1G25A

Solution structure of the n-terminal domain of the human tfiih mat1 subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Domain of the Human TFIIH MAT1 Subunit: New Insights into the RING Finger Family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords CDK-ACTIVATING KINASE ASSEMBLY FACTOR MAT1
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2000-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17121 zf-C3HC4_5 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1g25A00
3RTRB 2HYED 3C6WA 4P5OB 3QZVA 5D1KB 5B79A 2D8SA 4CCGX 3ZPVE 4XI1A 3FL2A 5G0FA 5J3XA 5B75A 4WZ2A 5G04B 2MNZA 3GL6A 4ZUXU 4YABA 2KFTA 1K2FA 4QF2A 2K17A 5B78A 2M6MA 2KWNA 3L11A 2LQ6A 3GV4A 1X4JA 4V3KC 3KV6A 4GNFA 4YADA 5LCWB 1N87A 2LRIC 2VP7A 2QICA 3L1XA 2BAYA 3N9LA 2YHOA 4FJCA 5KH3A 2KR4A 4A0CD 1JOCA 2Y1MA 1VYXA 2F6NA 1WENA 3ZPV1 4O64A 1E4UA 4IC2A 2KIZA 4YBSA 4F52B 2YW8A 2ECTA 2CKLB 3N9PA 3RPGC 2L43A 3U5NA 2L80A 5H1VA 2ZETC 3SOUA 4R7EA 2YYRA 4PTBA 4TKPB 4S3OB 3O70A 3V43A 4UP5A 4CA1A 2YURA 2LV9A 1VFYA 3I2DA 2C2VS 3KNVA 4AYCB 3ZVZB 2CT2A 2VNFA 2KWOA 4LJNA 5AIUA 2KE1A 5C13A 5FB1A 3U5OA 2DX8A 4YAXA 4YATA 3N9MA 2XB1A 4GNEA 1DVPA 1RMDA 4A49A 2JMJA 5FEYA 2RSDA 3O34A 5EYAF 5B76A 2KGGA 2MUMA 1HYIA 4LKAA 4A4BA 1XWHA 4QF3A 2VPBA 1WEEA 3SOWA 2MT5A 1WEPA 5JG6A 2ECJA 2HDPA 3ZTGA 4Q6FA 5G05B 1FBVA 1MM2A 2ECVA 4N3WA 1BORA 2KREA 4C9ZA 5I3LA 3U5MA 1F62A 4UP0A 1FP0A 3L1ZB 3LQJA 2ECGA 3HCSA 1CHCA 1WFKA 2K16A 3HTKC 3LQIA 4L58A 4WZ0A 2L75A 5TRBA 3N9QA 1T1HA 2MNYA 3ASLA 4R2YA 3MHSA 2YU4A 4A4CA 2VPEA 2G43A 4LK9A 5H9MA 4IC3A 4YBTA 2VJEA 1WEMA 2K1JA 5LKZA 1G25A 2EA6A 2YREA 4B86C 4LLBA 2MD7B 2FSAA 3KV5A 2CSZA 4V3LC 5AITA 1VD4A 2M85A 2E6RA 4AVXA 2LDRA 1ZBDB 2QIZA 2LGVA 4MVTA 3VK6A 5B8DA 1WGMA 2C2LA 2L0BA 4B7YC 2JRJA 4BBQA 2NAAA 2YUCA 5TDWA 2CKLA 2VJFA 4PPEA 2QJ0A 2MA5A 1X4IA 2RI7A 4ZQLA 2EGPA 3N9NA 3DQVR 3T6RA 2IDAA 1U6GB 3SOXA 2LN0A 2KYUA 5D1LB 2F42A 3EB6A 5LKXA 2LGKA 3EB5A 4AP4A 1WEVA 2ECWA 2KGIA 3O35A 1WEOA 4FIPA 2PUYA 2LXPC 2F6JA 5D1MB 3DPLR 3HCUA 2M3HA 4S3OC 3MHHA 1LDJB 2I50A 4FK5A 2OXQC 5DKAA 3PURA 3ZNIA 1Z6UA 4X3GA 4MSXA 2JMIA 4L7XA 2MD8C 4YC9A 4R8PK 2L5UA 2YT5A 4I7DA 2KWJA 3LQHA 3LRQA 2K4DA 3O7AA 5KH7A 4NN2A 4LADB 4I7BA 2KU3A 2Y1NA 3HCTA 5B77A 4WZ3B 1V87A 4BHWA 2FUUA 3RPGB 1Z2QA 1HYJA 5KH9A 3N9OA 1WE9A 2H0DA 1JM7B 2LXHC 2VPDA 3U5PA 3O37A 2MA6A 1JM7A 2XEUA 3ZVYA 2AN6A 2YSMA 5FERA 1WESA 2KWKA 2VJEB 4YBMA 