1T1HA

Nmr solution structure of the u box domain from atpub14, an armadillo repeat containing protein from arabidopsis thaliana
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
b'GSPEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLKSLIALWCESNGIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords armadillo repeat containing protein
publication title Structure and Biochemical Function of a Prototypical Arabidopsis U-box Domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1t1hA00
4QF2A 1X4UA 4V3LC 1LDKC 2LN0A 5B8DA 2XEUA 3ZYQA 2MA6A 2QIZA 2L5UA 2F6JA 4ZUXU 2EGPA 2I50A 1WEQA 2Y1MA 3KNVA 4R8PK 5D1LB 4R7EA 2C2VS 3O37A 4FO9A 5C13A 2H0DA 1WIMA 2K1JA 3O35A 2KWKA 3DQVR 2YHOA 2ECTA 4LKAA 2Y43A 2EA6A 4AYCB 3LQIA 2VPDA 2KE1A 4WA6A 4S3OB 4YBTA 3C6WA 3T6RA 2XB1A 4A49A 5LKUA 3M62A 2ECIA 2LGGA 4WZ2A 2K4DA 4YBSA 2F6NA 5D1KB 2ECJA 2FUUA 2M6MA 2KWOA 2BAYA 2LXPC 2M3HA 3HCUA 3MHHA 1JOCA 5G0FA 5TRBA 3ASLA 2ECVA 1VYXA 2FUIA 3FL2A 2KGIA 4UP0A 2HYED 1MM3A 2MD8C 2KWJA 2YT5A 2AN6A 1JM7A 1K2FA 3ZVYA 5FEYA 3KQIA 1Z2QA 3VK6A 3PURA 3U5PA 3N9LA 4A4BA 5B76A 4AUQB 4NN2A 3ZPV1 2JRJA 2HDPA 2KGGA 2YU4A 2YSMA 1N87A 2MNYA 2QJ0A 5B77A 3U5NA 3N9NA 2VPEA 1WEOA 4TKPB 4ZDTA 4B7YC 3KV5A 1WENA 2H0DB 2ECWA 4CCGX 2C2LA 3O70A 4MSXA 5H1UA 3N9PA 1HYJA 2FSAA 2LQ6A 2VPGA 4XI1A 4GNEA 5C11A 2CSYA 3SHBA 5G05B 2YYRA 3PHDA 5G04B 4GB0A 3EB6A 3IHPA 3LQHA 4YAXA 2YUCA 2UZGA 1HYIA 4GNFA 3C5KA 5FB0A 5B78A 1G25A 1T1HA 1WE9A 2VJFB 3N9MA 5D1MB 4WZ0A 4PTBA 1WEWA 1JM7B 3M63A 2ECGA 3NG2A 3L11A 1WESA 4FK5A 1E4UA 3GV4A 2CKLA 3SOUA 2CT2A 1U6GB 2K16A 3QZVA 4S3OC 2L0BA 1ZBDB 4I7CA 2KR4A 4N4FA 1X4JA 4GNGA 1XWHA 4FJCA 3N9QA 4X3GA 4QF3A 4A0CD 2IDAA 4ZQLA 1X4IA 1F62A 4UI9B 5H9MA 5LCWB 3RTRB 1RMDA 2JMDA 2YREA 2L75A 2LDRA 5DKAA 4BHWA 2LGVA 1WEEA 2CSZA 2MT5A 4AYCA 4I7BA 4YATA 3HTKC 1Z60A 2KU3A 2F42A 1MM2A 4B86C 3L1XA 4LADB 2KYUA 4LK9A 4WZ3B 2MA5A 2ZETC 2YSJA 3KV6A 4R2YA 4CA1A 5LKTA 2ECNA 2VNFA 3O34A 2E6SA 2VJEA 2L43A 4LLBA 2LGLA 2RI7A 2LV9A 3O7AA 1VFYA 2YQLA 4GNDA 2CKLB 3RPGB 2OXQC 2D8SA 2KWNA 4BBQA 1BORA 1WEPA 2E6RA 2RSDA 1FP0A 5TBNA 2KFTA 3MHSA 2JMJA 3L1ZB 4AP4A 3RPGC 4AVXA 3O36A 5DINA 1WEUA 2PNXA 1WFKA 4N3WA 5B75A 5EYAF 3SOXA 4MVTA 4O64A 5AITA 2YURA 1VD4A 3U5MA 2YHNA 5KH3A 1LDJB 2MNZA 2NAAA 4C9ZA 5H1VA 2K17A 3ZVZB 3DPLR 2L80A 5LKZA 3EB5A 2M1RA 4IC2A 3PUQA 1FBVA 5KH7A 4YBMA 2YW8A 2MD7B 5LKXA 5FERA 4W4UA 2DX8A 4Q6FA 1IYMA 3SOWA 2KREA 