5EYAF

Trim25 ring domain in complex with ubc13-ub conjugate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
PLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQARPQLHKNTVLCNVVEQFLQADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 N
publication title Mechanism of TRIM25 Catalytic Activation in the Antiviral RIG-I Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 21
structure length 76
sequence length 76
chains with identical sequence G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5eyaF00
4V3KC 3LQIA 4GB0A 3QZVA 1WEVA 4ZQLA 2YSMA 2L43A 1JOCA 5B76A 2EODA 1HYIA 3L11A 3ASLA 3ZVZB 4AUQB 5B8DA 2CSZA 1V87A 3KQIA 2LRIC 4AVXA 5JG6A 3EB6A 3RPGC 2F42A 2MT5A 1BORA 1N87A 2RSDA 3U5MA 4GNFA 4YADA 2D8SA 5D1LB 2ECNA 3ZVYA 2MD7B 2K16A 3HTKC 4N3WA 3ZTGA 3LRQA 3EB5A 1DVPA 2FUUA 2LXPC 3I2DA 2XEUA 1WILA 4WZ3B 4A4CA 5KH7A 4YAXA 4MVTA 3V43A 1WEMA 2LGKA 4F52B 1WGMA 4ZDTA 2M3HA 1VYXA 1WEEA 2YT5A 2HYED 2PNXA 2YQLA 2G45A 2MD8C 4W4UA 4O64A 5C11A 4QF2A 5FB1A 2QICA 5G05B 2JMDA 4I7CA 3U5NA 4TKPB 2QIZA 5G04B 2JMJA 1T1HA 4UI9B 1LDKC 2YSJA 4R7EA 5FEYA 4PPEA 1HYJA 3N9OA 5KH9A 3SOXA 2ECIA 4PTBA 2ECTA 2ZETC 3SHBA 5LKUA 1Z60A 2LV9A 2LGLA 2LXHC 1U6GB 3RTRB 2AN6A 2YHOA 2LGVA 3PURA 2KU3A 4NN2A 1MM3A 4QF3A 3DQVR 2VP7A 3FL2A 4FO9A 3C5KA 1WFKA 2OXQC 5G0FA 1ZBDB 2FUIA 2XB1A 2VJFA 1WIMA 2KIZA 2KR4A 4CA1A 4YBTA 2FSAA 3SOUA 5DINA 1WESA 5LKZA 2JRJA 5AITA 1LDJB 2MNZA 5H1TA 4FJCA 1WEOA 4L58A 3ZNIA 3GV4A 4XI1A 2KWNA 2MIQA 3M63A 2BAYA 1WE9A 4Q6FA 1JM7A 4YBSA 3T6RA 3C6WA 2LN0A 5B77A 4LADB 1F62A 4YBMA 2LGGA 4LLBA 1WEQA 3LQJA 2L80A 2HDPA 4YATA 2G6QA 1K2FA 3M99A 5J3XA 3DPLR 5TABA 2H0DA 4LJNA 4V3LC 5FB0A 4AYCA 1RMDA 4FK5A 5B79A 2M85A 2NAAA 3HCTA 5TDWA 5TRBA 3T7LA 4N4FA 4I7BA 4A4BA 3L1XA 2YREA 2KE1A 5KH3A 3N9NA 2M1RA 2KGIA 3N9LA 2VJEA 2I50A 4FIPA 2C2VS 4IC2A 5DKAA 1CHCA 2F6JA 3M62A 1IYMA 1G25A 3ZPV1 2KWJA 5D1KB 3VK6A 2VPBA 2DX8A 2VJEB 2L5UA 2UZGA 3PHDA 5LKXA 1FP0A 4UP5A 3O70A 5B78A 2CT2A 5H1VA 4CCGX 2C2LA 4LK9A 2ECGA 3N9MA 3SOWA 2YQMA 4P5OB 4AP4A 4S3OB 3O37A 5H1UA 3ZPVE 2KGGA 1WENA 4C9ZA 1WEWA 3PUQA 5FERA 2VJFB 3O36A 2CSYA 2M6MA 4YABA 5LKTA 4X3GA 3GL6A 4R8PK 3N9QA 1Z6UA 3U5OA 2LDRA 3ZYQA 2VPGA 3MHSA 2MUMA 3O34A 2KYUA 4B7YC 3O33A 2E6SA 4BBQA 1E4UA 3KNVA 2YYRA 2K17A 2E6RA 2L0BA 2VPEA 2VPDA 4A0CD 2QJ0A 5TBNA 1MM2A 3U5PA 2ECVA 1JM7B 2KWOA 3L1ZB 1FBVA 5EYAF 2L75A 2MA5A 2KREA 2Y43A 2EGPA 4WZ0A 3RPGB 2ECWA 4L7XA 2MA6A 