1T1HA

Nmr solution structure of the u box domain from atpub14, an armadillo repeat containing protein from arabidopsis thaliana
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
GSPEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLKSLIALWCESNGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords armadillo repeat containing protein
publication title Structure and Biochemical Function of a Prototypical Arabidopsis U-box Domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase
total genus 15
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1t1hA00
3RPGC 2KE1A 4R2YA 2OXQC 3L1ZB 2VJEA 4R8PK 3PHDA 4MSXA 4W4UA 3N9PA 2CSYA 4FO9A 5TDRA 2M85A 4WZ2A 2VPEA 4GB0A 2Y43A 2ECJA 3SOXA 3SOWA 4F52B 4NN2A 1Z2QA 4ZDTA 2JMDA 5H9MA 4GNEA 2KYUA 2H0DA 2L5UA 3KNVA 1XWHA 2K17A 3ZYQA 2H0DB 2LQ6A 2F6JA 4B86C 5B8DA 2HYED 4LLBA 3M62A 3M99A 5KH9A 3LQJA 2YUCA 2JMJA 2K16A 3ZVZB 2LV9A 2KR4A 4PPEA 4TKPB 4IC2A 2KFTA 2E6RA 2ZETC 3C6WA 3QZVA 2FUUA 2LDRA 2LXHC 3O34A 5B77A 3C5KA 3KQIA 5D1KB 2K4DA 3T7LA 2G45A 2JMIA 2YT5A 2C2VS 4ZUXU 5TBNA 3T6RA 1Z60A 4FIPA 4QF2A 2I50A 4P5OB 2KGIA 4YATA 2MT5A 4X3GA 4YBTA 3ZNIA 4FJCA 2XB1A 5I3LA 4L7XA 4A0CD 3LRQA 3HCSA 4YABA 5DKAA 5FB0A 2E6SA 1WILA 1DVPA 1WEEA 2LRIC 2VNFA 5LKUA 4I7CA 1WIMA 2KWKA 2YSMA 1WEPA 3U5MA 3L11A 4CCGX 1VFYA 3FL2A 2EODA 4V3KC 2CT2A 3LQHA 1F62A 2F6NA 2KWNA 2M1RA 4AYCA 2MD8C 4AYCB 1WEQA 4MVTA 2VJEB 5H1VA 2D8SA 2YSJA 5LKZA 2M3HA 4PTBA 2KWOA 1VYXA 3KV5A 5FB1A 4I7DA 5KH3A 1X4IA 5LCWB 2ECGA 2MIQA 4CA1A 4FK5A 4QF3A 1U6GB 4WA6A 3O36A 4UI9B 5D1LB 2VPBA 1WEMA 4S3OB 5B78A 3N9QA 1N87A 3IHPA 2L75A 2FSAA 3EB6A 2HDPA 3PURA 5D1MB 1WENA 2YURA 4A4CA 2MA6A 2LGVA 3SHBA 3N9MA 2QICA 1E4UA 2QJ0A 2Y1MA 5TDWA 1WEOA 2KIZA 1FP0A 2C2LA 3DPLR 4S3OC 5TABA 5DINA 4ZQLA 2VPGA 2Y1NA 2VJFA 1RMDA 2VJFB 4N4FA 2EGPA 4AVXA 4LKAA 5H1UA 4V3LC 3GL6A 4GNFA 4GNGA 3O37A 2YQLA 3N9NA 5FEYA 2MA5A 2ECWA 2CKLA 2YREA 4B7YC 2DX8A 2UZGA 1MM2A 2CSZA 5J3XA 4LADB 3O33A 4O64A 4BBQA 2YYRA 3N9OA 2MUMA 1HYJA 5EYAF 1WEUA 2NAAA 2ECTA 4A49A 2YU4A 1T1HA 2ECVA 2KREA 3VK6A 4YADA 2VP7A 5LKTA 5JG6A 4R7EA 2YQMA 4BHWA 1WFKA 3ASLA 1Z6UA 2G6QA 3NG2A 3V43A 3HCTA 2YHNA 1BORA 4UP0A 1WEWA 2AN6A 2VPDA 4WZ3B 3LQIA 1JM7A 5AITA 2L80A 3KV6A 3O7AA 1JOCA 1JM7B 2IDAA 1FBVA 2PUYA 2YHOA 4AP4A 3U5PA 2RSDA 1WGMA 1WESA 2XEUA 5KH7A 2RI7A 4L58A 4GNDA 4AUQB 2L0BA 2ECIA 3ZVYA 3ZPV1 1X4JA 2MNYA 4A4BA 2ECNA 5G05B 2MD7B 2L43A 3DQVR 2KWJA 2BAYA 