3LQJA 2VJEB 3HCSA 2M85A 4YABA 4YADA 2LGKA 3O33A 5FB1A 2QICA 4F52B 3ZTGA 4L7XA 3T7LA 2VJFA 2Y1NA 3M99A 5H1TA 2G43A 2MIQA 5TDRA 3N9OA 5AIUA 3ZNIA 1DVPA 4YC9A 3U5OA 5KH9A 3I2DA 4L58A 1Z6UA 2KIZA 3ZPVE 4I7DA 1WEMA 4P5OB 4UP5A 1CHCA 2G6QA 4A4CA 1V87A 2MUMA 2LRIC 3HCTA 5J3XA 4PPEA 5JG6A 3GL6A 2VPBA 2EODA 4LJNA 4FIPA 2G45A 2PUYA 4IC3A 1WEVA 5I3LA 3LRQA 4V3KC 2JMIA 5TDWA 5TABA 2VP7A 5B79A 2YQMA 3V43A 2LXHC 1WGMA 1WILA
chains in the Genus database with same CATH superfamily
4QF2A 1X4UA 2OWAA 4V3LC 1LDKC 2LN0A 2LAUA 5B8DA 2XEUA 3M7KA 3ZYQA 2MA6A 5SVIB 2QIZA 2L5UA 2F6JA 4ZUXU 2EGPA 2I50A 1WEQA 2Y1MA 3KNVA 2IQJA 4R8PK 5D1LB 4R7EA 2C2VS 3O37A 4FO9A 5C13A 2H0DA 2CRRA 1WIMA 2K1JA 3O35A 2KWKA 3DQVR 2YHOA 2ECTA 4LKAA 2Y43A 2EA6A 4AYCB 4O62A 2B0OE 3LQIA 2VPDA 2KE1A 4WA6A 5SVXA 2P57A 4S3OB 4YBTA 3C6WA 3T6RA 3LVQE 1MBMA 2XB1A 4A49A 2DJAA 5LKUA 3M62A 2ECIA 2LGGA 4WZ2A 2K4DA 4YBSA 2F6NA 3LDYA 5D1KB 4H9DA 2ECJA 2FUUA 2M6MA 2KWOA 2BAYA 2LXPC 2M3HA 3HCUA 2E61A 3MHHA 1JOCA 2MKEA 5G0FA 5TRBA 3ASLA 2ECVA 1VYXA 2FUIA 3FL2A 2KGIA 4UP0A 2HYED 1MM3A 2MD8C 2KWJA 2YT5A 2AN6A 4Z0OA 1JM7A 1K2FA 3ZVYA 5FEYA 3KQIA 1Z2QA 3VK6A 3PURA 2JM3A 3U5PA 3N9LA 4A4BA 5B76A 2XOZA 3E2DA 4AUQB 4NN2A 3DDTA 3ZPV1 2JRJA 2HDPA 2KGGA 2YU4A 2YSMA 1N87A 2MNYA 2QJ0A 3FM8C 5B77A 3U5NA 3N9NA 2VPEA 1WEOA 4TKPB 4ZDTA 5SVYA 4B7YC 3KV5A 1WENA 2H0DB 2ECWA 4CCGX 2C2LA 3MDBC 3KDEC 3O70A 3DWDA 4MSXA 4Z0RA 5H1UA 3N9PA 1HYJA 2FSAA 2LQ6A 2VPGA 4XI1A 3FJUB 4GNEA 5C11A 2CSYA 3SHBA 5G05B 2YYRA 3PHDA 5G04B 4GB0A 3EB6A 3IHPA 3LQHA 4YAXA 2FFWA 2YUCA 2UZGA 1HYIA 4GNFA 3C5KA 3Q1DA 5FB0A 5B78A 1G25A 1T1HA 1WE9A 2VJFB 3N9MA 3LVRE 5D1MB 4WZ0A 2RR4A 4PTBA 1WEWA 1JM7B 3M63A 2ECGA 2EXUA 3NG2A 3L11A 1WESA 4FK5A 1E4UA 3O47A 3GV4A 2CKLA 3SOUA 2CT2A 1U6GB 2K16A 3QZVA 3FEHA 4S3OC 2L0BA 1ZBDB 4I7CA 2KR4A 4N4FA 1X4JA 4GNGA 2CRWA 1XWHA 2M13A 4FJCA 3FANA 3N9QA 4X3GA 2L7PA 4QF3A 4A0CD 2IDAA 4ZQLA 1X4IA 1F62A 2XP0A 4UI9B 3FAOA 5H9MA 5LCWB 3RTRB 1RMDA 2JMDA 2YREA 2L75A 2LDRA 5DKAA 4BHWA 2KKXA 2LGVA 1WEEA 2CSZA 3H7HA 2MT5A 4AYCA 4I7BA 4YATA 3HTKC 1Z60A 2KU3A 2F42A 1MM2A 4B86C 3L1XA 4LADB 2KYUA 4LK9A 4WZ3B 2MA5A 2ZETC 2YSJA 3KV6A 4R2YA 4CA1A 5LKTA 2ECNA 2VNFA 4QQ4A 3O34A 2E6SA 2VJEA 2L43A 4LLBA 2D8UA 5K3QA 2LGLA 2RI7A 2LV9A 3O7AA 1VFYA 2YQLA 4GNDA 2FD4A 2CKLB 3RPGB 2YVRA 2OXQC 2D8SA 2JUNA 4OGEA 2KWNA 4BBQA 1BORA 1WEPA 2E6RA 2RSDA 1FP0A 5TBNA 2KFTA 3MHSA 2JMJA 3L1ZB 3PLWA 4AP4A 