1Z2QA 2YU4A 2MNYA 4UP0A 2K1JA 3IHPA 5D1MB 5LCWB 2YURA 2H0DB 2ECJA 4MSXA 1VFYA 2F6NA 4R2YA 4AYCB 3KV5A 5B75A 2Y1MA 2RI7A 3HCSA 5C13A 4GNDA 3N9PA 3O7AA 2K4DA 2KWKA 3MHHA 4WZ2A 3HCUA 4ZUXU 3NG2A 5TDRA 1WEUA 3LQHA 4S3OC 5AIUA 4IC3A 4GNEA 5H9MA 1X4JA 4GNGA 1WEPA 2IDAA 4A49A 5I3LA 1XWHA 2JMIA 2YW8A 2CKLA 4LKAA 4YC9A 2EA6A 4B86C 4I7DA 4WA6A 2PUYA 1X4IA 2KFTA 3KV6A 2G43A 2YHNA 2CKLB 1VD4A 2YUCA 3O35A 2VNFA 2Y1NA 1X4UA 4BHWA 2LQ6A
chains in the Genus database with same CATH superfamily
4V3KC 3LQIA 4GB0A 3QZVA 1WEVA 4ZQLA 2YSMA 2L43A 1JOCA 5B76A 2EODA 1HYIA 3L11A 3ASLA 3ZVZB 4AUQB 5B8DA 2CSZA 1V87A 3KQIA 2LRIC 4AVXA 5JG6A 3EB6A 3RPGC 2F42A 2MT5A 1BORA 1N87A 2RSDA 3U5MA 2CONA 4GNFA 2EXUA 4YADA 2D8SA 5D1LB 2ECNA 3O47A 3ZVYA 2MD7B 3H7HA 2K16A 2YVRA 3HTKC 4N3WA 3ZTGA 3LRQA 3EB5A 1DVPA 2FUUA 2LXPC 3I2DA 2XEUA 1WILA 4WZ3B 1MBMA 4A4CA 2DSMA 5KH7A 2OWAA 4YAXA 4MVTA 3V43A 2XOCA 1WEMA 2LAUA 2LGKA 4F52B 1WGMA 4ZDTA 2M3HA 1VYXA 1WEEA 2YT5A 2HYED 2PNXA 3FJUB 2YQLA 2G45A 5K3QA 2MD8C 4W4UA 4O64A 5C11A 4QF2A 4H9DA 5FB1A 2QICA 2D8UA 2JMDA 5G05B 4I7CA 3U5NA 2IQJA 4TKPB 2QIZA 5G04B 2JMJA 1T1HA 4UI9B 1LDKC 2YSJA 4R7EA 5FEYA 4PPEA 5SVYA 1HYJA 3N9OA 3FAOA 5KH9A 3SOXA 2ECIA 4PTBA 2ECTA 2ZETC 3SHBA 5LKUA 1Z60A 2LV9A 2LGLA 2LXHC 1U6GB 2M13A 3JUEA 3RTRB 4F1PA 2AN6A 2YHOA 2LGVA 3PURA 4OGEA 2KU3A 4NN2A 1MM3A 4QF3A 3DQVR 2VP7A 3FL2A 4FO9A 3C5KA 5SVXA 2FFWA 1WFKA 2OXQC 4Z0RA 5G0FA 1ZBDB 2FUIA 2XB1A 2VJFA 1WIMA 2KIZA 2KR4A 4CA1A 4YBTA 2XOYA 2FSAA 3SOUA 5DINA 1WESA 5LKZA 2JRJA 5AITA 1LDJB 2MNZA 3LDYA 5H1TA 4FJCA 3M7KA 1WEOA 4L58A 3ZNIA 3GV4A 4XI1A 2KWNA 2MIQA 3M63A 2BAYA 2XOZA 1WE9A 4Q6FA 1JM7A 3FANA 4YBSA 3T6RA 3C6WA 3DWDA 2LN0A 5B77A 4LADB 1F62A 4YBMA 2LGGA 4LLBA 1WEQA 3LQJA 2L80A 2HDPA 5SVIA 4YATA 2G6QA 1K2FA 3M99A 5J3XA 3DPLR 5TABA 2H0DA 4LJNA 4V3LC 5FB0A 4AYCA 2B0OE 1RMDA 4FK5A 5SVIB 3T9KA 5B79A 2M85A 2NAAA 3HCTA 2XP0A 5TDWA 3LVQE 5TRBA 3T7LA 3KDEC 4N4FA 4I7BA 4A4BA 3L1XA 2YREA 2KE1A 5KH3A 3N9NA 2M1RA 2KGIA 3N9LA 3Q1DA 2VJEA 2I50A 4FIPA 2C2VS 4IC2A 5DKAA 1CHCA 2F6JA 3M62A 1IYMA 3LJUX 1G25A 3ZPV1 2KWJA 5D1KB 3VK6A 2VPBA 3SUBA 2DX8A 2VJEB 2L5UA 2UZGA 3PHDA 3PLWA 5LKXA 1FP0A 4UP5A 3O70A 5B78A 2JM3A 3LVRE 2EGMA 2CT2A 5H1VA 4CCGX 2C2LA 4LK9A 2ECGA 3N9MA 3SOWA 3FM8C 2YQMA 4P5OB 4AP4A 4S3OB 3O37A 1DCQA 2L7PA 4O62A 2RR4A 5H1UA 3ZPVE 2KGGA 1WENA 3MDBC 1WEWA 3PUQA 4C9ZA 2CRWA 5FERA 2VJFB 4Z0OA 3O36A 2CSYA 2M6MA 2DJAA 4YABA 