2F42A 3EB5A 1V87A 5FERA 2KU3A 1LDKC 5AIUA 2PNXA 5B76A 4YC9A 4IC3A 3MHHA 1WEVA 2MNZA 4WZ0A 4XI1A 4YBMA 2LXPC 2K1JA 2M6MA 3MHSA 3N9LA 4YAXA 5G04B 1WE9A 1HYIA 4I7BA 3ZPVE 5H1TA 2YW8A 3HTKC 3ZTGA 3PUQA 2KGGA 3M63A 2G43A 3U5NA 3L1XA 3SOUA 4C9ZA 4N3WA 3U5OA 2LGLA 2CKLB 3O70A 2JRJA 1K2FA 2EA6A 5TRBA 3RPGB 4UP5A 4Q6FA 4YBSA 2LGGA 3HCUA 1MM3A 5B75A 2LGKA 5G0FA 1VD4A 2QIZA 1G25A 1CHCA 3I2DA 5C11A 5C13A 3GV4A 4LK9A 2FUIA 4LJNA 1IYMA 1X4UA 1ZBDB 3O35A 2LN0A 1LDJB 3RTRB 5LKXA 5B79A
chains in the Genus database with same CATH superfamily
3RPGC 2KE1A 4R2YA 3FJUB 2OXQC 3L1ZB 2VJEA 4R8PK 3PHDA 4MSXA 4W4UA 3N9PA 2CSYA 4FO9A 5TDRA 2M85A 4WZ2A 2VPEA 4GB0A 2Y43A 5K3QA 2ECJA 3SOXA 3SOWA 4F52B 4NN2A 1Z2QA 4ZDTA 2JMDA 5H9MA 4GNEA 2KYUA 2H0DA 2L5UA 3KNVA 1XWHA 2K17A 4H9DA 3ZYQA 2H0DB 2MKEA 2B0OE 2LQ6A 2F6JA 4B86C 5B8DA 2HYED 4LLBA 3M62A 3M99A 5KH9A 3LQJA 2YUCA 4QQ4A 2JMJA 2K16A 3ZVZB 2LV9A 3FANA 2KR4A 4PPEA 4TKPB 4IC2A 2KFTA 2E6RA 2OWAA 2ZETC 3C6WA 3QZVA 2CSVA 2FUUA 2LDRA 2LXHC 3O34A 4Z0RA 5B77A 3KDEC 3C5KA 3KQIA 2FD4A 5D1KB 2K4DA 3T7LA 2G45A 2JMIA 2YT5A 3H7HA 2C2VS 4ZUXU 5TBNA 4OGEA 3T6RA 1Z60A 4FIPA 3Q1DA 4QF2A 2I50A 4P5OB 2KGIA 4YATA 2MT5A 4X3GA 4YBTA 3ZNIA 3LVQE 4FJCA 2XB1A 5SVIA 5I3LA 4L7XA 4A0CD 3LRQA 3HCSA 4YABA 5DKAA 5FB0A 2E6SA 1WILA 1DVPA 1WEEA 2LRIC 3DDTA 2VNFA 5LKUA 4I7CA 1WIMA 2KWKA 2YSMA 3M7KA 1WEPA 3U5MA 4OGCA 3L11A 4CCGX 1VFYA 3FL2A 2EODA 3E2DA 4V3KC 2FFWA 2CT2A 3LQHA 4O62A 1F62A 2F6NA 2KWNA 1DCQA 3FM8C 2M1RA 4AYCA 2MD8C 4AYCB 1WEQA 4MVTA 2VJEB 5H1VA 2D8SA 2YSJA 5LKZA 2M3HA 4PTBA 2KWOA 1VYXA 3KV5A 5FB1A 3FAOA 4I7DA 5KH3A 1X4IA 5LCWB 2ECGA 2MIQA 2EGMA 2DSMA 4CA1A 4FK5A 4QF3A 1U6GB 4WA6A 3O36A 4UI9B 5D1LB 2VPBA 1WEMA 4S3OB 5B78A 3N9QA 1N87A 2EXUA 3IHPA 2L75A 2FSAA 3EB6A 3JUEA 2HDPA 3PURA 5D1MB 1WENA 2YURA 4A4CA 2MA6A 2LGVA 3SHBA 3N9MA 2QICA 1E4UA 2QJ0A 2Y1MA 5TDWA 1WEOA 2KIZA 1FP0A 2C2LA 3DPLR 4S3OC 5TABA 5DINA 4ZQLA 2VPGA 2Y1NA 2VJFA 1RMDA 2XOCA 2VJFB 4N4FA 5SVYA 2EGPA 4AVXA 4LKAA 5H1UA 4V3LC 3GL6A 4GNFA 5SVIB 4GNGA 3O37A 2YQLA 3N9NA 3FEHA 3PLWA 2YVRA 5FEYA 2MA5A 2ECWA 2CKLA 2YREA 4B7YC 2DX8A 2UZGA 1MM2A 2CSZA 5J3XA 4LADB 2DJAA 3O33A 4O64A 4BBQA 2YYRA 3N9OA 2MUMA 1HYJA 5EYAF 2KKYA 1WEUA 2NAAA 2ECTA 2XP0A 4A49A 2P57A 2YU4A 1T1HA 2ECVA 2CONA 2LAUA 2KREA 1MBMA 3VK6A 4YADA 2VP7A 5LKTA 5JG6A 4R7EA 2YQMA 4BHWA 1WFKA 3ASLA 1Z6UA 2G6QA 3NG2A 3V43A 3HCTA 2CRWA 3LDYA 2YHNA 1BORA 4UP0A 1WEWA 2AN6A 2VPDA 