2CSYA 1WEWA 3SHBA 4GNDA 4ZDTA 4GB0A 1IYMA 2EODA 1WILA 2YQLA 3ZYQA 5LKUA 1X4UA 3NG2A 1LDKC 1MM3A 3T7LA 1WIMA 2H0DB 2LGLA 2G6QA 3IHPA 5TABA 2FUIA 2YHNA 2G45A 2YSJA 5C11A 5H1UA 4GNGA 2VPGA 5DINA 4FO9A 1Z60A 2JMDA 3M63A 2UZGA 3PUQA 4W4UA 3O36A 2ECNA 4UI9B 5LKTA 3KQIA 4N4FA 4WA6A 5TDRA 2ECIA 3M62A 2PNXA 5TBNA 1WEUA 4I7CA 3PHDA 4AYCA 3C5KA 5FB0A 2LGGA 2Y43A 2M1RA 2YQMA 2MIQA 3M99A 1WEQA 2VJFB 3O33A 4AUQB 5H1TA 2E6SA
chains in the Genus database with same CATH superfamily
1MBMA 3RTRB 2HYED 3C6WA 4P5OB 3QZVA 3FANA 5D1KB 5B79A 2D8SA 4CCGX 3ZPVE 4XI1A 3FL2A 5G0FA 5J3XA 5B75A 4WZ2A 5G04B 2MNZA 2CONA 4H9DA 2XOZA 3GL6A 4ZUXU 4YABA 2KFTA 1K2FA 4QF2A 2K17A 5B78A 2M6MA 2KWNA 2IQJA 3L11A 2LQ6A 3DWDA 2YVRA 3GV4A 1X4JA 4V3KC 3KV6A 4GNFA 4YADA 5LCWB 4O62A 1N87A 2LRIC 2VP7A 2QICA 2EXUA 3L1XA 2BAYA 3N9LA 2YHOA 4FJCA 5KH3A 1DCQA 2KR4A 4A0CD 1JOCA 2Y1MA 1VYXA 2F6NA 1WENA 3LVRE 3ZPV1 4O64A 2CRRA 1E4UA 2L7PA 4IC2A 2KIZA 2XOCA 4YBSA 4F52B 2YW8A 2ECTA 2CKLB 3N9PA 3RPGC 2L43A 3U5NA 2KKXA 2L80A 5H1VA 2ZETC 3SOUA 4R7EA 2YYRA 4PTBA 4TKPB 4S3OB 3O70A 3V43A 4UP5A 4CA1A 3DDTA 2YURA 2LV9A 1VFYA 3I2DA 2C2VS 3KNVA 4AYCB 3ZVZB 2CT2A 2VNFA 2KWOA 4Z0RA 4LJNA 5AIUA 2KE1A 5C13A 2E61A 5FB1A 3U5OA 2DX8A 3E2DA 4YAXA 4YATA 3N9MA 2XB1A 4GNEA 2EGMA 1DVPA 1RMDA 4A49A 2JMJA 4OGEA 5FEYA 2RSDA 3O34A 5EYAF 2FFWA 2KGGA 5B76A 2MUMA 1HYIA 4LKAA 4A4BA 3JUEA 1XWHA 4QF3A 2LAUA 2VPBA 1WEEA 3SOWA 2MT5A 1WEPA 5JG6A 2ECJA 2HDPA 3ZTGA 4Q6FA 5G05B 1FBVA 1MM2A 2ECVA 4N3WA 1BORA 2RR4A 2KREA 4C9ZA 5I3LA 2DJAA 3U5MA 2XOYA 1F62A 4UP0A 1FP0A 3L1ZB 3LQJA 2B0OE 2ECGA 3HCSA 1CHCA 1WFKA 2K16A 3HTKC 3LQIA 4L58A 4WZ0A 2L75A 5SVIA 3LDYA 5TRBA 3N9QA 1T1HA 2MNYA 3ASLA 4R2YA 3MHSA 2YU4A 3T9KA 4A4CA 2VPEA 2G43A 3PLWA 4LK9A 5H9MA 4IC3A 4YBTA 2VJEA 1WEMA 2K1JA 5LKZA 1G25A 2EA6A 2YREA 4B86C 4LLBA 2MD7B 2FSAA 3KV5A 2CSZA 4V3LC 5AITA 2KKYA 2OWAA 1VD4A 2M85A 2E6RA 4AVXA 2LDRA 1ZBDB 2QIZA 5SVYA 3FJUB 2LGVA 4MVTA 3VK6A 5B8DA 1WGMA 2C2LA 2XP0A 2L0BA 4B7YC 2JRJA 4BBQA 2NAAA 2YUCA 5TDWA 2CKLA 2VJFA 4F1PA 4PPEA 2QJ0A 2MA5A 1X4IA 2RI7A 4ZQLA 2EGPA 2P57A 3O47A 3N9NA 3DQVR 3T6RA 2IDAA 1U6GB 3SOXA 2LN0A 2KYUA 5D1LB 2F42A 3SUBA 3EB6A 5LKXA 2LGKA 3EB5A 4AP4A 1WEVA 2ECWA 2KGIA 3O35A 1WEOA 4FIPA 3LJUX 4OGCA 2PUYA 2LXPC 2F6JA 5D1MB 3DPLR 3HCUA 3MDBC 2M3HA 4S3OC 3MHHA 1LDJB 2I50A 4FK5A 2OXQC 5DKAA 3PURA 3ZNIA 1Z6UA 4X3GA 4MSXA 2JMIA 4L7XA 2MD8C 4YC9A 4R8PK 2CRWA 2L5UA 2YT5A 4I7DA 