5LKTA 4X3GA 3GL6A 4R8PK 3N9QA 1Z6UA 3U5OA 2LDRA 3ZYQA 2VPGA 3MHSA 2MUMA 3O34A 2KYUA 4B7YC 3O33A 2E6SA 4BBQA 1E4UA 3KNVA 2YYRA 2K17A 2E6RA 2L0BA 2VPEA 2VPDA 4A0CD 2QJ0A 5TBNA 4OGCA 3E2DA 1MM2A 3U5PA 2ECVA 1JM7B 2KWOA 3L1ZB 1FBVA 5EYAF 2L75A 2MA5A 2KREA 2Y43A 2EGPA 4WZ0A 3RPGB 2ECWA 4L7XA 2MA6A 1Z2QA 2YU4A 4QQ4A 2CSVA 2MNYA 4UP0A 2K1JA 3IHPA 5D1MB 5LCWB 2YURA 2H0DB 2ECJA 4MSXA 1VFYA 2F6NA 4R2YA 2CRRA 2KKXA 4AYCB 3KV5A 5B75A 2Y1MA 2RI7A 3HCSA 5C13A 4GNDA 3N9PA 3O7AA 2K4DA 2KWKA 3MHHA 4WZ2A 3HCUA 4ZUXU 3NG2A 5TDRA 1WEUA 3LQHA 2FD4A 2KKYA 4S3OC 5AIUA 3FEHA 4GNEA 4IC3A 5H9MA 1X4JA 4GNGA 1WEPA 2IDAA 4A49A 5I3LA 1XWHA 2JMIA 2YW8A 2JUNA 2CKLA 4LKAA 4YC9A 2MKEA 2EA6A 4B86C 4I7DA 4WA6A 2PUYA 1X4IA 2KFTA 3KV6A 3DDTA 2G43A 2E61A 2YHNA 2CKLB 2P57A 1VD4A 2YUCA 3O35A 2VNFA 2Y1NA 1X4UA 4BHWA 2LQ6A
chains in the Genus database with same CATH topology
4V3KC 3LQIA 4GB0A 3QZVA 1WEVA 4ZQLA 2YSMA 2L43A 1JOCA 5B76A 2EODA 1HYIA 3L11A 3ASLA 3ZVZB 4AUQB 5B8DA 2CSZA 1V87A 3KQIA 2LRIC 4AVXA 5JG6A 3EB6A 3RPGC 2F42A 2MT5A 1BORA 1N87A 2RSDA 3U5MA 4GNFA 4YADA 2D8SA 5D1LB 2ECNA 3ZVYA 2MD7B 2K16A 3HTKC 4N3WA 3ZTGA 3LRQA 3EB5A 1DVPA 2FUUA 2LXPC 3I2DA 2XEUA 1WILA 4WZ3B 4A4CA 5KH7A 4YAXA 4MVTA 3V43A 1WEMA 2LGKA 4F52B 1WGMA 4ZDTA 2M3HA 1VYXA 1WEEA 2YT5A 2HYED 2PNXA 2YQLA 2G45A 2MD8C 4W4UA 4O64A 5C11A 4QF2A 5FB1A 2QICA 5G05B 2JMDA 4I7CA 3U5NA 4TKPB 2QIZA 5G04B 2JMJA 1T1HA 4UI9B 1LDKC 2YSJA 4R7EA 5FEYA 4PPEA 1HYJA 3N9OA 5KH9A 3SOXA 2ECIA 4PTBA 2ECTA 2ZETC 3SHBA 5LKUA 1Z60A 2LV9A 2LGLA 2LXHC 1U6GB 3RTRB 2AN6A 2YHOA 2LGVA 3PURA 2KU3A 4NN2A 1MM3A 4QF3A 3DQVR 2VP7A 3FL2A 4FO9A 3C5KA 1WFKA 2OXQC 5G0FA 1ZBDB 2FUIA 2XB1A 2VJFA 1WIMA 2KIZA 2KR4A 4CA1A 4YBTA 2FSAA 3SOUA 5DINA 1WESA 5LKZA 2JRJA 5AITA 1LDJB 2MNZA 5H1TA 4FJCA 1WEOA 4L58A 3ZNIA 3GV4A 4XI1A 2KWNA 2MIQA 3M63A 2BAYA 1WE9A 4Q6FA 1JM7A 4YBSA 3T6RA 3C6WA 2LN0A 5B77A 4LADB 1F62A 4YBMA 2LGGA 4LLBA 1WEQA 3LQJA 2L80A 2HDPA 4YATA 2G6QA 1K2FA 3M99A 5J3XA 3DPLR 5TABA 2H0DA 4LJNA 4V3LC 5FB0A 4AYCA 1RMDA 4FK5A 5B79A 2M85A 2NAAA 3HCTA 5TDWA 5TRBA 3T7LA 4N4FA 4I7BA 4A4BA 3L1XA 2YREA 2KE1A 5KH3A 3N9NA 2M1RA 2KGIA 3N9LA 2VJEA 2I50A 4FIPA 2C2VS 4IC2A 5DKAA 1CHCA 2F6JA 3M62A 1IYMA 1G25A 3ZPV1 2KWJA 5D1KB 3VK6A 2VPBA 2DX8A 2VJEB 2L5UA 2UZGA 3PHDA 5LKXA 1FP0A 4UP5A 3O70A 5B78A 2CT2A 5H1VA 4CCGX 2C2LA 4LK9A 2ECGA 3N9MA 3SOWA 2YQMA 4P5OB 4AP4A 4S3OB 3O37A 5H1UA 3ZPVE 2KGGA 1WENA 4C9ZA 