3RPGC 4AVXA 3O36A 5DINA 1WEUA 2PNXA 1WFKA 4N3WA 5B75A 5EYAF 3SOXA 4MVTA 4O64A 5AITA 2YURA 1VD4A 3U5MA 2YHNA 5KH3A 1LDJB 2MNZA 2NAAA 4C9ZA 5H1VA 2K17A 3ZVZB 3DPLR 2L80A 5LKZA 3EB5A 2M1RA 4IC2A 3PUQA 1FBVA 5KH7A 4YBMA 2YW8A 2MD7B 5LKXA 5FERA 4W4UA 2DX8A 4Q6FA 4OGCA 1IYMA 3SOWA 5SVIA 2KREA 3LQJA 2DSMA 2KKYA 2XOYA 2VJEB 3HCSA 2M85A 2CONA 4YABA 4YADA 2LGKA 3JUEA 3O33A 5FB1A 2QICA 3T9KA 4F52B 3ZTGA 4L7XA 3T7LA 2VJFA 2Y1NA 3M99A 5H1TA 2G43A 2MIQA 5TDRA 2EGMA 3N9OA 5AIUA 3SUBA 3ZNIA 1DVPA 4YC9A 3U5OA 5KH9A 3I2DA 4L58A 1Z6UA 2KIZA 3ZPVE 4I7DA 1WEMA 4P5OB 4UP5A 4F1PA 1CHCA 2G6QA 2XOCA 3LJUX 4A4CA 1V87A 2MUMA 2LRIC 1DCQA 3HCTA 5J3XA 4PPEA 5JG6A 3GL6A 2VPBA 2EODA 4LJNA 4FIPA 2G45A 2PUYA 4IC3A 1WEVA 5I3LA 3LRQA 4V3KC 2JMIA 5TDWA 5TABA 2VP7A 5B79A 2YQMA 3V43A 2LXHC 1WGMA 1WILA 2CSVA
chains in the Genus database with same CATH topology
4QF2A 1X4UA 4V3LC 1LDKC 2LN0A 5B8DA 2XEUA 3ZYQA 2MA6A 2QIZA 2L5UA 2F6JA 4ZUXU 2EGPA 2I50A 1WEQA 2Y1MA 3KNVA 4R8PK 5D1LB 4R7EA 2C2VS 3O37A 4FO9A 5C13A 2H0DA 1WIMA 2K1JA 3O35A 2KWKA 3DQVR 2YHOA 2ECTA 4LKAA 2Y43A 2EA6A 4AYCB 3LQIA 2VPDA 2KE1A 4WA6A 4S3OB 4YBTA 3C6WA 3T6RA 2XB1A 4A49A 5LKUA 3M62A 2ECIA 2LGGA 4WZ2A 2K4DA 4YBSA 2F6NA 5D1KB 2ECJA 2FUUA 2M6MA 2KWOA 2BAYA 2LXPC 2M3HA 3HCUA 3MHHA 1JOCA 5G0FA 5TRBA 3ASLA 2ECVA 1VYXA 2FUIA 3FL2A 2KGIA 4UP0A 2HYED 1MM3A 2MD8C 2KWJA 2YT5A 2AN6A 1JM7A 1K2FA 3ZVYA 5FEYA 3KQIA 1Z2QA 3VK6A 3PURA 3U5PA 3N9LA 4A4BA 5B76A 4AUQB 4NN2A 3ZPV1 2JRJA 2HDPA 2KGGA 2YU4A 2YSMA 1N87A 2MNYA 2QJ0A 5B77A 3U5NA 3N9NA 2VPEA 1WEOA 4TKPB 4ZDTA 4B7YC 3KV5A 1WENA 2H0DB 2ECWA 4CCGX 2C2LA 3O70A 4MSXA 5H1UA 3N9PA 1HYJA 2FSAA 2LQ6A 2VPGA 4XI1A 4GNEA 5C11A 2CSYA 3SHBA 5G05B 2YYRA 3PHDA 5G04B 4GB0A 3EB6A 3IHPA 3LQHA 4YAXA 2YUCA 2UZGA 1HYIA 4GNFA 3C5KA 5FB0A 5B78A 1G25A 1T1HA 1WE9A 2VJFB 3N9MA 5D1MB 4WZ0A 4PTBA 1WEWA 1JM7B 3M63A 2ECGA 3NG2A 3L11A 1WESA 4FK5A 1E4UA 3GV4A 2CKLA 3SOUA 2CT2A 1U6GB 2K16A 3QZVA 4S3OC 2L0BA 1ZBDB 4I7CA 2KR4A 4N4FA 1X4JA 4GNGA 1XWHA 4FJCA 3N9QA 4X3GA 4QF3A 4A0CD 2IDAA 4ZQLA 1X4IA 1F62A 4UI9B 5H9MA 5LCWB 3RTRB 1RMDA 2JMDA 2YREA 2L75A 2LDRA 5DKAA 4BHWA 2LGVA 1WEEA 2CSZA 2MT5A 4AYCA 4I7BA 4YATA 3HTKC 1Z60A 2KU3A 2F42A 1MM2A 4B86C 3L1XA 4LADB 2KYUA 4LK9A 4WZ3B 2MA5A 2ZETC 2YSJA 3KV6A 4R2YA 4CA1A 5LKTA 2ECNA 2VNFA 3O34A 2E6SA 2VJEA 2L43A 4LLBA 2LGLA 2RI7A 2LV9A 3O7AA 1VFYA 2YQLA 4GNDA 2CKLB 3RPGB 2OXQC 2D8SA 2KWNA 4BBQA 1BORA 1WEPA 