2KWJA 3H7HA 3FM8C 3LQHA 3LRQA 2D8UA 2K4DA 3O7AA 5KH7A 3FEHA 4NN2A 4LADB 4I7BA 2KU3A 2Y1NA 3HCTA 5B77A 4WZ3B 1V87A 2FUUA 3RPGB 4BHWA 1Z2QA 1HYJA 5KH9A 1WE9A 3N9OA 2CSVA 2H0DA 1JM7B 2LXHC 2VPDA 3U5PA 3O37A 2MA6A 1JM7A 5K3QA 2XEUA 2MKEA 2AN6A 2YSMA 5SVXA 3ZVYA 5FERA 1WESA 2KWKA 2VJEB 4YBMA 2CSYA 1WEWA 3M7KA 3SHBA 2JUNA 4GNDA 4ZDTA 4GB0A 1IYMA 2EODA 1WILA 2YQLA 3ZYQA 5LKUA 1X4UA 3NG2A 3Q1DA 1LDKC 1MM3A 3T7LA 1WIMA 2H0DB 2LGLA 2G6QA 3FAOA 3IHPA 5TABA 2FUIA 2YHNA 2G45A 2YSJA 5C11A 5H1UA 4GNGA 2VPGA 4QQ4A 5DINA 4FO9A 2DSMA 1Z60A 2JMDA 2M13A 3M63A 2UZGA 3PUQA 4W4UA 3O36A 2ECNA 4UI9B 5LKTA 3KQIA 4N4FA 4WA6A 5TDRA 2ECIA 3M62A 2PNXA 5SVIB 5TBNA 2JM3A 1WEUA 4I7CA 3PHDA 4AYCA 3C5KA 5FB0A 2LGGA 2Y43A 2M1RA 3LVQE 2YQMA 2MIQA 3M99A 1WEQA 2VJFB 3O33A 4AUQB 5H1TA 3KDEC 4Z0OA 2E6SA 2FD4A
chains in the Genus database with same CATH topology
3RTRB 2HYED 3C6WA 4P5OB 3QZVA 5D1KB 5B79A 2D8SA 4CCGX 3ZPVE 4XI1A 3FL2A 5G0FA 5J3XA 5B75A 4WZ2A 5G04B 2MNZA 3GL6A 4ZUXU 4YABA 2KFTA 1K2FA 4QF2A 2K17A 5B78A 2M6MA 2KWNA 3L11A 2LQ6A 3GV4A 1X4JA 4V3KC 3KV6A 4GNFA 4YADA 5LCWB 1N87A 2LRIC 2VP7A 2QICA 3L1XA 2BAYA 3N9LA 2YHOA 4FJCA 5KH3A 2KR4A 4A0CD 1JOCA 2Y1MA 1VYXA 2F6NA 1WENA 3ZPV1 4O64A 1E4UA 4IC2A 2KIZA 4YBSA 4F52B 2YW8A 2ECTA 2CKLB 3N9PA 3RPGC 2L43A 3U5NA 2L80A 5H1VA 2ZETC 3SOUA 4R7EA 2YYRA 4PTBA 4TKPB 4S3OB 3O70A 3V43A 4UP5A 4CA1A 2YURA 2LV9A 1VFYA 3I2DA 2C2VS 3KNVA 4AYCB 3ZVZB 2CT2A 2VNFA 2KWOA 4LJNA 5AIUA 2KE1A 5C13A 5FB1A 3U5OA 2DX8A 4YAXA 4YATA 3N9MA 2XB1A 4GNEA 1DVPA 1RMDA 4A49A 2JMJA 5FEYA 2RSDA 3O34A 5EYAF 5B76A 2KGGA 2MUMA 1HYIA 4LKAA 4A4BA 1XWHA 4QF3A 2VPBA 1WEEA 3SOWA 2MT5A 1WEPA 5JG6A 2ECJA 2HDPA 3ZTGA 4Q6FA 5G05B 1FBVA 1MM2A 2ECVA 4N3WA 1BORA 2KREA 4C9ZA 5I3LA 3U5MA 1F62A 4UP0A 1FP0A 3L1ZB 3LQJA 2ECGA 3HCSA 1CHCA 1WFKA 2K16A 3HTKC 3LQIA 4L58A 4WZ0A 2L75A 5TRBA 3N9QA 1T1HA 2MNYA 3ASLA 4R2YA 3MHSA 2YU4A 4A4CA 2VPEA 2G43A 4LK9A 5H9MA 4IC3A 4YBTA 2VJEA 1WEMA 2K1JA 5LKZA 1G25A 2EA6A 2YREA 4B86C 4LLBA 2MD7B 2FSAA 3KV5A 2CSZA 4V3LC 5AITA 1VD4A 2M85A 2E6RA 4AVXA 2LDRA 1ZBDB 2QIZA 2LGVA 4MVTA 3VK6A 5B8DA 1WGMA 2C2LA 2L0BA 4B7YC 2JRJA 4BBQA 2NAAA 2YUCA 5TDWA 2CKLA 2VJFA 4PPEA 2QJ0A 2MA5A 1X4IA 2RI7A 4ZQLA 2EGPA 3N9NA 3DQVR 3T6RA 2IDAA 1U6GB 3SOXA 2LN0A 2KYUA 5D1LB 2F42A 3EB6A 5LKXA 2LGKA 3EB5A 4AP4A 1WEVA 2ECWA 2KGIA 3O35A 1WEOA 4FIPA 2PUYA 2LXPC 2F6JA 5D1MB 3DPLR 3HCUA 2M3HA 4S3OC 3MHHA 1LDJB 2I50A 4FK5A 