1T1HA

Nmr solution structure of the u box domain from atpub14, an armadillo repeat containing protein from arabidopsis thaliana
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
GSPEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLKSLIALWCESNGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Biochemical Function of a Prototypical Arabidopsis U-box Domain
pubmed doi rcsb
molecule keywords armadillo repeat containing protein
molecule tags Ligase
source organism Arabidopsis thaliana
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1t1hA00
1T1HA 4PPEA 3PHDA 1VFYA 3I2DA 5KH7A 2L0BA 4ZQLA 2EA6A 4LK9A 4XI1A 2G45A 1WEOA 2MUMA 5D1KB 4AUQB 3RPGC 2L43A 2H0DB 2ECJA 3MHHA 5C13A 5KH3A 2QIZA 1WFKA 4L58A 2F42A 4V3LC 2YHOA 2XB1A 2LV9A 2VPDA 5I3LA 3O34A 2E6SA 3O70A 5FB0A 5FEYA 2NAAA 1X4IA 3N9LA 3LRQA 5B75A 3M62A 1RMDA 2KR4A 4IC3A 2CKLA 2QICA 4A49A 4FK5A 3QZVA 2L80A 4BHWA 3T6RA 3M63A 2JMJA 2PUYA 5J3XA 2OXQC 1WEQA 5TABA 3MHSA 2IDAA 3O35A 2LRIC 3KNVA 5H1UA 2I50A 4FO9A 3SOWA 4N3WA 1DVPA 5D1LB 2YUCA 2L5UA 4ZUXU 1WEVA 5EYAF 1U6GB 4A0CD 1X4JA 3VK6A 3L1ZB 3RTRB 5TBNA 2ECVA 1WILA 5JG6A 5H9MA 5TDRA 4R7EA 4PTBA 2M1RA 5B8DA 2KYUA 3KV5A 3LQIA 4I7DA 4B86C 1JM7A 1WENA 2YSJA 4FIPA 4TKPB 3NG2A 4P5OB 4O64A 1WGMA 3N9PA 4R8PK 3L11A 1WEWA 1VYXA 5AITA 2KWJA 4GNGA 2MA6A 3ZYQA 4QF3A 3ZNIA 5B77A 4WA6A 2JRJA 4MSXA 5FERA 1MM2A 2M6MA 2LXPC 3SOUA 4QF2A 1HYJA 3U5PA 5B76A 3DPLR 2EODA 1ZBDB 3HCTA 4FJCA 3PURA 1E4UA 5C11A 3O7AA 5G0FA 2MIQA 4Q6FA 1JOCA 3M99A 3N9OA 2C2LA 3ZVYA 2ECTA 1WE9A 1WEPA 2CT2A 1FBVA 3RPGB 2JMIA 1JM7B 2EGPA 4MVTA 2KE1A 2ECIA 4R2YA 4W4UA 2ECGA 5D1MB 4AVXA 2VP7A 4NN2A 2YYRA 5DINA 2Y1NA 3V43A 2LGVA 4L7XA 5H1VA 2L75A 3ZPVE 2YHNA 1WEMA 2G6QA 1MM3A 5AIUA 4V3KC 3C6WA 3EB6A 4LJNA 2C2VS 4S3OB 5LKUA 3O33A 3HTKC 5B78A 4AP4A 2MA5A 2FUIA 3O37A 2ZETC 4C9ZA 1WESA 1Z60A 2YQMA 2LN0A 2M85A 2KGIA 2VPGA 3FL2A 1G25A 4CCGX 2MNZA 2KU3A 2KWKA 4BBQA 1Z2QA 2BAYA 2YQLA 4ZDTA 2KREA 4WZ0A 1LDKC 2YU4A 2YW8A 2ECWA 3O36A 4AYCA 2F6NA 1BORA 1X4UA 2MNYA 5TRBA 3DQVR 4I7BA 2VPBA 2D8SA 2HYED 2KWOA 4GNFA 4B7YC 2HDPA 2K4DA 2M3HA 4IC2A 1VD4A 2KIZA 2KGGA 2UZGA 3GV4A 2CSZA 2FUUA 3U5OA 2YT5A 2Y1MA 1HYIA 4YATA 1WEUA 2VJFB 2MD8C 3KQIA 1CHCA 2DX8A 2PNXA 2YREA 3IHPA 2FSAA 2F6JA 2YSMA 2K1JA 2JMDA 2KFTA 4LKAA 4LLBA 2K16A 2XEUA 4A4BA 4YAXA 5KH9A 4YBMA 4GB0A 2ECNA 2VJEB 3HCUA 1IYMA 5G05B 4AYCB 2YURA 2RI7A 4UI9B 4YBSA 3PUQA 3T7LA 3KV6A 4YBTA 1FP0A 