4WZ3B 3LQIA 2M13A 1JM7A 5AITA 2L80A 2KKXA 3KV6A 3O7AA 1JOCA 1JM7B 2IDAA 4Z0OA 2XOYA 1FBVA 2PUYA 2YHOA 4AP4A 3U5PA 2RSDA 2CRRA 1WGMA 1WESA 2XEUA 5KH7A 2RI7A 4L58A 4GNDA 3LVRE 4AUQB 4F1PA 2L0BA 2ECIA 3ZVYA 3ZPV1 5SVXA 1X4JA 2MNYA 4A4BA 2ECNA 2RR4A 2L7PA 5G05B 2MD7B 2L43A 3DQVR 2KWJA 2BAYA 2F42A 3EB5A 1V87A 5FERA 2KU3A 1LDKC 5AIUA 3LJUX 2PNXA 5B76A 4YC9A 4IC3A 3MHHA 1WEVA 2MNZA 4WZ0A 4XI1A 4YBMA 2LXPC 2D8UA 2K1JA 2M6MA 3MHSA 3N9LA 4YAXA 3T9KA 5G04B 1WE9A 1HYIA 3SUBA 4I7BA 3ZPVE 5H1TA 2YW8A 3HTKC 2XOZA 3ZTGA 3PUQA 2KGGA 3M63A 2JUNA 2G43A 3DWDA 3U5NA 3L1XA 3SOUA 4C9ZA 4N3WA 3U5OA 2LGLA 2CKLB 3O70A 2JRJA 1K2FA 2EA6A 5TRBA 3RPGB 4UP5A 4Q6FA 4YBSA 2LGGA 3HCUA 1MM3A 5B75A 2LGKA 5G0FA 1VD4A 2QIZA 1G25A 1CHCA 2E61A 3I2DA 2IQJA 5C11A 5C13A 2JM3A 3GV4A 4LK9A 2FUIA 3O47A 4LJNA 1IYMA 1X4UA 1ZBDB 3O35A 2LN0A 1LDJB 3RTRB 5LKXA 5B79A 3MDBC
chains in the Genus database with same CATH topology
3RPGC 2KE1A 4R2YA 2OXQC 3L1ZB 2VJEA 4R8PK 3PHDA 4MSXA 4W4UA 3N9PA 2CSYA 4FO9A 5TDRA 2M85A 4WZ2A 2VPEA 4GB0A 2Y43A 2ECJA 3SOXA 3SOWA 4F52B 4NN2A 1Z2QA 4ZDTA 2JMDA 5H9MA 4GNEA 2KYUA 2H0DA 2L5UA 3KNVA 1XWHA 2K17A 3ZYQA 2H0DB 2LQ6A 2F6JA 4B86C 5B8DA 2HYED 4LLBA 3M62A 3M99A 5KH9A 3LQJA 2YUCA 2JMJA 2K16A 3ZVZB 2LV9A 2KR4A 4PPEA 4TKPB 4IC2A 2KFTA 2E6RA 2ZETC 3C6WA 3QZVA 2FUUA 2LDRA 2LXHC 3O34A 5B77A 3C5KA 3KQIA 5D1KB 2K4DA 3T7LA 2G45A 2JMIA 2YT5A 2C2VS 4ZUXU 5TBNA 3T6RA 1Z60A 4FIPA 4QF2A 2I50A 4P5OB 2KGIA 4YATA 2MT5A 4X3GA 4YBTA 3ZNIA 4FJCA 2XB1A 5I3LA 4L7XA 4A0CD 3LRQA 3HCSA 4YABA 5DKAA 5FB0A 2E6SA 1WILA 1DVPA 1WEEA 2LRIC 2VNFA 5LKUA 4I7CA 1WIMA 2KWKA 2YSMA 1WEPA 3U5MA 3L11A 4CCGX 1VFYA 3FL2A 2EODA 4V3KC 2CT2A 3LQHA 1F62A 2F6NA 2KWNA 2M1RA 4AYCA 2MD8C 4AYCB 1WEQA 4MVTA 2VJEB 5H1VA 2D8SA 2YSJA 5LKZA 2M3HA 4PTBA 2KWOA 1VYXA 3KV5A 5FB1A 4I7DA 5KH3A 1X4IA 5LCWB 2ECGA 2MIQA 4CA1A 4FK5A 4QF3A 1U6GB 4WA6A 3O36A 4UI9B 5D1LB 2VPBA 1WEMA 4S3OB 5B78A 3N9QA 1N87A 3IHPA 2L75A 2FSAA 3EB6A 2HDPA 3PURA 5D1MB 1WENA 2YURA 4A4CA 2MA6A 2LGVA 3SHBA 3N9MA 2QICA 1E4UA 2QJ0A 2Y1MA 5TDWA 1WEOA 2KIZA 1FP0A 2C2LA 3DPLR 4S3OC 5TABA 5DINA 4ZQLA 2VPGA 2Y1NA 2VJFA 1RMDA 2VJFB 4N4FA 2EGPA 4AVXA 4LKAA 5H1UA 4V3LC 3GL6A 4GNFA 4GNGA 3O37A 2YQLA 3N9NA 5FEYA 2MA5A 2ECWA 2CKLA 2YREA 4B7YC 2DX8A 2UZGA 1MM2A 2CSZA 5J3XA 4LADB 3O33A 4O64A 4BBQA 2YYRA 3N9OA 2MUMA 1HYJA 5EYAF 1WEUA 2NAAA 2ECTA 4A49A 2YU4A 1T1HA 2ECVA 2KREA 3VK6A 4YADA 2VP7A 5LKTA 5JG6A 4R7EA 