2OXQC 5DKAA 3PURA 3ZNIA 1Z6UA 4X3GA 4MSXA 2JMIA 4L7XA 2MD8C 4YC9A 4R8PK 2L5UA 2YT5A 4I7DA 2KWJA 3LQHA 3LRQA 2K4DA 3O7AA 5KH7A 4NN2A 4LADB 4I7BA 2KU3A 2Y1NA 3HCTA 5B77A 4WZ3B 1V87A 4BHWA 2FUUA 3RPGB 1Z2QA 1HYJA 5KH9A 3N9OA 1WE9A 2H0DA 1JM7B 2LXHC 2VPDA 3U5PA 3O37A 2MA6A 1JM7A 2XEUA 3ZVYA 2AN6A 2YSMA 5FERA 1WESA 2KWKA 2VJEB 4YBMA 2CSYA 1WEWA 3SHBA 4GNDA 4ZDTA 4GB0A 1IYMA 2EODA 1WILA 2YQLA 3ZYQA 5LKUA 1X4UA 3NG2A 1LDKC 1MM3A 3T7LA 1WIMA 2H0DB 2LGLA 2G6QA 3IHPA 5TABA 2FUIA 2YHNA 2G45A 2YSJA 5C11A 5H1UA 4GNGA 2VPGA 5DINA 4FO9A 1Z60A 2JMDA 3M63A 2UZGA 3PUQA 4W4UA 3O36A 2ECNA 4UI9B 5LKTA 3KQIA 4N4FA 4WA6A 5TDRA 2ECIA 3M62A 2PNXA 5TBNA 1WEUA 4I7CA 3PHDA 4AYCA 3C5KA 5FB0A 2LGGA 2Y43A 2M1RA 2YQMA 2MIQA 3M99A 1WEQA 2VJFB 3O33A 4AUQB 5H1TA 2E6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTR B;  2HYE D;  3C6W A;  4P5O B;  3QZV A;  5D1K B;  5B79 A;  2D8S A;  4CCG X;  3ZPV E;  4XI1 A;  3FL2 A;  5G0F A;  5J3X A;  5B75 A;  4WZ2 A;  5G04 B;  2MNZ A;  3GL6 A;  4ZUX U;  4YAB A;  2KFT A;  1K2F A;  4QF2 A;  2K17 A;  5B78 A;  2M6M A;  2KWN A;  3L11 A;  2LQ6 A;  3GV4 A;  1X4J A;  4V3K C;  3KV6 A;  4GNF A;  4YAD A;  5LCW B;  1N87 A;  2LRI C;  2VP7 A;  2QIC A;  3L1X A;  2BAY A;  3N9L A;  2YHO A;  4FJC A;  5KH3 A;  2KR4 A;  4A0C D;  1JOC A;  2Y1M A;  1VYX A;  2F6N A;  1WEN A;  3ZPV 1;  4O64 A;  1E4U A;  4IC2 A;  2KIZ A;  4YBS A;  4F52 B;  2YW8 A;  2ECT A;  2CKL B;  3N9P A;  3RPG C;  2L43 A;  3U5N A;  2L80 A;  5H1V A;  2ZET C;  3SOU A;  4R7E A;  2YYR A;  4PTB A;  4TKP B;  4S3O B;  3O70 A;  3V43 A;  4UP5 A;  4CA1 A;  2YUR A;  2LV9 A;  1VFY A;  3I2D A;  2C2V S;  3KNV A;  4AYC B;  3ZVZ B;  2CT2 A;  2VNF A;  2KWO A;  4LJN A;  5AIU A;  2KE1 A;  5C13 A;  5FB1 A;  3U5O A;  2DX8 A;  4YAX A;  4YAT A;  3N9M A;  2XB1 A;  4GNE A;  1DVP A;  1RMD A;  4A49 A;  2JMJ A;  5FEY A;  2RSD A;  3O34 A;  5EYA F;  5B76 A;  2KGG A;  2MUM A;  1HYI A;  4LKA A;  4A4B A;  1XWH A;  4QF3 A;  2VPB A;  1WEE A;  3SOW A;  2MT5 A;  1WEP A;  5JG6 A;  2ECJ A;  2HDP A;  3ZTG A;  4Q6F A;  5G05 B;  1FBV A;  1MM2 A;  2ECV A;  4N3W A;  1BOR A;  2KRE A;  4C9Z A;  5I3L A;  3U5M A;  1F62 A;  4UP0 A;  1FP0 A;  3L1Z B;  3LQJ A;  2ECG A;  3HCS A;  1CHC A;  1WFK A;  2K16 A;  3HTK C;  3LQI A;  4L58 A;  4WZ0 A;  2L75 A;  5TRB A;  3N9Q A;  1T1H A;  2MNY A;  3ASL A;  4R2Y A;  3MHS A;  2YU4 A;  4A4C A;  2VPE A;  2G43 A;  4LK9 A;  5H9M A;  4IC3 A;  