2E6RA 2RSDA 1FP0A 5TBNA 2KFTA 3MHSA 2JMJA 3L1ZB 4AP4A 3RPGC 4AVXA 3O36A 5DINA 1WEUA 2PNXA 1WFKA 4N3WA 5B75A 5EYAF 3SOXA 4MVTA 4O64A 5AITA 2YURA 1VD4A 3U5MA 2YHNA 5KH3A 1LDJB 2MNZA 2NAAA 4C9ZA 5H1VA 2K17A 3ZVZB 3DPLR 2L80A 5LKZA 3EB5A 2M1RA 4IC2A 3PUQA 1FBVA 5KH7A 4YBMA 2YW8A 2MD7B 5LKXA 5FERA 4W4UA 2DX8A 4Q6FA 1IYMA 3SOWA 2KREA 3LQJA 2VJEB 3HCSA 2M85A 4YABA 4YADA 2LGKA 3O33A 5FB1A 2QICA 4F52B 3ZTGA 4L7XA 3T7LA 2VJFA 2Y1NA 3M99A 5H1TA 2G43A 2MIQA 5TDRA 3N9OA 5AIUA 3ZNIA 1DVPA 4YC9A 3U5OA 5KH9A 3I2DA 4L58A 1Z6UA 2KIZA 3ZPVE 4I7DA 1WEMA 4P5OB 4UP5A 1CHCA 2G6QA 4A4CA 1V87A 2MUMA 2LRIC 3HCTA 5J3XA 4PPEA 5JG6A 3GL6A 2VPBA 2EODA 4LJNA 4FIPA 2G45A 2PUYA 4IC3A 1WEVA 5I3LA 3LRQA 4V3KC 2JMIA 5TDWA 5TABA 2VP7A 5B79A 2YQMA 3V43A 2LXHC 1WGMA 1WILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QF2 A;  1X4U A;  4V3L C;  1LDK C;  2LN0 A;  5B8D A;  2XEU A;  3ZYQ A;  2MA6 A;  2QIZ A;  2L5U A;  2F6J A;  4ZUX U;  2EGP A;  2I50 A;  1WEQ A;  2Y1M A;  3KNV A;  4R8P K;  5D1L B;  4R7E A;  2C2V S;  3O37 A;  4FO9 A;  5C13 A;  2H0D A;  1WIM A;  2K1J A;  3O35 A;  2KWK A;  3DQV R;  2YHO A;  2ECT A;  4LKA A;  2Y43 A;  2EA6 A;  4AYC B;  3LQI A;  2VPD A;  2KE1 A;  4WA6 A;  4S3O B;  4YBT A;  3C6W A;  3T6R A;  2XB1 A;  4A49 A;  5LKU A;  3M62 A;  2ECI A;  2LGG A;  4WZ2 A;  2K4D A;  4YBS A;  2F6N A;  5D1K B;  2ECJ A;  2FUU A;  2M6M A;  2KWO A;  2BAY A;  2LXP C;  2M3H A;  3HCU A;  3MHH A;  1JOC A;  5G0F A;  5TRB A;  3ASL A;  2ECV A;  1VYX A;  2FUI A;  3FL2 A;  2KGI A;  4UP0 A;  2HYE D;  1MM3 A;  2MD8 C;  2KWJ A;  2YT5 A;  2AN6 A;  1JM7 A;  1K2F A;  3ZVY A;  5FEY A;  3KQI A;  1Z2Q A;  3VK6 A;  3PUR A;  3U5P A;  3N9L A;  4A4B A;  5B76 A;  4AUQ B;  4NN2 A;  3ZPV 1;  2JRJ A;  2HDP A;  2KGG A;  2YU4 A;  2YSM A;  1N87 A;  2MNY A;  2QJ0 A;  5B77 A;  3U5N A;  3N9N A;  2VPE A;  1WEO A;  4TKP B;  4ZDT A;  4B7Y C;  3KV5 A;  1WEN A;  2H0D B;  2ECW A;  4CCG X;  2C2L A;  3O70 A;  4MSX A;  5H1U A;  3N9P A;  1HYJ A;  2FSA A;  2LQ6 A;  2VPG A;  4XI1 A;  4GNE A;  5C11 A;  2CSY A;  3SHB A;  5G05 B;  2YYR A;  3PHD A;  5G04 B;  4GB0 A;  3EB6 A;  3IHP A;  3LQH A;  4YAX A;  2YUC A;  2UZG A;  1HYI A;  4GNF A;  3C5K A;  5FB0 A;  5B78 A;  1G25 A;  1T1H A;  1WE9 A;  2VJF B;  3N9M A;  5D1M B;  4WZ0 A;  4PTB A;  1WEW A;  1JM7 B;  3M63 A;  2ECG A;  3NG2 A;  3L11 A;  1WES A;  4FK5 A;  1E4U A;  3GV4 A;  2CKL A;  3SOU A;  2CT2 A;  1U6G