2YQMA 4BHWA 1WFKA 3ASLA 1Z6UA 2G6QA 3NG2A 3V43A 3HCTA 2YHNA 1BORA 4UP0A 1WEWA 2AN6A 2VPDA 4WZ3B 3LQIA 1JM7A 5AITA 2L80A 3KV6A 3O7AA 1JOCA 1JM7B 2IDAA 1FBVA 2PUYA 2YHOA 4AP4A 3U5PA 2RSDA 1WGMA 1WESA 2XEUA 5KH7A 2RI7A 4L58A 4GNDA 4AUQB 2L0BA 2ECIA 3ZVYA 3ZPV1 1X4JA 2MNYA 4A4BA 2ECNA 5G05B 2MD7B 2L43A 3DQVR 2KWJA 2BAYA 2F42A 3EB5A 1V87A 5FERA 2KU3A 1LDKC 5AIUA 2PNXA 5B76A 4YC9A 4IC3A 3MHHA 1WEVA 2MNZA 4WZ0A 4XI1A 4YBMA 2LXPC 2K1JA 2M6MA 3MHSA 3N9LA 4YAXA 5G04B 1WE9A 1HYIA 4I7BA 3ZPVE 5H1TA 2YW8A 3HTKC 3ZTGA 3PUQA 2KGGA 3M63A 2G43A 3U5NA 3L1XA 3SOUA 4C9ZA 4N3WA 3U5OA 2LGLA 2CKLB 3O70A 2JRJA 1K2FA 2EA6A 5TRBA 3RPGB 4UP5A 4Q6FA 4YBSA 2LGGA 3HCUA 1MM3A 5B75A 2LGKA 5G0FA 1VD4A 2QIZA 1G25A 1CHCA 3I2DA 5C11A 5C13A 3GV4A 4LK9A 2FUIA 4LJNA 1IYMA 1X4UA 1ZBDB 3O35A 2LN0A 1LDJB 3RTRB 5LKXA 5B79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPG C;  2KE1 A;  4R2Y A;  2OXQ C;  3L1Z B;  2VJE A;  4R8P K;  3PHD A;  4MSX A;  4W4U A;  3N9P A;  2CSY A;  4FO9 A;  5TDR A;  2M85 A;  4WZ2 A;  2VPE A;  4GB0 A;  2Y43 A;  2ECJ A;  3SOX A;  3SOW A;  4F52 B;  4NN2 A;  1Z2Q A;  4ZDT A;  2JMD A;  5H9M A;  4GNE A;  2KYU A;  2H0D A;  2L5U A;  3KNV A;  1XWH A;  2K17 A;  3ZYQ A;  2H0D B;  2LQ6 A;  2F6J A;  4B86 C;  5B8D A;  2HYE D;  4LLB A;  3M62 A;  3M99 A;  5KH9 A;  3LQJ A;  2YUC A;  2JMJ A;  2K16 A;  3ZVZ B;  2LV9 A;  2KR4 A;  4PPE A;  4TKP B;  4IC2 A;  2KFT A;  2E6R A;  2ZET C;  3C6W A;  3QZV A;  2FUU A;  2LDR A;  2LXH C;  3O34 A;  5B77 A;  3C5K A;  3KQI A;  5D1K B;  2K4D A;  3T7L A;  2G45 A;  2JMI A;  2YT5 A;  2C2V S;  4ZUX U;  5TBN A;  3T6R A;  1Z60 A;  4FIP A;  4QF2 A;  2I50 A;  4P5O B;  2KGI A;  4YAT A;  2MT5 A;  4X3G A;  4YBT A;  3ZNI A;  4FJC A;  2XB1 A;  5I3L A;  4L7X A;  4A0C D;  3LRQ A;  3HCS A;  4YAB A;  5DKA A;  5FB0 A;  2E6S A;  1WIL A;  1DVP A;  1WEE A;  2LRI C;  2VNF A;  5LKU A;  4I7C A;  1WIM A;  2KWK A;  2YSM A;  1WEP A;  3U5M A;  3L11 A;  4CCG X;  1VFY A;  3FL2 A;  2EOD A;  4V3K C;  2CT2 A;  3LQH A;  1F62 A;  2F6N A;  2KWN A;  2M1R A;  4AYC A;  2MD8 C;  4AYC B;  1WEQ A;  4MVT A;  2VJE B;  5H1V A;  2D8S A;  2YSJ A;  5LKZ A;  2M3H A;  4PTB A;  2KWO A;  1VYX A;  3KV5 A;  5FB1 A;  4I7D A;  5KH3 A;  1X4I A;  5LCW B;  2ECG A;  2MIQ A;  4CA1 A;  4FK5 A;  4QF3 A;  1U6G B;  4WA6 A;  3O36 A;  4UI9 B;  5D1L B;  2VPB A;  1WEM A;  4S3O B;  5B78 A;  3N9Q A;  1N87 A;  3IHP A;  2L75 A;  2FSA A;  3EB6 A;  2HDP A;  