4YBT A;  2VJE A;  1WEM A;  2K1J A;  5LKZ A;  1G25 A;  2EA6 A;  2YRE A;  4B86 C;  4LLB A;  2MD7 B;  2FSA A;  3KV5 A;  2CSZ A;  4V3L C;  5AIT A;  1VD4 A;  2M85 A;  2E6R A;  4AVX A;  2LDR A;  1ZBD B;  2QIZ A;  2LGV A;  4MVT A;  3VK6 A;  5B8D A;  1WGM A;  2C2L A;  2L0B A;  4B7Y C;  2JRJ A;  4BBQ A;  2NAA A;  2YUC A;  5TDW A;  2CKL A;  2VJF A;  4PPE A;  2QJ0 A;  2MA5 A;  1X4I A;  2RI7 A;  4ZQL A;  2EGP A;  3N9N A;  3DQV R;  3T6R A;  2IDA A;  1U6G B;  3SOX A;  2LN0 A;  2KYU A;  5D1L B;  2F42 A;  3EB6 A;  5LKX A;  2LGK A;  3EB5 A;  4AP4 A;  1WEV A;  2ECW A;  2KGI A;  3O35 A;  1WEO A;  4FIP A;  2PUY A;  2LXP C;  2F6J A;  5D1M B;  3DPL R;  3HCU A;  2M3H A;  4S3O C;  3MHH A;  1LDJ B;  2I50 A;  4FK5 A;  2OXQ C;  5DKA A;  3PUR A;  3ZNI A;  1Z6U A;  4X3G A;  4MSX A;  2JMI A;  4L7X A;  2MD8 C;  4YC9 A;  4R8P K;  2L5U A;  2YT5 A;  4I7D A;  2KWJ A;  3LQH A;  3LRQ A;  2K4D A;  3O7A A;  5KH7 A;  4NN2 A;  4LAD B;  4I7B A;  2KU3 A;  2Y1N A;  3HCT A;  5B77 A;  4WZ3 B;  1V87 A;  4BHW A;  2FUU A;  3RPG B;  1Z2Q A;  1HYJ A;  5KH9 A;  3N9O A;  1WE9 A;  2H0D A;  1JM7 B;  2LXH C;  2VPD A;  3U5P A;  3O37 A;  2MA6 A;  1JM7 A;  2XEU A;  3ZVY A;  2AN6 A;  2YSM A;  5FER A;  1WES A;  2KWK A;  2VJE B;  4YBM A;  2CSY A;  1WEW A;  3SHB A;  4GND A;  4ZDT A;  4GB0 A;  1IYM A;  2EOD A;  1WIL A;  2YQL A;  3ZYQ A;  5LKU A;  1X4U A;  3NG2 A;  1LDK C;  1MM3 A;  3T7L A;  1WIM A;  2H0D B;  2LGL A;  2G6Q A;  3IHP A;  5TAB A;  2FUI A;  2YHN A;  2G45 A;  2YSJ A;  5C11 A;  5H1U A;  4GNG A;  2VPG A;  5DIN A;  4FO9 A;  1Z60 A;  2JMD A;  3M63 A;  2UZG A;  3PUQ A;  4W4U A;  3O36 A;  2ECN A;  4UI9 B;  5LKT A;  3KQI A;  4N4F A;  4WA6 A;  5TDR A;  2ECI A;  3M62 A;  2PNX A;  5TBN A;  1WEU A;  4I7C A;  3PHD A;  4AYC A;  3C5K A;  5FB0 A;  2LGG A;  2Y43 A;  2M1R A;  2YQM A;  2MIQ A;  3M99 A;  1WEQ A;  2VJF B;  3O33 A;  4AUQ B;  5H1T A;  2E6S A; 
#chains in the Genus database with same CATH topology
 1MBM A;  3RTR B;  2HYE D;  3C6W A;  4P5O B;  3QZV A;  3FAN A;  5D1K B;  5B79 A;  2D8S A;  4CCG X;  3ZPV E;  4XI1 A;  3FL2 A;  5G0F A;  5J3X A;  5B75 A;  4WZ2 A;  5G04 B;  2MNZ A;  2CON A;  4H9D A;  2XOZ A;  3GL6 A;  4ZUX U;  4YAB A;  2KFT A;  1K2F A;  4QF2 A;  2K17 A;  5B78 A;  2M6M A;  2KWN A;  2IQJ A;  3L11 A;  2LQ6 A;  3DWD A;  2YVR A;  3GV4 A;  1X4J A;  4V3K C;  3KV6 A;  4GNF A;  4YAD A;  5LCW B;  4O62 A;  1N87 A;  2LRI C;  2VP7 A;  