1WEWA 3PUQA 5FERA 2VJFB 3O36A 2CSYA 2M6MA 4YABA 5LKTA 4X3GA 3GL6A 4R8PK 3N9QA 1Z6UA 3U5OA 2LDRA 3ZYQA 2VPGA 3MHSA 2MUMA 3O34A 2KYUA 4B7YC 3O33A 2E6SA 4BBQA 1E4UA 3KNVA 2YYRA 2K17A 2E6RA 2L0BA 2VPEA 2VPDA 4A0CD 2QJ0A 5TBNA 1MM2A 3U5PA 2ECVA 1JM7B 2KWOA 3L1ZB 1FBVA 5EYAF 2L75A 2MA5A 2KREA 2Y43A 2EGPA 4WZ0A 3RPGB 2ECWA 4L7XA 2MA6A 1Z2QA 2YU4A 2MNYA 4UP0A 2K1JA 3IHPA 5D1MB 5LCWB 2YURA 2H0DB 2ECJA 4MSXA 1VFYA 2F6NA 4R2YA 4AYCB 3KV5A 5B75A 2Y1MA 2RI7A 3HCSA 5C13A 4GNDA 3N9PA 3O7AA 2K4DA 2KWKA 3MHHA 4WZ2A 3HCUA 4ZUXU 3NG2A 5TDRA 1WEUA 3LQHA 4S3OC 5AIUA 4IC3A 4GNEA 5H9MA 1X4JA 4GNGA 1WEPA 2IDAA 4A49A 5I3LA 1XWHA 2JMIA 2YW8A 2CKLA 4LKAA 4YC9A 2EA6A 4B86C 4I7DA 4WA6A 2PUYA 1X4IA 2KFTA 3KV6A 2G43A 2YHNA 2CKLB 1VD4A 2YUCA 3O35A 2VNFA 2Y1NA 1X4UA 4BHWA 2LQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3K C;  3LQI A;  4GB0 A;  3QZV A;  1WEV A;  4ZQL A;  2YSM A;  2L43 A;  1JOC A;  5B76 A;  2EOD A;  1HYI A;  3L11 A;  3ASL A;  3ZVZ B;  4AUQ B;  5B8D A;  2CSZ A;  1V87 A;  3KQI A;  2LRI C;  4AVX A;  5JG6 A;  3EB6 A;  3RPG C;  2F42 A;  2MT5 A;  1BOR A;  1N87 A;  2RSD A;  3U5M A;  4GNF A;  4YAD A;  2D8S A;  5D1L B;  2ECN A;  3ZVY A;  2MD7 B;  2K16 A;  3HTK C;  4N3W A;  3ZTG A;  3LRQ A;  3EB5 A;  1DVP A;  2FUU A;  2LXP C;  3I2D A;  2XEU A;  1WIL A;  4WZ3 B;  4A4C A;  5KH7 A;  4YAX A;  4MVT A;  3V43 A;  1WEM A;  2LGK A;  4F52 B;  1WGM A;  4ZDT A;  2M3H A;  1VYX A;  1WEE A;  2YT5 A;  2HYE D;  2PNX A;  2YQL A;  2G45 A;  2MD8 C;  4W4U A;  4O64 A;  5C11 A;  4QF2 A;  5FB1 A;  2QIC A;  5G05 B;  2JMD A;  4I7C A;  3U5N A;  4TKP B;  2QIZ A;  5G04 B;  2JMJ A;  1T1H A;  4UI9 B;  1LDK C;  2YSJ A;  4R7E A;  5FEY A;  4PPE A;  1HYJ A;  3N9O A;  5KH9 A;  3SOX A;  2ECI A;  4PTB A;  2ECT A;  2ZET C;  3SHB A;  5LKU A;  1Z60 A;  2LV9 A;  2LGL A;  2LXH C;  1U6G B;  3RTR B;  2AN6 A;  2YHO A;  2LGV A;  3PUR A;  2KU3 A;  4NN2 A;  1MM3 A;  4QF3 A;  3DQV R;  2VP7 A;  3FL2 A;  4FO9 A;  3C5K A;  1WFK A;  2OXQ C;  5G0F A;  1ZBD B;  2FUI A;  2XB1 A;  2VJF A;  1WIM A;  2KIZ A;  2KR4 A;  4CA1 A;  4YBT A;  2FSA A;  3SOU A;  5DIN A;  1WES A;  5LKZ A;  2JRJ A;  5AIT A;  1LDJ B;  2MNZ A;  5H1T A;  4FJC A;  1WEO A;  4L58 A;  3ZNI A;  3GV4 A;  4XI1 A;  2KWN A;  2MIQ A;  3M63 A;  2BAY A;  1WE9 A;  4Q6F A;  1JM7 A;  4YBS A;  3T6R A;  3C6W A;  2LN0 A;  5B77 A;  4LAD B;  1F62 A;  4YBM A;  2LGG A;  4LLB A;  1WEQ A;  3LQJ A;  2L80 A;  