B;  2K16 A;  3QZV A;  4S3O C;  2L0B A;  1ZBD B;  4I7C A;  2KR4 A;  4N4F A;  1X4J A;  4GNG A;  1XWH A;  4FJC A;  3N9Q A;  4X3G A;  4QF3 A;  4A0C D;  2IDA A;  4ZQL A;  1X4I A;  1F62 A;  4UI9 B;  5H9M A;  5LCW B;  3RTR B;  1RMD A;  2JMD A;  2YRE A;  2L75 A;  2LDR A;  5DKA A;  4BHW A;  2LGV A;  1WEE A;  2CSZ A;  2MT5 A;  4AYC A;  4I7B A;  4YAT A;  3HTK C;  1Z60 A;  2KU3 A;  2F42 A;  1MM2 A;  4B86 C;  3L1X A;  4LAD B;  2KYU A;  4LK9 A;  4WZ3 B;  2MA5 A;  2ZET C;  2YSJ A;  3KV6 A;  4R2Y A;  4CA1 A;  5LKT A;  2ECN A;  2VNF A;  3O34 A;  2E6S A;  2VJE A;  2L43 A;  4LLB A;  2LGL A;  2RI7 A;  2LV9 A;  3O7A A;  1VFY A;  2YQL A;  4GND A;  2CKL B;  3RPG B;  2OXQ C;  2D8S A;  2KWN A;  4BBQ A;  1BOR A;  1WEP A;  2E6R A;  2RSD A;  1FP0 A;  5TBN A;  2KFT A;  3MHS A;  2JMJ A;  3L1Z B;  4AP4 A;  3RPG C;  4AVX A;  3O36 A;  5DIN A;  1WEU A;  2PNX A;  1WFK A;  4N3W A;  5B75 A;  5EYA F;  3SOX A;  4MVT A;  4O64 A;  5AIT A;  2YUR A;  1VD4 A;  3U5M A;  2YHN A;  5KH3 A;  1LDJ B;  2MNZ A;  2NAA A;  4C9Z A;  5H1V A;  2K17 A;  3ZVZ B;  3DPL R;  2L80 A;  5LKZ A;  3EB5 A;  2M1R A;  4IC2 A;  3PUQ A;  1FBV A;  5KH7 A;  4YBM A;  2YW8 A;  2MD7 B;  5LKX A;  5FER A;  4W4U A;  2DX8 A;  4Q6F A;  1IYM A;  3SOW A;  2KRE A;  3LQJ A;  2VJE B;  3HCS A;  2M85 A;  4YAB A;  4YAD A;  2LGK A;  3O33 A;  5FB1 A;  2QIC A;  4F52 B;  3ZTG A;  4L7X A;  3T7L A;  2VJF A;  2Y1N A;  3M99 A;  5H1T A;  2G43 A;  2MIQ A;  5TDR A;  3N9O A;  5AIU A;  3ZNI A;  1DVP A;  4YC9 A;  3U5O A;  5KH9 A;  3I2D A;  4L58 A;  1Z6U A;  2KIZ A;  3ZPV E;  4I7D A;  1WEM A;  4P5O B;  4UP5 A;  1CHC A;  2G6Q A;  4A4C A;  1V87 A;  2MUM A;  2LRI C;  3HCT A;  5J3X A;  4PPE A;  5JG6 A;  3GL6 A;  2VPB A;  2EOD A;  4LJN A;  4FIP A;  2G45 A;  2PUY A;  4IC3 A;  1WEV A;  5I3L A;  3LRQ A;  4V3K C;  2JMI A;  5TDW A;  5TAB A;  2VP7 A;  5B79 A;  2YQM A;  3V43 A;  2LXH C;  1WGM A;  1WIL A; 
#chains in the Genus database with same CATH topology
 4QF2 A;  1X4U A;  2OWA A;  4V3L C;  1LDK C;  2LN0 A;  2LAU A;  5B8D A;  2XEU A;  3M7K A;  3ZYQ A;  2MA6 A;  5SVI B;  2QIZ A;  2L5U A;  2F6J A;  4ZUX U;  2EGP A;  2I50 A;  1WEQ A;  2Y1M A;  3KNV A;  2IQJ A;  4R8P K;  5D1L B;  4R7E A;  2C2V S;  3O37 A;  4FO9 A;  5C13 A;  2H0D A;  2CRR A;  1WIM A;  2K1J A;  3O35 A;  2KWK A;  3DQV R;  2YHO A;  2ECT A;  4LKA A;  2Y43 A;  2EA6 A;  4AYC B;  4O62 A;  2B0O E;  3LQI A;  2VPD A;  2KE1 A;  4WA6 A;  