2QIC A;  2EXU A;  3L1X A;  2BAY A;  3N9L A;  2YHO A;  4FJC A;  5KH3 A;  1DCQ A;  2KR4 A;  4A0C D;  1JOC A;  2Y1M A;  1VYX A;  2F6N A;  1WEN A;  3LVR E;  3ZPV 1;  4O64 A;  2CRR A;  1E4U A;  2L7P A;  4IC2 A;  2KIZ A;  2XOC A;  4YBS A;  4F52 B;  2YW8 A;  2ECT A;  2CKL B;  3N9P A;  3RPG C;  2L43 A;  3U5N A;  2KKX A;  2L80 A;  5H1V A;  2ZET C;  3SOU A;  4R7E A;  2YYR A;  4PTB A;  4TKP B;  4S3O B;  3O70 A;  3V43 A;  4UP5 A;  4CA1 A;  3DDT A;  2YUR A;  2LV9 A;  1VFY A;  3I2D A;  2C2V S;  3KNV A;  4AYC B;  3ZVZ B;  2CT2 A;  2VNF A;  2KWO A;  4Z0R A;  4LJN A;  5AIU A;  2KE1 A;  5C13 A;  2E61 A;  5FB1 A;  3U5O A;  2DX8 A;  3E2D A;  4YAX A;  4YAT A;  3N9M A;  2XB1 A;  4GNE A;  2EGM A;  1DVP A;  1RMD A;  4A49 A;  2JMJ A;  4OGE A;  5FEY A;  2RSD A;  3O34 A;  5EYA F;  2FFW A;  2KGG A;  5B76 A;  2MUM A;  1HYI A;  4LKA A;  4A4B A;  3JUE A;  1XWH A;  4QF3 A;  2LAU A;  2VPB A;  1WEE A;  3SOW A;  2MT5 A;  1WEP A;  5JG6 A;  2ECJ A;  2HDP A;  3ZTG A;  4Q6F A;  5G05 B;  1FBV A;  1MM2 A;  2ECV A;  4N3W A;  1BOR A;  2RR4 A;  2KRE A;  4C9Z A;  5I3L A;  2DJA A;  3U5M A;  2XOY A;  1F62 A;  4UP0 A;  1FP0 A;  3L1Z B;  3LQJ A;  2B0O E;  2ECG A;  3HCS A;  1CHC A;  1WFK A;  2K16 A;  3HTK C;  3LQI A;  4L58 A;  4WZ0 A;  2L75 A;  5SVI A;  3LDY A;  5TRB A;  3N9Q A;  1T1H A;  2MNY A;  3ASL A;  4R2Y A;  3MHS A;  2YU4 A;  3T9K A;  4A4C A;  2VPE A;  2G43 A;  3PLW A;  4LK9 A;  5H9M A;  4IC3 A;  4YBT A;  2VJE A;  1WEM A;  2K1J A;  5LKZ A;  1G25 A;  2EA6 A;  2YRE A;  4B86 C;  4LLB A;  2MD7 B;  2FSA A;  3KV5 A;  2CSZ A;  4V3L C;  5AIT A;  2KKY A;  2OWA A;  1VD4 A;  2M85 A;  2E6R A;  4AVX A;  2LDR A;  1ZBD B;  2QIZ A;  5SVY A;  3FJU B;  2LGV A;  4MVT A;  3VK6 A;  5B8D A;  1WGM A;  2C2L A;  2XP0 A;  2L0B A;  4B7Y C;  2JRJ A;  4BBQ A;  2NAA A;  2YUC A;  5TDW A;  2CKL A;  2VJF A;  4F1P A;  4PPE A;  2QJ0 A;  2MA5 A;  1X4I A;  2RI7 A;  4ZQL A;  2EGP A;  2P57 A;  3O47 A;  3N9N A;  3DQV R;  3T6R A;  2IDA A;  1U6G B;  3SOX A;  2LN0 A;  2KYU A;  5D1L B;  2F42 A;  3SUB A;  3EB6 A;  5LKX A;  2LGK A;  3EB5 A;  4AP4 A;  1WEV A;  2ECW A;  2KGI A;  3O35 A;  1WEO A;  4FIP A;  3LJU X;  4OGC A;  2PUY A;  2LXP C;  2F6J A;  5D1M B;  3DPL R;  3HCU A;  3MDB C;  2M3H A;  4S3O C;  3MHH A;  1LDJ B;  2I50 A;  4FK5 A;  2OXQ C;  5DKA A;  3PUR A;  3ZNI A;  1Z6U A;  4X3G A;  4MSX A;  2JMI A;  4L7X A;  2MD8 C;  4YC9 A;  4R8P K;  2CRW A;  2L5U A;  