  4YBS A;  4YAD A;  1FBV A;  5DIN A;  4FJC A;  4PPE A;  1MBM A;  2CRW A;  4WZ0 A;  5H1V A;  4FK5 A;  2LAU A;  4R2Y A;  4LKA A;  1BOR A;  3PHD A;  2EOD A;  2G43 A;  2HDP A;  2KWN A;  2M1R A;  2JMD A;  3FAN A;  2EXU A;  2B0O E;  3LRQ A;  2AN6 A;  4GNF A;  5G05 B;  4IC2 A;  1FP0 A;  4XI1 A;  4YBT A;  2MD8 C;  3ZYQ A;  3LQJ A;  3JUE A;  2E6R A;  1WEP A;  1Z60 A;  2EGP A;  1MM2 A;  2MA6 A;  4ZQL A;  2CKL B;  2CSV A;  3O34 A;  5I3L A;  4WZ3 B;  2RR4 A;  2I50 A;  3O47 A;  2EA6 A;  2K4D A;  2VPD A;  2YW8 A;  2VPB A;  4YC9 A;  4QQ4 A;  2CT2 A;  1WGM A;  5C13 A;  3RTR B;  4Z0R A;  5H1T A;  2OXQ C;  2KRE A;  2L5U A;  4WA6 A;  2VJF B;  1WIL A;  4R8P K;  4LLB A;  2YUC A;  4L58 A;  5SVI B;  2JM3 A;  5B76 A;  2YT5 A;  4BBQ A;  4ZUX U;  2BAY A;  2DJA A;  2LGG A;  3SOU A;  2LXH C;  4MVT A;  4GNE A;  2YSJ A;  5K3Q A;  5LKX A;  2RSD A;  4Z0O A;  1VD4 A;  3N9P A;  2JMI A;  2KKX A;  4F1P A;  2XOC A;  3I2D A;  3U5N A;  3N9M A;  2EGM A;  1Z6U A;  3KNV A;  1X4U A;  2C2L A;  3U5O A;  1VFY A;  1MM3 A;  2DSM A;  3M7K A;  2XB1 A;  2CSY A;  2XOY A;  5LCW B;  3FL2 A;  2VJE A;  5FEY A;  1N87 A; 
#chains in the Genus database with same CATH homology
 4QF3 A;  1JM7 A;  5DKA A;  3HTK C;  2MUM A;  4GNG A;  5AIT A;  5KH9 A;  4AYC B;  2ECT A;  3EB6 A;  4S3O B;  2ECG A;  3SOW A;  2C2V S;  3T7L A;  2FSA A;  4B7Y C;  1E4U A;  3C6W A;  5AIU A;  5B8D A;  3PUR A;  4IC3 A;  3ZPV 1;  3ZPV E;  5B79 A;  5D1L B;  3ZVZ B;  5B75 A;  3RPG B;  2LXP C;  3VK6 A;  4YAT A;  3U5M A;  4A49 A;  2YRE A;  1HYI A;  3ZNI A;  2YHN A;  1LDJ B;  4R7E A;  2Y43 A;  1DVP A;  5FER A;  3O37 A;  4V3L C;  1T1H A;  1X4I A;  2HYE D;  5D1K B;  3M99 A;  4L7X A;  4FIP A;  2JRJ A;  5TBN A;  2YYR A;  4MSX A;  2UZG A;  5G0F A;  2KYU A;  3KV5 A;  4QF2 A;  3GL6 A;  4GND A;  5TDR A;  4V3K C;  1WE9 A;  1WES A;  1WEW A;  2L80 A;  4LK9 A;  2M6M A;  4I7D A;  2L75 A;  2Y1M A;  2LGL A;  2LRI C;  5LKT A;  5J3X A;  2LGV A;  3O35 A;  2F6N A;  5G04 B;  5FB1 A;  2MA5 A;  4YBM A;  2CSZ A;  3N9O A;  4Q6F A;  4YAX A;  3DQV R;  2ECW A;  2H0D A;  5TAB A;  3N9Q A;  4I7C A;  1WEO A;  3KQI A;  3KV6 A;  4AYC A;  3V43 A;  1F62 A;  1VYX A;  3LQI A;  3M63 A;  4S3O C;  3O7A A;  2VPE A;  2NAA A;  1WEV A;  3U5P A;  2PNX A;  5EYA F;  4GB0 A;  1X4J A;  4F52 B;  4AP4 A;  5LKZ A;  4YAB A;  3O36 A;  3SHB A;  3RPG C;  3MHH A;  2YQM A;  