2HDP A;  4YAT A;  2G6Q A;  1K2F A;  3M99 A;  5J3X A;  3DPL R;  5TAB A;  2H0D A;  4LJN A;  4V3L C;  5FB0 A;  4AYC A;  1RMD A;  4FK5 A;  5B79 A;  2M85 A;  2NAA A;  3HCT A;  5TDW A;  5TRB A;  3T7L A;  4N4F A;  4I7B A;  4A4B A;  3L1X A;  2YRE A;  2KE1 A;  5KH3 A;  3N9N A;  2M1R A;  2KGI A;  3N9L A;  2VJE A;  2I50 A;  4FIP A;  2C2V S;  4IC2 A;  5DKA A;  1CHC A;  2F6J A;  3M62 A;  1IYM A;  1G25 A;  3ZPV 1;  2KWJ A;  5D1K B;  3VK6 A;  2VPB A;  2DX8 A;  2VJE B;  2L5U A;  2UZG A;  3PHD A;  5LKX A;  1FP0 A;  4UP5 A;  3O70 A;  5B78 A;  2CT2 A;  5H1V A;  4CCG X;  2C2L A;  4LK9 A;  2ECG A;  3N9M A;  3SOW A;  2YQM A;  4P5O B;  4AP4 A;  4S3O B;  3O37 A;  5H1U A;  3ZPV E;  2KGG A;  1WEN A;  4C9Z A;  1WEW A;  3PUQ A;  5FER A;  2VJF B;  3O36 A;  2CSY A;  2M6M A;  4YAB A;  5LKT A;  4X3G A;  3GL6 A;  4R8P K;  3N9Q A;  1Z6U A;  3U5O A;  2LDR A;  3ZYQ A;  2VPG A;  3MHS A;  2MUM A;  3O34 A;  2KYU A;  4B7Y C;  3O33 A;  2E6S A;  4BBQ A;  1E4U A;  3KNV A;  2YYR A;  2K17 A;  2E6R A;  2L0B A;  2VPE A;  2VPD A;  4A0C D;  2QJ0 A;  5TBN A;  1MM2 A;  3U5P A;  2ECV A;  1JM7 B;  2KWO A;  3L1Z B;  1FBV A;  5EYA F;  2L75 A;  2MA5 A;  2KRE A;  2Y43 A;  2EGP A;  4WZ0 A;  3RPG B;  2ECW A;  4L7X A;  2MA6 A;  1Z2Q A;  2YU4 A;  2MNY A;  4UP0 A;  2K1J A;  3IHP A;  5D1M B;  5LCW B;  2YUR A;  2H0D B;  2ECJ A;  4MSX A;  1VFY A;  2F6N A;  4R2Y A;  4AYC B;  3KV5 A;  5B75 A;  2Y1M A;  2RI7 A;  3HCS A;  5C13 A;  4GND A;  3N9P A;  3O7A A;  2K4D A;  2KWK A;  3MHH A;  4WZ2 A;  3HCU A;  4ZUX U;  3NG2 A;  5TDR A;  1WEU A;  3LQH A;  4S3O C;  5AIU A;  4IC3 A;  4GNE A;  5H9M A;  1X4J A;  4GNG A;  1WEP A;  2IDA A;  4A49 A;  5I3L A;  1XWH A;  2JMI A;  2YW8 A;  2CKL A;  4LKA A;  4YC9 A;  2EA6 A;  4B86 C;  4I7D A;  4WA6 A;  2PUY A;  1X4I A;  2KFT A;  3KV6 A;  2G43 A;  2YHN A;  2CKL B;  1VD4 A;  2YUC A;  3O35 A;  2VNF A;  2Y1N A;  1X4U A;  4BHW A;  2LQ6 A; 
#chains in the Genus database with same CATH topology
 4V3K C;  3LQI A;  4GB0 A;  3QZV A;  1WEV A;  4ZQL A;  2YSM A;  2L43 A;  1JOC A;  5B76 A;  2EOD A;  1HYI A;  3L11 A;  3ASL A;  3ZVZ B;  4AUQ B;  5B8D A;  2CSZ A;  1V87 A;  3KQI A;  2LRI C;  4AVX A;  5JG6 A;  3EB6 A;  3RPG C;  2F42 A;  2MT5 A;  1BOR A;  1N87 A;  2RSD A;  3U5M A;  2CON A;  4GNF A;  2EXU A;  4YAD A;  2D8S A;  5D1L B;  2ECN A;  3O47 A;  3ZVY A;  2MD7 B;  3H7H A;  2K16 A;  2YVR A;  3HTK C;  4N3W A;  3ZTG A;  3LRQ A;  3EB5 