2YT5 A;  4I7D A;  2KWJ A;  3H7H A;  3FM8 C;  3LQH A;  3LRQ A;  2D8U A;  2K4D A;  3O7A A;  5KH7 A;  3FEH A;  4NN2 A;  4LAD B;  4I7B A;  2KU3 A;  2Y1N A;  3HCT A;  5B77 A;  4WZ3 B;  1V87 A;  2FUU A;  3RPG B;  4BHW A;  1Z2Q A;  1HYJ A;  5KH9 A;  1WE9 A;  3N9O A;  2CSV A;  2H0D A;  1JM7 B;  2LXH C;  2VPD A;  3U5P A;  3O37 A;  2MA6 A;  1JM7 A;  5K3Q A;  2XEU A;  2MKE A;  2AN6 A;  2YSM A;  5SVX A;  3ZVY A;  5FER A;  1WES A;  2KWK A;  2VJE B;  4YBM A;  2CSY A;  1WEW A;  3M7K A;  3SHB A;  2JUN A;  4GND A;  4ZDT A;  4GB0 A;  1IYM A;  2EOD A;  1WIL A;  2YQL A;  3ZYQ A;  5LKU A;  1X4U A;  3NG2 A;  3Q1D A;  1LDK C;  1MM3 A;  3T7L A;  1WIM A;  2H0D B;  2LGL A;  2G6Q A;  3FAO A;  3IHP A;  5TAB A;  2FUI A;  2YHN A;  2G45 A;  2YSJ A;  5C11 A;  5H1U A;  4GNG A;  2VPG A;  4QQ4 A;  5DIN A;  4FO9 A;  2DSM A;  1Z60 A;  2JMD A;  2M13 A;  3M63 A;  2UZG A;  3PUQ A;  4W4U A;  3O36 A;  2ECN A;  4UI9 B;  5LKT A;  3KQI A;  4N4F A;  4WA6 A;  5TDR A;  2ECI A;  3M62 A;  2PNX A;  5SVI B;  5TBN A;  2JM3 A;  1WEU A;  4I7C A;  3PHD A;  4AYC A;  3C5K A;  5FB0 A;  2LGG A;  2Y43 A;  2M1R A;  3LVQ E;  2YQM A;  2MIQ A;  3M99 A;  1WEQ A;  2VJF B;  3O33 A;  4AUQ B;  5H1T A;  3KDE C;  4Z0O A;  2E6S A;  2FD4 A; 
#chains in the Genus database with same CATH homology
 3RTR B;  2HYE D;  3C6W A;  4P5O B;  3QZV A;  5D1K B;  5B79 A;  2D8S A;  4CCG X;  3ZPV E;  4XI1 A;  3FL2 A;  5G0F A;  5J3X A;  5B75 A;  4WZ2 A;  5G04 B;  2MNZ A;  3GL6 A;  4ZUX U;  4YAB A;  2KFT A;  1K2F A;  4QF2 A;  2K17 A;  5B78 A;  2M6M A;  2KWN A;  3L11 A;  2LQ6 A;  3GV4 A;  1X4J A;  4V3K C;  3KV6 A;  4GNF A;  4YAD A;  5LCW B;  1N87 A;  2LRI C;  2VP7 A;  2QIC A;  3L1X A;  2BAY A;  3N9L A;  2YHO A;  4FJC A;  5KH3 A;  2KR4 A;  4A0C D;  1JOC A;  2Y1M A;  1VYX A;  2F6N A;  1WEN A;  3ZPV 1;  4O64 A;  1E4U A;  4IC2 A;  2KIZ A;  4YBS A;  4F52 B;  2YW8 A;  2ECT A;  2CKL B;  3N9P A;  3RPG C;  2L43 A;  3U5N A;  2L80 A;  5H1V A;  2ZET C;  3SOU A;  4R7E A;  2YYR A;  4PTB A;  4TKP B;  4S3O B;  3O70 A;  3V43 A;  4UP5 A;  4CA1 A;  2YUR A;  2LV9 A;  1VFY A;  3I2D A;  2C2V S;  3KNV A;  4AYC B;  3ZVZ B;  2CT2 A;  2VNF A;  2KWO A;  4LJN A;  5AIU A;  2KE1 A;  5C13 A;  5FB1 A;  3U5O A;  2DX8 A;  4YAX A;  4YAT A;  3N9M A;  2XB1 A;  4GNE A;  1DVP A;  1RMD A;  4A49 A;  2JMJ A;  5FEY A;  2RSD A;  3O34 A;  5EYA F;  5B76 A;  2KGG A;  2MUM A;  1HYI A;  4LKA A;  4A4B A;  1XWH A;  4QF3 