2MD7B 5H1TA 2LQ6A 2RSDA 4N4FA 5DKAA 4WZ3B 4LADB 2E6RA 2VNFA 2CSYA 3U5MA 4S3OC 2AN6A 4UP5A 3C5KA 2K17A 2KWNA 5G04B 3GL6A 3HCSA 1V87A 4I7CA 4YADA 3L1XA 4A4CA 1Z6UA 4YC9A 5TDWA 2QJ0A 2LGKA 1WEEA 3N9QA 4GNEA 5B79A 5LKXA 2G43A 3U5NA 5FB1A 2Y43A 1WIMA 3SHBA 1LDJB 2VJFA 5LKZA 1F62A 2LDRA 2H0DA 1K2FA 3EB5A 4F52B 1N87A 3ASLA 5LKTA 4YABA 3SOXA 1XWHA 3LQJA 2LGGA 3ZTGA 4X3GA 3N9NA 2CKLB 3N9MA 3ZVZB 2MT5A 2VPEA 4GNDA 2VJEA 4WZ2A 2LGLA 5LCWB 3ZPV1 3LQHA 2LXHC 4UP0A 4CA1A
chains in the Genus database with same CATH superfamily
1T1HA 2XOCA 4PPEA 3PHDA 1VFYA 3I2DA 2RR4A 5KH7A 2L0BA 2OWAA 4ZQLA 2EA6A 4LK9A 4XI1A 2G45A 1WEOA 2MUMA 5D1KB 4AUQB 3RPGC 2L43A 2H0DB 2L7PA 3O47A 2ECJA 3MHHA 5C13A 5KH3A 2QIZA 1WFKA 4L58A 2EXUA 4O62A 2F42A 4V3LC 2YHOA 4OGEA 2XB1A 2LV9A 2VPDA 5I3LA 2FFWA 3O34A 2E6SA 3O70A 5FB0A 5FEYA 2NAAA 1X4IA 2M13A 3N9LA 3LRQA 5B75A 3M62A 1RMDA 2KR4A 4IC3A 2CKLA 2QICA 4A49A 3M7KA 4FK5A 3QZVA 2L80A 4BHWA 3T6RA 3M63A 2JMJA 2PUYA 5J3XA 2OXQC 1WEQA 5TABA 3MHSA 2IDAA 3O35A 2LRIC 3KNVA 5H1UA 2I50A 4Z0RA 4FO9A 3SOWA 4N3WA 2CSVA 1DVPA 5D1LB 2YUCA 2L5UA 2IQJA 4ZUXU 1WEVA 5EYAF 1U6GB 4A0CD 1X4JA 3VK6A 3L1ZB 3RTRB 1MBMA 5TBNA 3FJUB 2ECVA 1WILA 5JG6A 5H9MA 5TDRA 2DSMA 4R7EA 4PTBA 2M1RA 5B8DA 2KYUA 3KV5A 3LQIA 4I7DA 4B86C 1JM7A 1WENA 2YSJA 3T9KA 4FIPA 4TKPB 3NG2A 4P5OB 3SUBA 4O64A 1WGMA 3N9PA 4F1PA 4R8PK 3L11A 1WEWA 4QQ4A 1VYXA 5AITA 4H9DA 2KWJA 4GNGA 2MA6A 2XP0A 3ZYQA 4QF3A 3ZNIA 5B77A 4WA6A 2JRJA 4MSXA 5FERA 1MM2A 2M6MA 2LXPC 3SOUA 2FD4A 4QF2A 1HYJA 3U5PA 5B76A 3DPLR 2EODA 1ZBDB 3HCTA 4FJCA 3PURA 1E4UA 2JUNA 5C11A 2CRRA 3O7AA 5G0FA 2MIQA 4Q6FA 3FEHA 1JOCA 2JM3A 3M99A 3N9OA 2C2LA 3ZVYA 2ECTA 1WE9A 1WEPA 2CT2A 1FBVA 3RPGB 2JMIA 1JM7B 2EGPA 4MVTA 2KE1A 2ECIA 4R2YA 4W4UA 2ECGA 5D1MB 4Z0OA 4AVXA 2VP7A 4NN2A 1DCQA 2YYRA 3H7HA 5DINA 3DDTA 2MKEA 2CONA 2Y1NA 3V43A 2LGVA 4L7XA 5H1VA 2L75A 3ZPVE 2YHNA 1WEMA 2G6QA 1MM3A 5AIUA 2XOZA 4V3KC 3C6WA 3EB6A 4LJNA 2C2VS 4S3OB 5LKUA 3O33A 2EGMA 3HTKC 5B78A 4AP4A 2MA5A 2FUIA 3O37A 2ZETC 4C9ZA 1WESA 1Z60A 2YQMA 2LN0A 2M85A 2KGIA 2VPGA 3FL2A 1G25A 3FANA 4CCGX 2MNZA 3DWDA 3LJUX 2KU3A 2KWKA 4BBQA 1Z2QA 2BAYA 2YQLA 4ZDTA 2KREA 4WZ0A 1LDKC 2YU4A 2YW8A 2ECWA 3KDEC 3O36A 4AYCA 2F6NA 1BORA 1X4UA 2MNYA 5TRBA 3DQVR 2XOYA 3LDYA 4OGCA 4I7BA 2VPBA 2D8SA 3LVRE 2HYED 2KWOA 4GNFA 4B7YC 2HDPA 2K4DA 2KKXA 2M3HA 2D8UA 4IC2A 1VD4A 2KIZA 2KGGA 2UZGA 3GV4A 2CSZA 2FUUA 3U5OA 2YT5A 2Y1MA 3FM8C 