3PUR A;  5D1M B;  1WEN A;  2YUR A;  4A4C A;  2MA6 A;  2LGV A;  3SHB A;  3N9M A;  2QIC A;  1E4U A;  2QJ0 A;  2Y1M A;  5TDW A;  1WEO A;  2KIZ A;  1FP0 A;  2C2L A;  3DPL R;  4S3O C;  5TAB A;  5DIN A;  4ZQL A;  2VPG A;  2Y1N A;  2VJF A;  1RMD A;  2VJF B;  4N4F A;  2EGP A;  4AVX A;  4LKA A;  5H1U A;  4V3L C;  3GL6 A;  4GNF A;  4GNG A;  3O37 A;  2YQL A;  3N9N A;  5FEY A;  2MA5 A;  2ECW A;  2CKL A;  2YRE A;  4B7Y C;  2DX8 A;  2UZG A;  1MM2 A;  2CSZ A;  5J3X A;  4LAD B;  3O33 A;  4O64 A;  4BBQ A;  2YYR A;  3N9O A;  2MUM A;  1HYJ A;  5EYA F;  1WEU A;  2NAA A;  2ECT A;  4A49 A;  2YU4 A;  1T1H A;  2ECV A;  2KRE A;  3VK6 A;  4YAD A;  2VP7 A;  5LKT A;  5JG6 A;  4R7E A;  2YQM A;  4BHW A;  1WFK A;  3ASL A;  1Z6U A;  2G6Q A;  3NG2 A;  3V43 A;  3HCT A;  2YHN A;  1BOR A;  4UP0 A;  1WEW A;  2AN6 A;  2VPD A;  4WZ3 B;  3LQI A;  1JM7 A;  5AIT A;  2L80 A;  3KV6 A;  3O7A A;  1JOC A;  1JM7 B;  2IDA A;  1FBV A;  2PUY A;  2YHO A;  4AP4 A;  3U5P A;  2RSD A;  1WGM A;  1WES A;  2XEU A;  5KH7 A;  2RI7 A;  4L58 A;  4GND A;  4AUQ B;  2L0B A;  2ECI A;  3ZVY A;  3ZPV 1;  1X4J A;  2MNY A;  4A4B A;  2ECN A;  5G05 B;  2MD7 B;  2L43 A;  3DQV R;  2KWJ A;  2BAY A;  2F42 A;  3EB5 A;  1V87 A;  5FER A;  2KU3 A;  1LDK C;  5AIU A;  2PNX A;  5B76 A;  4YC9 A;  4IC3 A;  3MHH A;  1WEV A;  2MNZ A;  4WZ0 A;  4XI1 A;  4YBM A;  2LXP C;  2K1J A;  2M6M A;  3MHS A;  3N9L A;  4YAX A;  5G04 B;  1WE9 A;  1HYI A;  4I7B A;  3ZPV E;  5H1T A;  2YW8 A;  3HTK C;  3ZTG A;  3PUQ A;  2KGG A;  3M63 A;  2G43 A;  3U5N A;  3L1X A;  3SOU A;  4C9Z A;  4N3W A;  3U5O A;  2LGL A;  2CKL B;  3O70 A;  2JRJ A;  1K2F A;  2EA6 A;  5TRB A;  3RPG B;  4UP5 A;  4Q6F A;  4YBS A;  2LGG A;  3HCU A;  1MM3 A;  5B75 A;  2LGK A;  5G0F A;  1VD4 A;  2QIZ A;  1G25 A;  1CHC A;  3I2D A;  5C11 A;  5C13 A;  3GV4 A;  4LK9 A;  2FUI A;  4LJN A;  1IYM A;  1X4U A;  1ZBD B;  3O35 A;  2LN0 A;  1LDJ B;  3RTR B;  5LKX A;  5B79 A; 
#chains in the Genus database with same CATH topology
 3RPG C;  2KE1 A;  4R2Y A;  3FJU B;  2OXQ C;  3L1Z B;  2VJE A;  4R8P K;  3PHD A;  4MSX A;  4W4U A;  3N9P A;  2CSY A;  4FO9 A;  5TDR A;  2M85 A;  4WZ2 A;  2VPE A;  4GB0 A;  2Y43 A;  5K3Q A;  2ECJ A;  3SOX A;  3SOW A;  4F52 B;  4NN2 A;  1Z2Q A;  4ZDT A;  2JMD A;  5H9M A;  4GNE A;  2KYU A;  2H0D A;  2L5U A;  3KNV A;  1XWH A;  2K17 A;  4H9D A;  3ZYQ A;  2H0D B;  2MKE A;  2B0O E;  2LQ6 A;  2F6J A;  4B86 C;  5B8D A;  