A;  2VPB A;  1WEE A;  3SOW A;  2MT5 A;  1WEP A;  5JG6 A;  2ECJ A;  2HDP A;  3ZTG A;  4Q6F A;  5G05 B;  1FBV A;  1MM2 A;  2ECV A;  4N3W A;  1BOR A;  2KRE A;  4C9Z A;  5I3L A;  3U5M A;  1F62 A;  4UP0 A;  1FP0 A;  3L1Z B;  3LQJ A;  2ECG A;  3HCS A;  1CHC A;  1WFK A;  2K16 A;  3HTK C;  3LQI A;  4L58 A;  4WZ0 A;  2L75 A;  5TRB A;  3N9Q A;  1T1H A;  2MNY A;  3ASL A;  4R2Y A;  3MHS A;  2YU4 A;  4A4C A;  2VPE A;  2G43 A;  4LK9 A;  5H9M A;  4IC3 A;  4YBT A;  2VJE A;  1WEM A;  2K1J A;  5LKZ A;  1G25 A;  2EA6 A;  2YRE A;  4B86 C;  4LLB A;  2MD7 B;  2FSA A;  3KV5 A;  2CSZ A;  4V3L C;  5AIT A;  1VD4 A;  2M85 A;  2E6R A;  4AVX A;  2LDR A;  1ZBD B;  2QIZ A;  2LGV A;  4MVT A;  3VK6 A;  5B8D A;  1WGM A;  2C2L A;  2L0B A;  4B7Y C;  2JRJ A;  4BBQ A;  2NAA A;  2YUC A;  5TDW A;  2CKL A;  2VJF A;  4PPE A;  2QJ0 A;  2MA5 A;  1X4I A;  2RI7 A;  4ZQL A;  2EGP A;  3N9N A;  3DQV R;  3T6R A;  2IDA A;  1U6G B;  3SOX A;  2LN0 A;  2KYU A;  5D1L B;  2F42 A;  3EB6 A;  5LKX A;  2LGK A;  3EB5 A;  4AP4 A;  1WEV A;  2ECW A;  2KGI A;  3O35 A;  1WEO A;  4FIP A;  2PUY A;  2LXP C;  2F6J A;  5D1M B;  3DPL R;  3HCU A;  2M3H A;  4S3O C;  3MHH A;  1LDJ B;  2I50 A;  4FK5 A;  2OXQ C;  5DKA A;  3PUR A;  3ZNI A;  1Z6U A;  4X3G A;  4MSX A;  2JMI A;  4L7X A;  2MD8 C;  4YC9 A;  4R8P K;  2L5U A;  2YT5 A;  4I7D A;  2KWJ A;  3LQH A;  3LRQ A;  2K4D A;  3O7A A;  5KH7 A;  4NN2 A;  4LAD B;  4I7B A;  2KU3 A;  2Y1N A;  3HCT A;  5B77 A;  4WZ3 B;  1V87 A;  4BHW A;  2FUU A;  3RPG B;  1Z2Q A;  1HYJ A;  5KH9 A;  3N9O A;  1WE9 A;  2H0D A;  1JM7 B;  2LXH C;  2VPD A;  3U5P A;  3O37 A;  2MA6 A;  1JM7 A;  2XEU A;  3ZVY A;  2AN6 A;  2YSM A;  5FER A;  1WES A;  2KWK A;  2VJE B;  4YBM A;  2CSY A;  1WEW A;  3SHB A;  4GND A;  4ZDT A;  4GB0 A;  1IYM A;  2EOD A;  1WIL A;  2YQL A;  3ZYQ A;  5LKU A;  1X4U A;  3NG2 A;  1LDK C;  1MM3 A;  3T7L A;  1WIM A;  2H0D B;  2LGL A;  2G6Q A;  3IHP A;  5TAB A;  2FUI A;  2YHN A;  2G45 A;  2YSJ A;  5C11 A;  5H1U A;  4GNG A;  2VPG A;  5DIN A;  4FO9 A;  1Z60 A;  2JMD A;  3M63 A;  2UZG A;  3PUQ A;  4W4U A;  3O36 A;  2ECN A;  4UI9 B;  5LKT A;  3KQI A;  4N4F A;  4WA6 A;  5TDR A;  2ECI A;  3M62 A;  2PNX A;  5TBN A;  1WEU A;  4I7C A;  3PHD A;  4AYC A;  3C5K A;  5FB0 A;  2LGG A;  2Y43 A;  2M1R A;  2YQM A;  2MIQ A;  3M99 A;  1WEQ A;  2VJF B;  3O33 A;  4AUQ B;  5H1T A;  2E6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...