1HYIA 2KKYA 4YATA 1WEUA 2VJFB 2MD8C 3KQIA 5SVIB 1CHCA 2DX8A 2PNXA 2YREA 3IHPA 3LVQE 2FSAA 2F6JA 2YSMA 2K1JA 2B0OE 2JMDA 2KFTA 3JUEA 4LKAA 4LLBA 5SVYA 2K16A 2XEUA 4A4BA 4YAXA 5KH9A 4YBMA 4GB0A 2ECNA 2VJEB 3HCUA 1IYMA 2P57A 2DJAA 5G05B 5SVXA 4AYCB 2YURA 2RI7A 4UI9B 4YBSA 3PUQA 3T7LA 3KV6A 4YBTA 1FP0A 2MD7B 2LAUA 2E61A 2LQ6A 5H1TA 3E2DA 2RSDA 4N4FA 5DKAA 4WZ3B 4LADB 2E6RA 2VNFA 3Q1DA 2CSYA 3U5MA 4S3OC 2AN6A 4UP5A 3C5KA 2K17A 2KWNA 5G04B 3GL6A 3HCSA 1V87A 4I7CA 4YADA 3L1XA 4A4CA 1Z6UA 4YC9A 5TDWA 2QJ0A 2LGKA 1WEEA 3N9QA 4GNEA 5B79A 5LKXA 2YVRA 2G43A 3MDBC 3U5NA 5FB1A 2Y43A 1WIMA 3SHBA 1LDJB 2VJFA 3PLWA 5LKZA 1F62A 5SVIA 2CRWA 2LDRA 5K3QA 2H0DA 1K2FA 3EB5A 4F52B 1N87A 3ASLA 5LKTA 4YABA 3SOXA 1XWHA 3LQJA 2LGGA 3ZTGA 4X3GA 3N9NA 2CKLB 3N9MA 3ZVZB 2MT5A 2VPEA 4GNDA 2VJEA 4WZ2A 2LGLA 5LCWB 3ZPV1 3LQHA 2LXHC 4UP0A 3FAOA 4CA1A
chains in the Genus database with same CATH topology
1T1HA 4PPEA 3PHDA 1VFYA 3I2DA 5KH7A 2L0BA 4ZQLA 2EA6A 4LK9A 4XI1A 2G45A 1WEOA 2MUMA 5D1KB 4AUQB 3RPGC 2L43A 2H0DB 2ECJA 3MHHA 5C13A 5KH3A 2QIZA 1WFKA 4L58A 2F42A 4V3LC 2YHOA 2XB1A 2LV9A 2VPDA 5I3LA 3O34A 2E6SA 3O70A 5FB0A 5FEYA 2NAAA 1X4IA 3N9LA 3LRQA 5B75A 3M62A 1RMDA 2KR4A 4IC3A 2CKLA 2QICA 4A49A 4FK5A 3QZVA 2L80A 4BHWA 3T6RA 3M63A 2JMJA 2PUYA 5J3XA 2OXQC 1WEQA 5TABA 3MHSA 2IDAA 3O35A 2LRIC 3KNVA 5H1UA 2I50A 4FO9A 3SOWA 4N3WA 1DVPA 5D1LB 2YUCA 2L5UA 4ZUXU 1WEVA 5EYAF 1U6GB 4A0CD 1X4JA 3VK6A 3L1ZB 3RTRB 5TBNA 2ECVA 1WILA 5JG6A 5H9MA 5TDRA 4R7EA 4PTBA 2M1RA 5B8DA 2KYUA 3KV5A 3LQIA 4I7DA 4B86C 1JM7A 1WENA 2YSJA 4FIPA 4TKPB 3NG2A 4P5OB 4O64A 1WGMA 3N9PA 4R8PK 3L11A 1WEWA 1VYXA 5AITA 2KWJA 4GNGA 2MA6A 3ZYQA 4QF3A 3ZNIA 5B77A 4WA6A 2JRJA 4MSXA 5FERA 1MM2A 2M6MA 2LXPC 3SOUA 4QF2A 1HYJA 3U5PA 5B76A 3DPLR 2EODA 1ZBDB 3HCTA 4FJCA 3PURA 1E4UA 5C11A 3O7AA 5G0FA 2MIQA 4Q6FA 1JOCA 3M99A 3N9OA 2C2LA 3ZVYA 2ECTA 1WE9A 1WEPA 2CT2A 1FBVA 3RPGB 2JMIA 1JM7B 2EGPA 4MVTA 2KE1A 2ECIA 4R2YA 4W4UA 2ECGA 5D1MB 4AVXA 2VP7A 4NN2A 2YYRA 5DINA 2Y1NA 3V43A 2LGVA 4L7XA 5H1VA 2L75A 3ZPVE 2YHNA 1WEMA 2G6QA 1MM3A 5AIUA 4V3KC 3C6WA 3EB6A 4LJNA 2C2VS 4S3OB 5LKUA 3O33A 3HTKC 5B78A 4AP4A 2MA5A 2FUIA 3O37A 2ZETC 4C9ZA 1WESA 1Z60A 2YQMA 2LN0A 2M85A 2KGIA 2VPGA 3FL2A 1G25A 4CCGX 2MNZA 2KU3A 2KWKA 4BBQA 1Z2QA 2BAYA 2YQLA 4ZDTA 2KREA 4WZ0A 1LDKC 2YU4A 2YW8A 2ECWA 3O36A 4AYCA 2F6NA 1BORA 1X4UA 2MNYA 5TRBA 3DQVR 4I7BA 2VPBA 2D8SA 2HYED 2KWOA 4GNFA 4B7YC 2HDPA 2K4DA 