2HYE D;  4LLB A;  3M62 A;  3M99 A;  5KH9 A;  3LQJ A;  2YUC A;  4QQ4 A;  2JMJ A;  2K16 A;  3ZVZ B;  2LV9 A;  3FAN A;  2KR4 A;  4PPE A;  4TKP B;  4IC2 A;  2KFT A;  2E6R A;  2OWA A;  2ZET C;  3C6W A;  3QZV A;  2CSV A;  2FUU A;  2LDR A;  2LXH C;  3O34 A;  4Z0R A;  5B77 A;  3KDE C;  3C5K A;  3KQI A;  2FD4 A;  5D1K B;  2K4D A;  3T7L A;  2G45 A;  2JMI A;  2YT5 A;  3H7H A;  2C2V S;  4ZUX U;  5TBN A;  4OGE A;  3T6R A;  1Z60 A;  4FIP A;  3Q1D A;  4QF2 A;  2I50 A;  4P5O B;  2KGI A;  4YAT A;  2MT5 A;  4X3G A;  4YBT A;  3ZNI A;  3LVQ E;  4FJC A;  2XB1 A;  5SVI A;  5I3L A;  4L7X A;  4A0C D;  3LRQ A;  3HCS A;  4YAB A;  5DKA A;  5FB0 A;  2E6S A;  1WIL A;  1DVP A;  1WEE A;  2LRI C;  3DDT A;  2VNF A;  5LKU A;  4I7C A;  1WIM A;  2KWK A;  2YSM A;  3M7K A;  1WEP A;  3U5M A;  4OGC A;  3L11 A;  4CCG X;  1VFY A;  3FL2 A;  2EOD A;  3E2D A;  4V3K C;  2FFW A;  2CT2 A;  3LQH A;  4O62 A;  1F62 A;  2F6N A;  2KWN A;  1DCQ A;  3FM8 C;  2M1R A;  4AYC A;  2MD8 C;  4AYC B;  1WEQ A;  4MVT A;  2VJE B;  5H1V A;  2D8S A;  2YSJ A;  5LKZ A;  2M3H A;  4PTB A;  2KWO A;  1VYX A;  3KV5 A;  5FB1 A;  3FAO A;  4I7D A;  5KH3 A;  1X4I A;  5LCW B;  2ECG A;  2MIQ A;  2EGM A;  2DSM A;  4CA1 A;  4FK5 A;  4QF3 A;  1U6G B;  4WA6 A;  3O36 A;  4UI9 B;  5D1L B;  2VPB A;  1WEM A;  4S3O B;  5B78 A;  3N9Q A;  1N87 A;  2EXU A;  3IHP A;  2L75 A;  2FSA A;  3EB6 A;  3JUE A;  2HDP A;  3PUR A;  5D1M B;  1WEN A;  2YUR A;  4A4C A;  2MA6 A;  2LGV A;  3SHB A;  3N9M A;  2QIC A;  1E4U A;  2QJ0 A;  2Y1M A;  5TDW A;  1WEO A;  2KIZ A;  1FP0 A;  2C2L A;  3DPL R;  4S3O C;  5TAB A;  5DIN A;  4ZQL A;  2VPG A;  2Y1N A;  2VJF A;  1RMD A;  2XOC A;  2VJF B;  4N4F A;  5SVY A;  2EGP A;  4AVX A;  4LKA A;  5H1U A;  4V3L C;  3GL6 A;  4GNF A;  5SVI B;  4GNG A;  3O37 A;  2YQL A;  3N9N A;  3FEH A;  3PLW A;  2YVR A;  5FEY A;  2MA5 A;  2ECW A;  2CKL A;  2YRE A;  4B7Y C;  2DX8 A;  2UZG A;  1MM2 A;  2CSZ A;  5J3X A;  4LAD B;  2DJA A;  3O33 A;  4O64 A;  4BBQ A;  2YYR A;  3N9O A;  2MUM A;  1HYJ A;  5EYA F;  2KKY A;  1WEU A;  2NAA A;  2ECT A;  2XP0 A;  4A49 A;  2P57 A;  2YU4 A;  1T1H A;  2ECV A;  2CON A;  2LAU A;  2KRE A;  1MBM A;  3VK6 A;  4YAD A;  2VP7 A;  5LKT A;  5JG6 A;  4R7E A;  2YQM A;  4BHW A;  1WFK A;  3ASL A;  1Z6U A;  2G6Q A;  3NG2 A;  3V43 A;  3HCT A;  2CRW A;  3LDY A;  2YHN A;  1BOR A;  4UP0 A;  1WEW A;  2AN6 A;  2VPD A;  4WZ3 B;  3LQI A;  2M13 A;  1JM7 A;  5AIT A;  2L80 