5SVX A;  2P57 A;  4S3O B;  4YBT A;  3C6W A;  3T6R A;  3LVQ E;  1MBM A;  2XB1 A;  4A49 A;  2DJA A;  5LKU A;  3M62 A;  2ECI A;  2LGG A;  4WZ2 A;  2K4D A;  4YBS A;  2F6N A;  3LDY A;  5D1K B;  4H9D A;  2ECJ A;  2FUU A;  2M6M A;  2KWO A;  2BAY A;  2LXP C;  2M3H A;  3HCU A;  2E61 A;  3MHH A;  1JOC A;  2MKE A;  5G0F A;  5TRB A;  3ASL A;  2ECV A;  1VYX A;  2FUI A;  3FL2 A;  2KGI A;  4UP0 A;  2HYE D;  1MM3 A;  2MD8 C;  2KWJ A;  2YT5 A;  2AN6 A;  4Z0O A;  1JM7 A;  1K2F A;  3ZVY A;  5FEY A;  3KQI A;  1Z2Q A;  3VK6 A;  3PUR A;  2JM3 A;  3U5P A;  3N9L A;  4A4B A;  5B76 A;  2XOZ A;  3E2D A;  4AUQ B;  4NN2 A;  3DDT A;  3ZPV 1;  2JRJ A;  2HDP A;  2KGG A;  2YU4 A;  2YSM A;  1N87 A;  2MNY A;  2QJ0 A;  3FM8 C;  5B77 A;  3U5N A;  3N9N A;  2VPE A;  1WEO A;  4TKP B;  4ZDT A;  5SVY A;  4B7Y C;  3KV5 A;  1WEN A;  2H0D B;  2ECW A;  4CCG X;  2C2L A;  3MDB C;  3KDE C;  3O70 A;  3DWD A;  4MSX A;  4Z0R A;  5H1U A;  3N9P A;  1HYJ A;  2FSA A;  2LQ6 A;  2VPG A;  4XI1 A;  3FJU B;  4GNE A;  5C11 A;  2CSY A;  3SHB A;  5G05 B;  2YYR A;  3PHD A;  5G04 B;  4GB0 A;  3EB6 A;  3IHP A;  3LQH A;  4YAX A;  2FFW A;  2YUC A;  2UZG A;  1HYI A;  4GNF A;  3C5K A;  3Q1D A;  5FB0 A;  5B78 A;  1G25 A;  1T1H A;  1WE9 A;  2VJF B;  3N9M A;  3LVR E;  5D1M B;  4WZ0 A;  2RR4 A;  4PTB A;  1WEW A;  1JM7 B;  3M63 A;  2ECG A;  2EXU A;  3NG2 A;  3L11 A;  1WES A;  4FK5 A;  1E4U A;  3O47 A;  3GV4 A;  2CKL A;  3SOU A;  2CT2 A;  1U6G B;  2K16 A;  3QZV A;  3FEH A;  4S3O C;  2L0B A;  1ZBD B;  4I7C A;  2KR4 A;  4N4F A;  1X4J A;  4GNG A;  2CRW A;  1XWH A;  2M13 A;  4FJC A;  3FAN A;  3N9Q A;  4X3G A;  2L7P A;  4QF3 A;  4A0C D;  2IDA A;  4ZQL A;  1X4I A;  1F62 A;  2XP0 A;  4UI9 B;  3FAO A;  5H9M A;  5LCW B;  3RTR B;  1RMD A;  2JMD A;  2YRE A;  2L75 A;  2LDR A;  5DKA A;  4BHW A;  2KKX A;  2LGV A;  1WEE A;  2CSZ A;  3H7H A;  2MT5 A;  4AYC A;  4I7B A;  4YAT A;  3HTK C;  1Z60 A;  2KU3 A;  2F42 A;  1MM2 A;  4B86 C;  3L1X A;  4LAD B;  2KYU A;  4LK9 A;  4WZ3 B;  2MA5 A;  2ZET C;  2YSJ A;  3KV6 A;  4R2Y A;  4CA1 A;  5LKT A;  2ECN A;  2VNF A;  4QQ4 A;  3O34 A;  2E6S A;  2VJE A;  2L43 A;  4LLB A;  2D8U A;  5K3Q A;  2LGL A;  2RI7 A;  2LV9 A;  3O7A A;  1VFY A;  2YQL A;  4GND A;  2FD4 A;  2CKL B;  3RPG B;  2YVR A;  2OXQ C;  2D8S A;  2JUN A;  4OGE A;  2KWN A;  4BBQ A;  1BOR A;  1WEP A;  2E6R A;  2RSD A;  1FP0 A;  5TBN A;  2KFT A;  3MHS A;  2JMJ A;  3L1Z B;  