A;  1DVP A;  2FUU A;  2LXP C;  3I2D A;  2XEU A;  1WIL A;  4WZ3 B;  1MBM A;  4A4C A;  2DSM A;  5KH7 A;  2OWA A;  4YAX A;  4MVT A;  3V43 A;  2XOC A;  1WEM A;  2LAU A;  2LGK A;  4F52 B;  1WGM A;  4ZDT A;  2M3H A;  1VYX A;  1WEE A;  2YT5 A;  2HYE D;  2PNX A;  3FJU B;  2YQL A;  2G45 A;  5K3Q A;  2MD8 C;  4W4U A;  4O64 A;  5C11 A;  4QF2 A;  4H9D A;  5FB1 A;  2QIC A;  2D8U A;  2JMD A;  5G05 B;  4I7C A;  3U5N A;  2IQJ A;  4TKP B;  2QIZ A;  5G04 B;  2JMJ A;  1T1H A;  4UI9 B;  1LDK C;  2YSJ A;  4R7E A;  5FEY A;  4PPE A;  5SVY A;  1HYJ A;  3N9O A;  3FAO A;  5KH9 A;  3SOX A;  2ECI A;  4PTB A;  2ECT A;  2ZET C;  3SHB A;  5LKU A;  1Z60 A;  2LV9 A;  2LGL A;  2LXH C;  1U6G B;  2M13 A;  3JUE A;  3RTR B;  4F1P A;  2AN6 A;  2YHO A;  2LGV A;  3PUR A;  4OGE A;  2KU3 A;  4NN2 A;  1MM3 A;  4QF3 A;  3DQV R;  2VP7 A;  3FL2 A;  4FO9 A;  3C5K A;  5SVX A;  2FFW A;  1WFK A;  2OXQ C;  4Z0R A;  5G0F A;  1ZBD B;  2FUI A;  2XB1 A;  2VJF A;  1WIM A;  2KIZ A;  2KR4 A;  4CA1 A;  4YBT A;  2XOY A;  2FSA A;  3SOU A;  5DIN A;  1WES A;  5LKZ A;  2JRJ A;  5AIT A;  1LDJ B;  2MNZ A;  3LDY A;  5H1T A;  4FJC A;  3M7K A;  1WEO A;  4L58 A;  3ZNI A;  3GV4 A;  4XI1 A;  2KWN A;  2MIQ A;  3M63 A;  2BAY A;  2XOZ A;  1WE9 A;  4Q6F A;  1JM7 A;  3FAN A;  4YBS A;  3T6R A;  3C6W A;  3DWD A;  2LN0 A;  5B77 A;  4LAD B;  1F62 A;  4YBM A;  2LGG A;  4LLB A;  1WEQ A;  3LQJ A;  2L80 A;  2HDP A;  5SVI A;  4YAT A;  2G6Q A;  1K2F A;  3M99 A;  5J3X A;  3DPL R;  5TAB A;  2H0D A;  4LJN A;  4V3L C;  5FB0 A;  4AYC A;  2B0O E;  1RMD A;  4FK5 A;  5SVI B;  3T9K A;  5B79 A;  2M85 A;  2NAA A;  3HCT A;  2XP0 A;  5TDW A;  3LVQ E;  5TRB A;  3T7L A;  3KDE C;  4N4F A;  4I7B A;  4A4B A;  3L1X A;  2YRE A;  2KE1 A;  5KH3 A;  3N9N A;  2M1R A;  2KGI A;  3N9L A;  3Q1D A;  2VJE A;  2I50 A;  4FIP A;  2C2V S;  4IC2 A;  5DKA A;  1CHC A;  2F6J A;  3M62 A;  1IYM A;  3LJU X;  1G25 A;  3ZPV 1;  2KWJ A;  5D1K B;  3VK6 A;  2VPB A;  3SUB A;  2DX8 A;  2VJE B;  2L5U A;  2UZG A;  3PHD A;  3PLW A;  5LKX A;  1FP0 A;  4UP5 A;  3O70 A;  5B78 A;  2JM3 A;  3LVR E;  2EGM A;  2CT2 A;  5H1V A;  4CCG X;  2C2L A;  4LK9 A;  2ECG A;  3N9M A;  3SOW A;  3FM8 C;  2YQM A;  4P5O B;  4AP4 A;  4S3O B;  3O37 A;  1DCQ A;  2L7P A;  4O62 A;  2RR4 A;  5H1U A;  3ZPV E;  2KGG A;  1WEN A;  3MDB C;  1WEW A;  3PUQ A;  4C9Z A;  2CRW A;  5FER A;  2VJF B;  4Z0O A;  3O36 A;  2CSY A;  2M6M A;  2DJA A;  4YAB A;  