A;  2KKX A;  3KV6 A;  3O7A A;  1JOC A;  1JM7 B;  2IDA A;  4Z0O A;  2XOY A;  1FBV A;  2PUY A;  2YHO A;  4AP4 A;  3U5P A;  2RSD A;  2CRR A;  1WGM A;  1WES A;  2XEU A;  5KH7 A;  2RI7 A;  4L58 A;  4GND A;  3LVR E;  4AUQ B;  4F1P A;  2L0B A;  2ECI A;  3ZVY A;  3ZPV 1;  5SVX A;  1X4J A;  2MNY A;  4A4B A;  2ECN A;  2RR4 A;  2L7P A;  5G05 B;  2MD7 B;  2L43 A;  3DQV R;  2KWJ A;  2BAY A;  2F42 A;  3EB5 A;  1V87 A;  5FER A;  2KU3 A;  1LDK C;  5AIU A;  3LJU X;  2PNX A;  5B76 A;  4YC9 A;  4IC3 A;  3MHH A;  1WEV A;  2MNZ A;  4WZ0 A;  4XI1 A;  4YBM A;  2LXP C;  2D8U A;  2K1J A;  2M6M A;  3MHS A;  3N9L A;  4YAX A;  3T9K A;  5G04 B;  1WE9 A;  1HYI A;  3SUB A;  4I7B A;  3ZPV E;  5H1T A;  2YW8 A;  3HTK C;  2XOZ A;  3ZTG A;  3PUQ A;  2KGG A;  3M63 A;  2JUN A;  2G43 A;  3DWD A;  3U5N A;  3L1X A;  3SOU A;  4C9Z A;  4N3W A;  3U5O A;  2LGL A;  2CKL B;  3O70 A;  2JRJ A;  1K2F A;  2EA6 A;  5TRB A;  3RPG B;  4UP5 A;  4Q6F A;  4YBS A;  2LGG A;  3HCU A;  1MM3 A;  5B75 A;  2LGK A;  5G0F A;  1VD4 A;  2QIZ A;  1G25 A;  1CHC A;  2E61 A;  3I2D A;  2IQJ A;  5C11 A;  5C13 A;  2JM3 A;  3GV4 A;  4LK9 A;  2FUI A;  3O47 A;  4LJN A;  1IYM A;  1X4U A;  1ZBD B;  3O35 A;  2LN0 A;  1LDJ B;  3RTR B;  5LKX A;  5B79 A;  3MDB C; 
#chains in the Genus database with same CATH homology
 3RPG C;  2KE1 A;  4R2Y A;  2OXQ C;  3L1Z B;  2VJE A;  4R8P K;  3PHD A;  4MSX A;  4W4U A;  3N9P A;  2CSY A;  4FO9 A;  5TDR A;  2M85 A;  4WZ2 A;  2VPE A;  4GB0 A;  2Y43 A;  2ECJ A;  3SOX A;  3SOW A;  4F52 B;  4NN2 A;  1Z2Q A;  4ZDT A;  2JMD A;  5H9M A;  4GNE A;  2KYU A;  2H0D A;  2L5U A;  3KNV A;  1XWH A;  2K17 A;  3ZYQ A;  2H0D B;  2LQ6 A;  2F6J A;  4B86 C;  5B8D A;  2HYE D;  4LLB A;  3M62 A;  3M99 A;  5KH9 A;  3LQJ A;  2YUC A;  2JMJ A;  2K16 A;  3ZVZ B;  2LV9 A;  2KR4 A;  4PPE A;  4TKP B;  4IC2 A;  2KFT A;  2E6R A;  2ZET C;  3C6W A;  3QZV A;  2FUU A;  2LDR A;  2LXH C;  3O34 A;  5B77 A;  3C5K A;  3KQI A;  5D1K B;  2K4D A;  3T7L A;  2G45 A;  2JMI A;  2YT5 A;  2C2V S;  4ZUX U;  5TBN A;  3T6R A;  1Z60 A;  4FIP A;  4QF2 A;  2I50 A;  4P5O B;  2KGI A;  4YAT A;  2MT5 A;  4X3G A;  4YBT A;  3ZNI A;  4FJC A;  2XB1 A;  5I3L A;  4L7X A;  4A0C D;  3LRQ A;  3HCS A;  4YAB A;  5DKA A;  5FB0 A;  2E6S A;  1WIL A;  1DVP A;  1WEE A;  2LRI C;  2VNF A;  5LKU A;  4I7C A;  1WIM A;  2KWK A;  2YSM A;  1WEP A;  3U5M A;  3L11 A;  4CCG X;  1VFY A;  3FL2 A;  2EOD A;  4V3K C;  2CT2 