3PLW A;  4AP4 A;  3RPG C;  4AVX A;  3O36 A;  5DIN A;  1WEU A;  2PNX A;  1WFK A;  4N3W A;  5B75 A;  5EYA F;  3SOX A;  4MVT A;  4O64 A;  5AIT A;  2YUR A;  1VD4 A;  3U5M A;  2YHN A;  5KH3 A;  1LDJ B;  2MNZ A;  2NAA A;  4C9Z A;  5H1V A;  2K17 A;  3ZVZ B;  3DPL R;  2L80 A;  5LKZ A;  3EB5 A;  2M1R A;  4IC2 A;  3PUQ A;  1FBV A;  5KH7 A;  4YBM A;  2YW8 A;  2MD7 B;  5LKX A;  5FER A;  4W4U A;  2DX8 A;  4Q6F A;  4OGC A;  1IYM A;  3SOW A;  5SVI A;  2KRE A;  3LQJ A;  2DSM A;  2KKY A;  2XOY A;  2VJE B;  3HCS A;  2M85 A;  2CON A;  4YAB A;  4YAD A;  2LGK A;  3JUE A;  3O33 A;  5FB1 A;  2QIC A;  3T9K A;  4F52 B;  3ZTG A;  4L7X A;  3T7L A;  2VJF A;  2Y1N A;  3M99 A;  5H1T A;  2G43 A;  2MIQ A;  5TDR A;  2EGM A;  3N9O A;  5AIU A;  3SUB A;  3ZNI A;  1DVP A;  4YC9 A;  3U5O A;  5KH9 A;  3I2D A;  4L58 A;  1Z6U A;  2KIZ A;  3ZPV E;  4I7D A;  1WEM A;  4P5O B;  4UP5 A;  4F1P A;  1CHC A;  2G6Q A;  2XOC A;  3LJU X;  4A4C A;  1V87 A;  2MUM A;  2LRI C;  1DCQ A;  3HCT A;  5J3X A;  4PPE A;  5JG6 A;  3GL6 A;  2VPB A;  2EOD A;  4LJN A;  4FIP A;  2G45 A;  2PUY A;  4IC3 A;  1WEV A;  5I3L A;  3LRQ A;  4V3K C;  2JMI A;  5TDW A;  5TAB A;  2VP7 A;  5B79 A;  2YQM A;  3V43 A;  2LXH C;  1WGM A;  1WIL A;  2CSV A; 
#chains in the Genus database with same CATH homology
 4QF2 A;  1X4U A;  4V3L C;  1LDK C;  2LN0 A;  5B8D A;  2XEU A;  3ZYQ A;  2MA6 A;  2QIZ A;  2L5U A;  2F6J A;  4ZUX U;  2EGP A;  2I50 A;  1WEQ A;  2Y1M A;  3KNV A;  4R8P K;  5D1L B;  4R7E A;  2C2V S;  3O37 A;  4FO9 A;  5C13 A;  2H0D A;  1WIM A;  2K1J A;  3O35 A;  2KWK A;  3DQV R;  2YHO A;  2ECT A;  4LKA A;  2Y43 A;  2EA6 A;  4AYC B;  3LQI A;  2VPD A;  2KE1 A;  4WA6 A;  4S3O B;  4YBT A;  3C6W A;  3T6R A;  2XB1 A;  4A49 A;  5LKU A;  3M62 A;  2ECI A;  2LGG A;  4WZ2 A;  2K4D A;  4YBS A;  2F6N A;  5D1K B;  2ECJ A;  2FUU A;  2M6M A;  2KWO A;  2BAY A;  2LXP C;  2M3H A;  3HCU A;  3MHH A;  1JOC A;  5G0F A;  5TRB A;  3ASL A;  2ECV A;  1VYX A;  2FUI A;  3FL2 A;  2KGI A;  4UP0 A;  2HYE D;  1MM3 A;  2MD8 C;  2KWJ A;  2YT5 A;  2AN6 A;  1JM7 A;  1K2F A;  3ZVY A;  5FEY A;  3KQI A;  1Z2Q A;  3VK6 A;  3PUR A;  3U5P A;  3N9L A;  4A4B A;  5B76 A;  4AUQ B;  4NN2 A;  3ZPV 1;  2JRJ A;  2HDP A;  2KGG A;  2YU4 A;  2YSM A;  1N87 A;  2MNY A;  2QJ0 A;  5B77 A;  3U5N A;  3N9N A;  2VPE A;  1WEO A;  4TKP B;  4ZDT A;  4B7Y C;  3KV5 A;  1WEN A;  2H0D B;  2ECW A;  4CCG X;  2C2L A;  3O70 A;  4MSX