4FO9 A;  2YUR A;  2KGG A;  4I7B A;  4P5O B;  2KWJ A;  2VJE B;  4BHW A;  1V87 A;  2D8S A;  1JM7 B;  3HCT A;  4N3W A;  4W4U A;  3N9L A;  2RI7 A;  2L43 A;  2CKL A;  2IDA A;  1K2F A;  2LGK A;  5B77 A;  5JG6 A;  3GV4 A;  2ECN A;  5KH7 A;  5H9M A;  3HCS A;  5TRB A;  2G6Q A;  2VNF A;  3IHP A;  2YSM A;  1WFK A;  2K1J A;  4PTB A;  2QIZ A;  4CCG X;  2KU3 A;  3MHS A;  1JOC A;  2KGI A;  2F42 A;  2VJF A;  4UI9 B;  4WZ2 A;  3NG2 A;  4C9Z A;  2MIQ A;  4AUQ B;  3HCU A;  2KFT A;  2FUI A;  2ZET C;  1WEU A;  2KE1 A;  4A4B A;  2DX8 A;  4UP5 A;  2KWK A;  2LV9 A;  1U6G B;  3N9N A;  2K17 A;  4N4F A;  4AVX A;  1ZBD B;  5KH3 A;  3T6R A;  1WEQ A;  2LQ6 A;  1IYM A;  5TDW A;  3L1Z B;  2ECV A;  4ZDT A;  2XEU A;  4O64 A;  1LDK C;  2Y1N A;  2MT5 A;  2YHO A;  2VP7 A;  2M3H A;  4TKP B;  2MNY A;  2E6S A;  1RMD A;  2QIC A;  5C11 A;  4A4C A;  3L11 A;  2MNZ A;  2F6J A;  3ZTG A;  4B86 C;  1XWH A;  4LAD B;  1Z2Q A;  1WEM A;  2L0B A;  2YU4 A;  4A0C D;  1G25 A;  2MD7 B;  1WIM A;  3C5K A;  3ZVY A;  5LKU A;  3PUQ A;  3L1X A;  4NN2 A;  2LN0 A;  3O70 A;  1WEE A;  4LJN A;  2K16 A;  1HYJ A;  2ECJ A;  2LDR A;  5B78 A;  2YQL A;  3ASL A;  3SOX A;  4CA1 A;  1CHC A;  2KWO A;  2M85 A;  2ECI A;  5H1U A;  4X3G A;  2FUU A;  2KR4 A;  3LQH A;  1WEN A;  4UP0 A;  3DPL R;  2KIZ A;  2QJ0 A;  2H0D B;  3O33 A;  3M62 A;  2PUY A;  5D1M B;  5FB0 A;  3EB5 A;  2JMJ A;  2G45 A;  3QZV A;  2VPG A;  4YBS A;  4YAD A;  1FBV A;  5DIN A;  4FJC A;  4PPE A;  4WZ0 A;  5H1V A;  4FK5 A;  4R2Y A;  4LKA A;  1BOR A;  3PHD A;  2EOD A;  2G43 A;  2HDP A;  2KWN A;  2M1R A;  2JMD A;  3LRQ A;  2AN6 A;  4GNF A;  5G05 B;  4IC2 A;  1FP0 A;  4XI1 A;  4YBT A;  2MD8 C;  3ZYQ A;  3LQJ A;  2E6R A;  1WEP A;  1Z60 A;  2EGP A;  1MM2 A;  2MA6 A;  4ZQL A;  2CKL B;  3O34 A;  5I3L A;  4WZ3 B;  2I50 A;  2EA6 A;  2K4D A;  2VPD A;  2YW8 A;  2VPB A;  4YC9 A;  2CT2 A;  1WGM A;  5C13 A;  3RTR B;  5H1T A;  2OXQ C;  2KRE A;  2L5U A;  4WA6 A;  2VJF B;  1WIL A;  4R8P K;  4LLB A;  2YUC A;  4L58 A;  5B76 A;  2YT5 A;  4BBQ A;  4ZUX U;  2BAY A;  2LGG A;  3SOU A;  2LXH C;  4MVT A;  4GNE A;  2YSJ A;  5LKX A;  2RSD A;  1VD4 A;  3N9P A;  2JMI A;  3I2D A;  3U5N A;  3N9M A;  1Z6U A;  3KNV A;  1X4U A;  2C2L A;  3U5O A;  1VFY A;  1MM3 A;  2XB1 A;  2CSY A;  5LCW B;  3FL2 A;  2VJE A;  5FEY A;  1N87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...