A;  3LQH A;  1F62 A;  2F6N A;  2KWN A;  2M1R A;  4AYC A;  2MD8 C;  4AYC B;  1WEQ A;  4MVT A;  2VJE B;  5H1V A;  2D8S A;  2YSJ A;  5LKZ A;  2M3H A;  4PTB A;  2KWO A;  1VYX A;  3KV5 A;  5FB1 A;  4I7D A;  5KH3 A;  1X4I A;  5LCW B;  2ECG A;  2MIQ A;  4CA1 A;  4FK5 A;  4QF3 A;  1U6G B;  4WA6 A;  3O36 A;  4UI9 B;  5D1L B;  2VPB A;  1WEM A;  4S3O B;  5B78 A;  3N9Q A;  1N87 A;  3IHP A;  2L75 A;  2FSA A;  3EB6 A;  2HDP A;  3PUR A;  5D1M B;  1WEN A;  2YUR A;  4A4C A;  2MA6 A;  2LGV A;  3SHB A;  3N9M A;  2QIC A;  1E4U A;  2QJ0 A;  2Y1M A;  5TDW A;  1WEO A;  2KIZ A;  1FP0 A;  2C2L A;  3DPL R;  4S3O C;  5TAB A;  5DIN A;  4ZQL A;  2VPG A;  2Y1N A;  2VJF A;  1RMD A;  2VJF B;  4N4F A;  2EGP A;  4AVX A;  4LKA A;  5H1U A;  4V3L C;  3GL6 A;  4GNF A;  4GNG A;  3O37 A;  2YQL A;  3N9N A;  5FEY A;  2MA5 A;  2ECW A;  2CKL A;  2YRE A;  4B7Y C;  2DX8 A;  2UZG A;  1MM2 A;  2CSZ A;  5J3X A;  4LAD B;  3O33 A;  4O64 A;  4BBQ A;  2YYR A;  3N9O A;  2MUM A;  1HYJ A;  5EYA F;  1WEU A;  2NAA A;  2ECT A;  4A49 A;  2YU4 A;  1T1H A;  2ECV A;  2KRE A;  3VK6 A;  4YAD A;  2VP7 A;  5LKT A;  5JG6 A;  4R7E A;  2YQM A;  4BHW A;  1WFK A;  3ASL A;  1Z6U A;  2G6Q A;  3NG2 A;  3V43 A;  3HCT A;  2YHN A;  1BOR A;  4UP0 A;  1WEW A;  2AN6 A;  2VPD A;  4WZ3 B;  3LQI A;  1JM7 A;  5AIT A;  2L80 A;  3KV6 A;  3O7A A;  1JOC A;  1JM7 B;  2IDA A;  1FBV A;  2PUY A;  2YHO A;  4AP4 A;  3U5P A;  2RSD A;  1WGM A;  1WES A;  2XEU A;  5KH7 A;  2RI7 A;  4L58 A;  4GND A;  4AUQ B;  2L0B A;  2ECI A;  3ZVY A;  3ZPV 1;  1X4J A;  2MNY A;  4A4B A;  2ECN A;  5G05 B;  2MD7 B;  2L43 A;  3DQV R;  2KWJ A;  2BAY A;  2F42 A;  3EB5 A;  1V87 A;  5FER A;  2KU3 A;  1LDK C;  5AIU A;  2PNX A;  5B76 A;  4YC9 A;  4IC3 A;  3MHH A;  1WEV A;  2MNZ A;  4WZ0 A;  4XI1 A;  4YBM A;  2LXP C;  2K1J A;  2M6M A;  3MHS A;  3N9L A;  4YAX A;  5G04 B;  1WE9 A;  1HYI A;  4I7B A;  3ZPV E;  5H1T A;  2YW8 A;  3HTK C;  3ZTG A;  3PUQ A;  2KGG A;  3M63 A;  2G43 A;  3U5N A;  3L1X A;  3SOU A;  4C9Z A;  4N3W A;  3U5O A;  2LGL A;  2CKL B;  3O70 A;  2JRJ A;  1K2F A;  2EA6 A;  5TRB A;  3RPG B;  4UP5 A;  4Q6F A;  4YBS A;  2LGG A;  3HCU A;  1MM3 A;  5B75 A;  2LGK A;  5G0F A;  1VD4 A;  2QIZ A;  1G25 A;  1CHC A;  3I2D A;  5C11 A;  5C13 A;  3GV4 A;  4LK9 A;  2FUI A;  4LJN A;  1IYM A;  1X4U A;  1ZBD B;  3O35 A;  2LN0 A;  1LDJ B;  3RTR B;  5LKX A;  5B79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...