5LKT A;  4X3G A;  3GL6 A;  4R8P K;  3N9Q A;  1Z6U A;  3U5O A;  2LDR A;  3ZYQ A;  2VPG A;  3MHS A;  2MUM A;  3O34 A;  2KYU A;  4B7Y C;  3O33 A;  2E6S A;  4BBQ A;  1E4U A;  3KNV A;  2YYR A;  2K17 A;  2E6R A;  2L0B A;  2VPE A;  2VPD A;  4A0C D;  2QJ0 A;  5TBN A;  4OGC A;  3E2D A;  1MM2 A;  3U5P A;  2ECV A;  1JM7 B;  2KWO A;  3L1Z B;  1FBV A;  5EYA F;  2L75 A;  2MA5 A;  2KRE A;  2Y43 A;  2EGP A;  4WZ0 A;  3RPG B;  2ECW A;  4L7X A;  2MA6 A;  1Z2Q A;  2YU4 A;  4QQ4 A;  2CSV A;  2MNY A;  4UP0 A;  2K1J A;  3IHP A;  5D1M B;  5LCW B;  2YUR A;  2H0D B;  2ECJ A;  4MSX A;  1VFY A;  2F6N A;  4R2Y A;  2CRR A;  2KKX A;  4AYC B;  3KV5 A;  5B75 A;  2Y1M A;  2RI7 A;  3HCS A;  5C13 A;  4GND A;  3N9P A;  3O7A A;  2K4D A;  2KWK A;  3MHH A;  4WZ2 A;  3HCU A;  4ZUX U;  3NG2 A;  5TDR A;  1WEU A;  3LQH A;  2FD4 A;  2KKY A;  4S3O C;  5AIU A;  3FEH A;  4GNE A;  4IC3 A;  5H9M A;  1X4J A;  4GNG A;  1WEP A;  2IDA A;  4A49 A;  5I3L A;  1XWH A;  2JMI A;  2YW8 A;  2JUN A;  2CKL A;  4LKA A;  4YC9 A;  2MKE A;  2EA6 A;  4B86 C;  4I7D A;  4WA6 A;  2PUY A;  1X4I A;  2KFT A;  3KV6 A;  3DDT A;  2G43 A;  2E61 A;  2YHN A;  2CKL B;  2P57 A;  1VD4 A;  2YUC A;  3O35 A;  2VNF A;  2Y1N A;  1X4U A;  4BHW A;  2LQ6 A; 
#chains in the Genus database with same CATH homology
 4V3K C;  3LQI A;  4GB0 A;  3QZV A;  1WEV A;  4ZQL A;  2YSM A;  2L43 A;  1JOC A;  5B76 A;  2EOD A;  1HYI A;  3L11 A;  3ASL A;  3ZVZ B;  4AUQ B;  5B8D A;  2CSZ A;  1V87 A;  3KQI A;  2LRI C;  4AVX A;  5JG6 A;  3EB6 A;  3RPG C;  2F42 A;  2MT5 A;  1BOR A;  1N87 A;  2RSD A;  3U5M A;  4GNF A;  4YAD A;  2D8S A;  5D1L B;  2ECN A;  3ZVY A;  2MD7 B;  2K16 A;  3HTK C;  4N3W A;  3ZTG A;  3LRQ A;  3EB5 A;  1DVP A;  2FUU A;  2LXP C;  3I2D A;  2XEU A;  1WIL A;  4WZ3 B;  4A4C A;  5KH7 A;  4YAX A;  4MVT A;  3V43 A;  1WEM A;  2LGK A;  4F52 B;  1WGM A;  4ZDT A;  2M3H A;  1VYX A;  1WEE A;  2YT5 A;  2HYE D;  2PNX A;  2YQL A;  2G45 A;  2MD8 C;  4W4U A;  4O64 A;  5C11 A;  4QF2 A;  5FB1 A;  2QIC A;  5G05 B;  2JMD A;  4I7C A;  3U5N A;  4TKP B;  2QIZ A;  5G04 B;  2JMJ A;  1T1H A;  4UI9 B;  1LDK C;  2YSJ A;  4R7E A;  5FEY A;  4PPE A;  1HYJ A;  3N9O A;  5KH9 A;  3SOX A;  2ECI A;  4PTB A;  2ECT A;  2ZET C;  3SHB A;  5LKU A;  1Z60 A;  2LV9 A;  2LGL A;  2LXH C;  1U6G B;  3RTR B;  2AN6 A;  2YHO A;  2LGV A;  3PUR A;  2KU3 A;  4NN2 A;  1MM3 A;  4QF3 A;  3DQV R;  2VP7 A;  3FL2 A;  4FO9 A;  3C5K A;  1WFK A;  2OXQ C;  5G0F A;  1ZBD B;  2FUI A;  2XB1 A;  2VJF A;  1WIM A;  2KIZ A;  2KR4 A;  4CA1 A;  4YBT A;  2FSA A;  3SOU A;  5DIN A;  1WES A;  5LKZ A;  2JRJ A;  5AIT A;  1LDJ B;  2MNZ A;  5H1T A;  4FJC A;  1WEO A;  4L58 A;  3ZNI A;  3GV4 A;  4XI1 A;  2KWN A;  2MIQ A;  3M63 A;  2BAY A;  1WE9 A;  4Q6F A;  1JM7 A;  4YBS A;  3T6R A;  3C6W A;  2LN0 A;  5B77 A;  4LAD B;  1F62 A;  4YBM A;  2LGG A;  4LLB A;  1WEQ A;  3LQJ A;  2L80 A;  2HDP A;  4YAT A;  2G6Q A;  1K2F A;  3M99 A;  5J3X A;  3DPL R;  5TAB A;  2H0D A;  4LJN A;  4V3L C;  5FB0 A;  4AYC A;  1RMD A;  4FK5 A;  5B79 A;  2M85 A;  2NAA A;  3HCT A;  5TDW A;  5TRB A;  3T7L A;  4N4F A;  4I7B A;  4A4B A;  3L1X A;  2YRE A;  2KE1 A;  5KH3 A;  3N9N A;  2M1R A;  2KGI A;  3N9L A;  2VJE A;  2I50 A;  4FIP A;  2C2V S;  4IC2 A;  5DKA A;  1CHC A;  2F6J A;  3M62 A;  1IYM A;  1G25 A;  3ZPV 1;  2KWJ A;  5D1K B;  3VK6 A;  2VPB A;  2DX8 A;  2VJE B;  2L5U A;  2UZG A;  3PHD A;  5LKX A;  1FP0 A;  4UP5 A;  3O70 A;  5B78 A;  2CT2 A;  5H1V A;  4CCG X;  2C2L A;  4LK9 A;  2ECG A;  3N9M A;  3SOW A;  2YQM A;  4P5O B;  4AP4 A;  4S3O B;  3O37 A;  5H1U A;  3ZPV E;  2KGG A;  1WEN A;  4C9Z A;  1WEW A;  3PUQ A;  5FER A;  2VJF B;  3O36 A;  2CSY A;  2M6M A;  4YAB A;  5LKT A;  4X3G A;  3GL6 A;  4R8P K;  3N9Q A;  1Z6U A;  3U5O A;  2LDR A;  3ZYQ A;  2VPG A;  3MHS A;  2MUM A;  3O34 A;  2KYU A;  4B7Y C;  3O33 A;  2E6S A;  4BBQ A;  1E4U A;  3KNV A;  2YYR A;  2K17 A;  2E6R A;  2L0B A;  2VPE A;  2VPD A;  4A0C D;  2QJ0 A;  5TBN A;  1MM2 A;  3U5P A;  2ECV A;  1JM7 B;  2KWO A;  3L1Z B;  1FBV A;  5EYA F;  2L75 A;  2MA5 A;  2KRE A;  2Y43 A;  2EGP A;  4WZ0 A;  3RPG B;  2ECW A;  4L7X A;  2MA6 A;  1Z2Q A;  2YU4 A;  2MNY A;  4UP0 A;  2K1J A;  3IHP A;  5D1M B;  5LCW B;  2YUR A;  2H0D B;  2ECJ A;  4MSX A;  1VFY A;  2F6N A;  4R2Y A;  4AYC B;  3KV5 A;  5B75 A;  2Y1M A;  2RI7 A;  3HCS A;  5C13 A;  4GND A;  3N9P A;  3O7A A;  2K4D A;  2KWK A;  3MHH A;  4WZ2 A;  3HCU A;  4ZUX U;  3NG2 A;  5TDR A;  1WEU A;  3LQH A;  4S3O C;  5AIU A;  4IC3 A;  4GNE A;  5H9M A;  1X4J A;  4GNG A;  1WEP A;  2IDA A;  4A49 A;  5I3L A;  1XWH A;  2JMI A;  2YW8 A;  2CKL A;  4LKA A;  4YC9 A;  2EA6 A;  4B86 C;  4I7D A;  4WA6 A;  2PUY A;  1X4I A;  2KFT A;  3KV6 A;  2G43 A;  2YHN A;  2CKL B;  1VD4 A;  2YUC A;  3O35 A;  2VNF A;  2Y1N A;  1X4U A;  4BHW A;  2LQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...