2M3HA 4IC2A 1VD4A 2KIZA 2KGGA 2UZGA 3GV4A 2CSZA 2FUUA 3U5OA 2YT5A 2Y1MA 1HYIA 4YATA 1WEUA 2VJFB 2MD8C 3KQIA 1CHCA 2DX8A 2PNXA 2YREA 3IHPA 2FSAA 2F6JA 2YSMA 2K1JA 2JMDA 2KFTA 4LKAA 4LLBA 2K16A 2XEUA 4A4BA 4YAXA 5KH9A 4YBMA 4GB0A 2ECNA 2VJEB 3HCUA 1IYMA 5G05B 4AYCB 2YURA 2RI7A 4UI9B 4YBSA 3PUQA 3T7LA 3KV6A 4YBTA 1FP0A 2MD7B 5H1TA 2LQ6A 2RSDA 4N4FA 5DKAA 4WZ3B 4LADB 2E6RA 2VNFA 2CSYA 3U5MA 4S3OC 2AN6A 4UP5A 3C5KA 2K17A 2KWNA 5G04B 3GL6A 3HCSA 1V87A 4I7CA 4YADA 3L1XA 4A4CA 1Z6UA 4YC9A 5TDWA 2QJ0A 2LGKA 1WEEA 3N9QA 4GNEA 5B79A 5LKXA 2G43A 3U5NA 5FB1A 2Y43A 1WIMA 3SHBA 1LDJB 2VJFA 5LKZA 1F62A 2LDRA 2H0DA 1K2FA 3EB5A 4F52B 1N87A 3ASLA 5LKTA 4YABA 3SOXA 1XWHA 3LQJA 2LGGA 3ZTGA 4X3GA 3N9NA 2CKLB 3N9MA 3ZVZB 2MT5A 2VPEA 4GNDA 2VJEA 4WZ2A 2LGLA 5LCWB 3ZPV1 3LQHA 2LXHC 4UP0A 4CA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1H A;  4PPE A;  3PHD A;  1VFY A;  3I2D A;  5KH7 A;  2L0B A;  4ZQL A;  2EA6 A;  4LK9 A;  4XI1 A;  2G45 A;  1WEO A;  2MUM A;  5D1K B;  4AUQ B;  3RPG C;  2L43 A;  2H0D B;  2ECJ A;  3MHH A;  5C13 A;  5KH3 A;  2QIZ A;  1WFK A;  4L58 A;  2F42 A;  4V3L C;  2YHO A;  2XB1 A;  2LV9 A;  2VPD A;  5I3L A;  3O34 A;  2E6S A;  3O70 A;  5FB0 A;  5FEY A;  2NAA A;  1X4I A;  3N9L A;  3LRQ A;  5B75 A;  3M62 A;  1RMD A;  2KR4 A;  4IC3 A;  2CKL A;  2QIC A;  4A49 A;  4FK5 A;  3QZV A;  2L80 A;  4BHW A;  3T6R A;  3M63 A;  2JMJ A;  2PUY A;  5J3X A;  2OXQ C;  1WEQ A;  5TAB A;  3MHS A;  2IDA A;  3O35 A;  2LRI C;  3KNV A;  5H1U A;  2I50 A;  4FO9 A;  3SOW A;  4N3W A;  1DVP A;  5D1L B;  2YUC A;  2L5U A;  4ZUX U;  1WEV A;  5EYA F;  1U6G B;  4A0C D;  1X4J A;  3VK6 A;  3L1Z B;  3RTR B;  5TBN A;  2ECV A;  1WIL A;  5JG6 A;  5H9M A;  5TDR A;  4R7E A;  4PTB A;  2M1R A;  5B8D A;  2KYU A;  3KV5 A;  3LQI A;  4I7D A;  4B86 C;  1JM7 A;  1WEN A;  2YSJ A;  4FIP A;  4TKP B;  3NG2 A;  4P5O B;  4O64 A;  1WGM A;  3N9P A;  4R8P K;  3L11 A;  1WEW A;  1VYX A;  5AIT A;  2KWJ A;  4GNG A;  2MA6 A;  3ZYQ A;  4QF3 A;  3ZNI A;  5B77 A;  4WA6 A;  2JRJ A;  4MSX A;  5FER A;  1MM2 A;  2M6M A;  2LXP C;  3SOU A;  4QF2 A;  1HYJ A;  3U5P A;  5B76 A;  3DPL R;  2EOD A;  1ZBD B;  3HCT A;  4FJC A;  3PUR A;  1E4U A;  5C11 A;  3O7A A;  5G0F A;  2MIQ A;  4Q6F A;  1JOC A;  3M99 A;  3N9O A;  2C2L A;  3ZVY A;  2ECT A;  1WE9 A;  1WEP A;  2CT2 A;  1FBV A;  3RPG B;  2JMI A;  1JM7 B;  2EGP A;  4MVT A;  2KE1 A;  2ECI A;  4R2Y A;  4W4U A;  2ECG