A;  5H1U A;  3N9P A;  1HYJ A;  2FSA A;  2LQ6 A;  2VPG A;  4XI1 A;  4GNE A;  5C11 A;  2CSY A;  3SHB A;  5G05 B;  2YYR A;  3PHD A;  5G04 B;  4GB0 A;  3EB6 A;  3IHP A;  3LQH A;  4YAX A;  2YUC A;  2UZG A;  1HYI A;  4GNF A;  3C5K A;  5FB0 A;  5B78 A;  1G25 A;  1T1H A;  1WE9 A;  2VJF B;  3N9M A;  5D1M B;  4WZ0 A;  4PTB A;  1WEW A;  1JM7 B;  3M63 A;  2ECG A;  3NG2 A;  3L11 A;  1WES A;  4FK5 A;  1E4U A;  3GV4 A;  2CKL A;  3SOU A;  2CT2 A;  1U6G B;  2K16 A;  3QZV A;  4S3O C;  2L0B A;  1ZBD B;  4I7C A;  2KR4 A;  4N4F A;  1X4J A;  4GNG A;  1XWH A;  4FJC A;  3N9Q A;  4X3G A;  4QF3 A;  4A0C D;  2IDA A;  4ZQL A;  1X4I A;  1F62 A;  4UI9 B;  5H9M A;  5LCW B;  3RTR B;  1RMD A;  2JMD A;  2YRE A;  2L75 A;  2LDR A;  5DKA A;  4BHW A;  2LGV A;  1WEE A;  2CSZ A;  2MT5 A;  4AYC A;  4I7B A;  4YAT A;  3HTK C;  1Z60 A;  2KU3 A;  2F42 A;  1MM2 A;  4B86 C;  3L1X A;  4LAD B;  2KYU A;  4LK9 A;  4WZ3 B;  2MA5 A;  2ZET C;  2YSJ A;  3KV6 A;  4R2Y A;  4CA1 A;  5LKT A;  2ECN A;  2VNF A;  3O34 A;  2E6S A;  2VJE A;  2L43 A;  4LLB A;  2LGL A;  2RI7 A;  2LV9 A;  3O7A A;  1VFY A;  2YQL A;  4GND A;  2CKL B;  3RPG B;  2OXQ C;  2D8S A;  2KWN A;  4BBQ A;  1BOR A;  1WEP A;  2E6R A;  2RSD A;  1FP0 A;  5TBN A;  2KFT A;  3MHS A;  2JMJ A;  3L1Z B;  4AP4 A;  3RPG C;  4AVX A;  3O36 A;  5DIN A;  1WEU A;  2PNX A;  1WFK A;  4N3W A;  5B75 A;  5EYA F;  3SOX A;  4MVT A;  4O64 A;  5AIT A;  2YUR A;  1VD4 A;  3U5M A;  2YHN A;  5KH3 A;  1LDJ B;  2MNZ A;  2NAA A;  4C9Z A;  5H1V A;  2K17 A;  3ZVZ B;  3DPL R;  2L80 A;  5LKZ A;  3EB5 A;  2M1R A;  4IC2 A;  3PUQ A;  1FBV A;  5KH7 A;  4YBM A;  2YW8 A;  2MD7 B;  5LKX A;  5FER A;  4W4U A;  2DX8 A;  4Q6F A;  1IYM A;  3SOW A;  2KRE A;  3LQJ A;  2VJE B;  3HCS A;  2M85 A;  4YAB A;  4YAD A;  2LGK A;  3O33 A;  5FB1 A;  2QIC A;  4F52 B;  3ZTG A;  4L7X A;  3T7L A;  2VJF A;  2Y1N A;  3M99 A;  5H1T A;  2G43 A;  2MIQ A;  5TDR A;  3N9O A;  5AIU A;  3ZNI A;  1DVP A;  4YC9 A;  3U5O A;  5KH9 A;  3I2D A;  4L58 A;  1Z6U A;  2KIZ A;  3ZPV E;  4I7D A;  1WEM A;  4P5O B;  4UP5 A;  1CHC A;  2G6Q A;  4A4C A;  1V87 A;  2MUM A;  2LRI C;  3HCT A;  5J3X A;  4PPE A;  5JG6 A;  3GL6 A;  2VPB A;  2EOD A;  4LJN A;  4FIP A;  2G45 A;  2PUY A;  4IC3 A;  1WEV A;  5I3L A;  3LRQ A;  4V3K C;  2JMI A;  5TDW A;  5TAB A;  2VP7 A;  5B79 A;  2YQM A;  3V43 A;  2LXH C;  1WGM A;  1WIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...