A;  5D1M B;  4AVX A;  2VP7 A;  4NN2 A;  2YYR A;  5DIN A;  2Y1N A;  3V43 A;  2LGV A;  4L7X A;  5H1V A;  2L75 A;  3ZPV E;  2YHN A;  1WEM A;  2G6Q A;  1MM3 A;  5AIU A;  4V3K C;  3C6W A;  3EB6 A;  4LJN A;  2C2V S;  4S3O B;  5LKU A;  3O33 A;  3HTK C;  5B78 A;  4AP4 A;  2MA5 A;  2FUI A;  3O37 A;  2ZET C;  4C9Z A;  1WES A;  1Z60 A;  2YQM A;  2LN0 A;  2M85 A;  2KGI A;  2VPG A;  3FL2 A;  1G25 A;  4CCG X;  2MNZ A;  2KU3 A;  2KWK A;  4BBQ A;  1Z2Q A;  2BAY A;  2YQL A;  4ZDT A;  2KRE A;  4WZ0 A;  1LDK C;  2YU4 A;  2YW8 A;  2ECW A;  3O36 A;  4AYC A;  2F6N A;  1BOR A;  1X4U A;  2MNY A;  5TRB A;  3DQV R;  4I7B A;  2VPB A;  2D8S A;  2HYE D;  2KWO A;  4GNF A;  4B7Y C;  2HDP A;  2K4D A;  2M3H A;  4IC2 A;  1VD4 A;  2KIZ A;  2KGG A;  2UZG A;  3GV4 A;  2CSZ A;  2FUU A;  3U5O A;  2YT5 A;  2Y1M A;  1HYI A;  4YAT A;  1WEU A;  2VJF B;  2MD8 C;  3KQI A;  1CHC A;  2DX8 A;  2PNX A;  2YRE A;  3IHP A;  2FSA A;  2F6J A;  2YSM A;  2K1J A;  2JMD A;  2KFT A;  4LKA A;  4LLB A;  2K16 A;  2XEU A;  4A4B A;  4YAX A;  5KH9 A;  4YBM A;  4GB0 A;  2ECN A;  2VJE B;  3HCU A;  1IYM A;  5G05 B;  4AYC B;  2YUR A;  2RI7 A;  4UI9 B;  4YBS A;  3PUQ A;  3T7L A;  3KV6 A;  4YBT A;  1FP0 A;  2MD7 B;  5H1T A;  2LQ6 A;  2RSD A;  4N4F A;  5DKA A;  4WZ3 B;  4LAD B;  2E6R A;  2VNF A;  2CSY A;  3U5M A;  4S3O C;  2AN6 A;  4UP5 A;  3C5K A;  2K17 A;  2KWN A;  5G04 B;  3GL6 A;  3HCS A;  1V87 A;  4I7C A;  4YAD A;  3L1X A;  4A4C A;  1Z6U A;  4YC9 A;  5TDW A;  2QJ0 A;  2LGK A;  1WEE A;  3N9Q A;  4GNE A;  5B79 A;  5LKX A;  2G43 A;  3U5N A;  5FB1 A;  2Y43 A;  1WIM A;  3SHB A;  1LDJ B;  2VJF A;  5LKZ A;  1F62 A;  2LDR A;  2H0D A;  1K2F A;  3EB5 A;  4F52 B;  1N87 A;  3ASL A;  5LKT A;  4YAB A;  3SOX A;  1XWH A;  3LQJ A;  2LGG A;  3ZTG A;  4X3G A;  3N9N A;  2CKL B;  3N9M A;  3ZVZ B;  2MT5 A;  2VPE A;  4GND A;  2VJE A;  4WZ2 A;  2LGL A;  5LCW B;  3ZPV 1;  3LQH A;  2LXH C;  4UP0 A;  4CA1 A; 
#chains in the Genus database with same CATH topology
 1T1H A;  2XOC A;  4PPE A;  3PHD A;  1VFY A;  3I2D A;  2RR4 A;  5KH7 A;  2L0B A;  2OWA A;  4ZQL A;  2EA6 A;  4LK9 A;  4XI1 A;  2G45 A;  1WEO A;  2MUM A;  5D1K B;  4AUQ B;  3RPG C;  2L43 A;  2H0D B;  2L7P A;  3O47 A;  2ECJ A;  3MHH A;  5C13 A;  5KH3 A;  2QIZ A;  1WFK A;  4L58 A;  2EXU A;  4O62 A;  2F42 A;  4V3L C;  2YHO A;  4OGE A;  2XB1 A;  2LV9 A;  2VPD A;  5I3L A;  2FFW A;  3O34 A;  2E6S A;  3O70 A;  5FB0 A;  5FEY A;  2NAA A;  1X4I A;  2M13 A;  3N9L A;  3LRQ A;  5B75 A;  3M62 A;  1RMD A;  2KR4 A;  4IC3 A;  2CKL A;  2QIC A;  4A49 A;  3M7K A;  4FK5 A;  3QZV A;  2L80 A;  4BHW A;  3T6R A;  3M63 A;  2JMJ A;  2PUY A;  5J3X A;  2OXQ C;  1WEQ A;  5TAB A;  3MHS A;  2IDA A;  3O35 A;  2LRI C;  3KNV A;  5H1U A;  2I50 A;  4Z0R A;  4FO9 A;  3SOW A;  4N3W A;  2CSV A;  1DVP A;  5D1L B;  2YUC A;  2L5U A;  2IQJ A;  4ZUX U;  1WEV A;  5EYA F;  1U6G B;  4A0C D;  1X4J A;  3VK6 A;  3L1Z B;  3RTR B;  1MBM A;  5TBN A;  3FJU B;  2ECV A;  1WIL A;  5JG6 A;  5H9M A;  5TDR A;  2DSM A;  4R7E A;  4PTB A;  2M1R A;  5B8D A;  2KYU A;  3KV5 A;  3LQI A;  4I7D A;  4B86 C;  1JM7 A;  1WEN A;  2YSJ A;  3T9K A;  4FIP A;  4TKP B;  3NG2 A;  4P5O B;  3SUB A;  4O64 A;  1WGM A;  3N9P A;  4F1P A;  4R8P K;  3L11 A;  1WEW A;  4QQ4 A;  1VYX A;  5AIT A;  4H9D A;  2KWJ A;  4GNG A;  2MA6 A;  2XP0 A;  3ZYQ A;  4QF3 A;  3ZNI A;  5B77 A;  4WA6 A;  2JRJ A;  4MSX A;  5FER A;  1MM2 A;  2M6M A;  2LXP C;  3SOU A;  2FD4 A;  4QF2 A;  1HYJ A;  3U5P A;  5B76 A;  3DPL R;  2EOD A;  1ZBD B;  3HCT A;  4FJC A;  3PUR A;  1E4U A;  2JUN A;  5C11 A;  2CRR A;  3O7A A;  5G0F A;  2MIQ A;  4Q6F A;  3FEH A;  1JOC A;  2JM3 A;  3M99 A;  3N9O A;  2C2L A;  3ZVY A;  2ECT A;  1WE9 A;  1WEP A;  2CT2 A;  1FBV A;  3RPG B;  2JMI A;  1JM7 B;  2EGP A;  4MVT A;  2KE1 A;  2ECI A;  4R2Y A;  4W4U A;  2ECG A;  5D1M B;  4Z0O A;  4AVX A;  2VP7 A;  4NN2 A;  1DCQ A;  2YYR A;  3H7H A;  5DIN A;  3DDT A;  2MKE A;  2CON A;  2Y1N A;  3V43 A;  2LGV A;  4L7X A;  5H1V A;  2L75 A;  3ZPV E;  2YHN A;  1WEM A;  2G6Q A;  1MM3 A;  5AIU A;  2XOZ A;  4V3K C;  3C6W A;  3EB6 A;  4LJN A;  2C2V S;  4S3O B;  5LKU A;  3O33 A;  2EGM A;  3HTK C;  5B78 A;  4AP4 A;  2MA5 A;  2FUI A;  3O37 A;  2ZET C;  4C9Z A;  1WES A;  1Z60 A;  2YQM A;  2LN0 A;  2M85 A;  2KGI A;  2VPG A;  3FL2 A;  1G25 A;  3FAN A;  4CCG X;  2MNZ A;  3DWD A;  3LJU X;  2KU3 A;  2KWK A;  4BBQ A;  1Z2Q A;  2BAY A;  2YQL A;  4ZDT A;  2KRE A;  4WZ0 A;  1LDK C;  2YU4 A;  2YW8 A;  2ECW A;  3KDE C;  3O36 A;  4AYC A;  2F6N A;  1BOR A;  1X4U A;  2MNY A;  5TRB A;  3DQV R;  2XOY A;  3LDY A;  4OGC A;  4I7B A;  2VPB A;  2D8S A;  3LVR E;  2HYE D;  2KWO A;  4GNF A;  4B7Y C;  2HDP A;  2K4D A;  2KKX A;  2M3H A;  2D8U A;  4IC2 A;  1VD4 A;  2KIZ A;  2KGG A;  2UZG A;  3GV4 A;  2CSZ A;  2FUU A;  3U5O A;  2YT5 A;  2Y1M A;  3FM8 C;  1HYI A;  2KKY A;  4YAT A;  1WEU A;  2VJF B;  2MD8 C;  3KQI A;  5SVI B;  1CHC A;  2DX8 A;  2PNX A;  2YRE A;  3IHP A;  3LVQ E;  2FSA A;  2F6J A;  2YSM A;  2K1J A;  2B0O E;  2JMD A;  2KFT A;  3JUE A;  4LKA A;  4LLB A;  5SVY A;  2K16 A;  2XEU A;  4A4B A;  4YAX A;  5KH9 A;  4YBM A;  4GB0 A;  2ECN A;  2VJE B;  3HCU A;  1IYM A;  2P57 A;  2DJA A;  5G05 B;  5SVX A;  4AYC B;  2YUR A;  2RI7 A;  4UI9 B;  4YBS A;  3PUQ A;  3T7L A;  3KV6 A;  4YBT A;  1FP0 A;  2MD7 B;  2LAU A;  2E61 A;  2LQ6 A;  5H1T A;  3E2D A;  2RSD A;  4N4F A;  5DKA A;  4WZ3 B;  4LAD B;  2E6R A;  2VNF A;  3Q1D A;  2CSY A;  3U5M A;  4S3O C;  2AN6 A;  4UP5 A;  3C5K A;  2K17 A;  2KWN A;  5G04 B;  3GL6 A;  3HCS A;  1V87 A;  4I7C A;  4YAD A;  3L1X A;  4A4C A;  1Z6U A;  4YC9 A;  5TDW A;  2QJ0 A;  2LGK A;  1WEE A;  3N9Q A;  4GNE A;  5B79 A;  5LKX A;  2YVR A;  2G43 A;  3MDB C;  3U5N A;  5FB1 A;  2Y43 A;  1WIM A;  3SHB A;  1LDJ B;  2VJF A;  3PLW A;  5LKZ A;  1F62 A;  5SVI A;  2CRW A;  2LDR A;  5K3Q A;  2H0D A;  1K2F A;  3EB5 A;  4F52 B;  1N87 A;  3ASL A;  5LKT A;  4YAB A;  3SOX A;  1XWH A;  3LQJ A;  2LGG A;  3ZTG A;  4X3G A;  3N9N A;  2CKL B;  3N9M A;  3ZVZ B;  2MT5 A;  2VPE A;  4GND A;  2VJE A;  4WZ2 A;  2LGL A;  5LCW B;  3ZPV 1;  3LQH A;  2LXH C;  4UP0 A;  3FAO A;  4CA1 A; 
#chains in the Genus database with same CATH homology
 1T1H A;  4PPE A;  3PHD A;  1VFY A;  3I2D A;  5KH7 A;  2L0B A;  4ZQL A;  2EA6 A;  4LK9 A;  4XI1 A;  2G45 A;  1WEO A;  2MUM A;  5D1K B;  4AUQ B;  3RPG C;  2L43 A;  2H0D B;  2ECJ A;  3MHH A;  5C13 A;  5KH3 A;  2QIZ A;  1WFK A;  4L58 A;  2F42 A;  4V3L C;  2YHO A;  2XB1 A;  2LV9 A;  2VPD A;  5I3L A;  3O34 A;  2E6S A;  3O70 A;  5FB0 A;  5FEY A;  2NAA A;  1X4I A;  3N9L A;  3LRQ A;  5B75 A;  3M62 A;  1RMD A;  2KR4 A;  4IC3 A;  2CKL A;  2QIC A;  4A49 A;  4FK5 A;  3QZV A;  2L80 A;  4BHW A;  3T6R A;  3M63 A;  2JMJ A;  2PUY A;  5J3X A;  2OXQ C;  1WEQ A;  5TAB A;  3MHS A;  2IDA A;  3O35 A;  2LRI C;  3KNV A;  5H1U A;  2I50 A;  4FO9 A;  3SOW A;  4N3W A;  1DVP A;  5D1L B;  2YUC A;  2L5U A;  4ZUX U;  1WEV A;  5EYA F;  1U6G B;  4A0C D;  1X4J A;  3VK6 A;  3L1Z B;  3RTR B;  5TBN A;  2ECV A;  1WIL A;  5JG6 A;  5H9M A;  5TDR A;  4R7E A;  4PTB A;  2M1R A;  5B8D A;  2KYU A;  3KV5 A;  3LQI A;  4I7D A;  4B86 C;  1JM7 A;  1WEN A;  2YSJ A;  4FIP A;  4TKP B;  3NG2 A;  4P5O B;  4O64 A;  1WGM A;  3N9P A;  4R8P K;  3L11 A;  1WEW A;  1VYX A;  5AIT A;  2KWJ A;  4GNG A;  2MA6 A;  3ZYQ A;  4QF3 A;  3ZNI A;  5B77 A;  4WA6 A;  2JRJ A;  4MSX A;  5FER A;  1MM2 A;  2M6M A;  2LXP C;  3SOU A;  4QF2 A;  1HYJ A;  3U5P A;  5B76 A;  3DPL R;  2EOD A;  1ZBD B;  3HCT A;  4FJC A;  3PUR A;  1E4U A;  5C11 A;  3O7A A;  5G0F A;  2MIQ A;  4Q6F A;  1JOC A;  3M99 A;  3N9O A;  2C2L A;  3ZVY A;  2ECT A;  1WE9 A;  1WEP A;  2CT2 A;  1FBV A;  3RPG B;  2JMI A;  1JM7 B;  2EGP A;  4MVT A;  2KE1 A;  2ECI A;  4R2Y A;  4W4U A;  2ECG A;  5D1M B;  4AVX A;  2VP7 A;  4NN2 A;  2YYR A;  5DIN A;  2Y1N A;  3V43 A;  2LGV A;  4L7X A;  5H1V A;  2L75 A;  3ZPV E;  2YHN A;  1WEM A;  2G6Q A;  1MM3 A;  5AIU A;  4V3K C;  3C6W A;  3EB6 A;  4LJN A;  2C2V S;  4S3O B;  5LKU A;  3O33 A;  3HTK C;  5B78 A;  4AP4 A;  2MA5 A;  2FUI A;  3O37 A;  2ZET C;  4C9Z A;  1WES A;  1Z60 A;  2YQM A;  2LN0 A;  2M85 A;  2KGI A;  2VPG A;  3FL2 A;  1G25 A;  4CCG X;  2MNZ A;  2KU3 A;  2KWK A;  4BBQ A;  1Z2Q A;  2BAY A;  2YQL A;  4ZDT A;  2KRE A;  4WZ0 A;  1LDK C;  2YU4 A;  2YW8 A;  2ECW A;  3O36 A;  4AYC A;  2F6N A;  1BOR A;  1X4U A;  2MNY A;  5TRB A;  3DQV R;  4I7B A;  2VPB A;  2D8S A;  2HYE D;  2KWO A;  4GNF A;  4B7Y C;  2HDP A;  2K4D A;  2M3H A;  4IC2 A;  1VD4 A;  2KIZ A;  2KGG A;  2UZG A;  3GV4 A;  2CSZ A;  2FUU A;  3U5O A;  2YT5 A;  2Y1M A;  1HYI A;  4YAT A;  1WEU A;  2VJF B;  2MD8 C;  3KQI A;  1CHC A;  2DX8 A;  2PNX A;  2YRE A;  3IHP A;  2FSA A;  2F6J A;  2YSM A;  2K1J A;  2JMD A;  2KFT A;  4LKA A;  4LLB A;  2K16 A;  2XEU A;  4A4B A;  4YAX A;  5KH9 A;  4YBM A;  4GB0 A;  2ECN A;  2VJE B;  3HCU A;  1IYM A;  5G05 B;  4AYC B;  2YUR A;  2RI7 A;  4UI9 B;  4YBS A;  3PUQ A;  3T7L A;  3KV6 A;  4YBT A;  1FP0 A;  2MD7 B;  5H1T A;  2LQ6 A;  2RSD A;  4N4F A;  5DKA A;  4WZ3 B;  4LAD B;  2E6R A;  2VNF A;  2CSY A;  3U5M A;  4S3O C;  2AN6 A;  4UP5 A;  3C5K A;  2K17 A;  2KWN A;  5G04 B;  3GL6 A;  3HCS A;  1V87 A;  4I7C A;  4YAD A;  3L1X A;  4A4C A;  1Z6U A;  4YC9 A;  5TDW A;  2QJ0 A;  2LGK A;  1WEE A;  3N9Q A;  4GNE A;  5B79 A;  5LKX A;  2G43 A;  3U5N A;  5FB1 A;  2Y43 A;  1WIM A;  3SHB A;  1LDJ B;  2VJF A;  5LKZ A;  1F62 A;  2LDR A;  2H0D A;  1K2F A;  3EB5 A;  4F52 B;  1N87 A;  3ASL A;  5LKT A;  4YAB A;  3SOX A;  1XWH A;  3LQJ A;  2LGG A;  3ZTG A;  4X3G A;  3N9N A;  2CKL B;  3N9M A;  3ZVZ B;  2MT5 A;  2VPE A;  4GND A;  2VJE A;  4WZ2 A;  2LGL A;  5LCW B;  3ZPV 1;  3LQH A;  2LXH C;  4UP0 A;  4CA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...