1G25A

Solution structure of the n-terminal domain of the human tfiih mat1 subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDK-ACTIVATING KINASE ASSEMBLY FACTOR MAT1
publication title Solution Structure of the N-terminal Domain of the Human TFIIH MAT1 Subunit: New Insights into the RING Finger Family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2000-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17121 zf-C3HC4_5 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1g25A00
2VJEB 5B77A 1FP0A 4NN2A 3N9OA 3ZVYA 2YQLA 4FJCA 3ZYQA 1JM7A 3IHPA 1G25A 5AITA 1LDKC 4S3OC 3O33A 2QJ0A 2JMDA 3N9QA 2L80A 3U5OA 4IC2A 3SOUA 4BHWA 5EYAF 2G45A 5LKTA 5LKZA 2LGKA 5D1KB 3U5NA 4N4FA 4QF3A 2MA6A 2QIZA 2FUIA 1V87A 2XB1A 2M6MA 2LRIC 2VPEA 4GB0A 1XWHA 1VD4A 2LGLA 2ECGA 1IYMA 3EB6A 2KGIA 2PUYA 3KNVA 4I7BA 2L43A 2AN6A 4IC3A 1U6GB 4LKAA 3N9LA 2Y43A 1E4UA 2VJFA 4XI1A 3C6WA 4UP5A 1WENA 3KV6A 2PNXA 2K17A 3ZTGA 4PTBA 2JRJA 1WEVA 1WEEA 3SHBA 4FK5A 5G04B 2D8SA 2C2VS 2XEUA 2MT5A 2CKLB 5TRBA 2F6NA 2LV9A 3L1ZB 1X4UA 3O37A 4WZ3B 5D1MB 2YSMA 4W4UA 2VPBA 2KU3A 1X4IA 5C13A 5C11A 3FL2A 5DKAA 2MNYA 3U5MA 2LXHC 4LADB 4AUQB 1FBVA 4A4CA 4ZDTA 2YSJA 5H1VA 3L11A 2YHOA 1K2FA 4L58A 2ECWA 3MHHA 2KWJA 5H9MA 2YREA 4GNGA 4A4BA 2NAAA 4CA1A 2HDPA 3HCSA 2QICA 5TABA 2H0DA 2K4DA 5H1UA 3ZNIA 3GV4A 5LCWB 4F52B 3QZVA 5KH3A 4R8PK 1Z60A 2YT5A 2M85A 3O7AA 2YYRA 3ZVZB 2KIZA 2LXPC 3I2DA 2F42A 4AYCA 3RPGB 3N9PA 2BAYA 3LRQA 3SOXA 2CT2A 4V3KC 4WA6A 3PUQA 4WZ0A 4QF2A 3KV5A 4WZ2A 4UI9B 1Z2QA 3ASLA 4LLBA 2KYUA 3M63A 4CCGX 5H1TA 3T7LA 1DVPA 4L7XA 2KR4A 3NG2A 5FEYA 2KREA 1MM3A 3C5KA 3RPGC 4GNEA 4YADA 5TDWA 4A49A 2ECJA 2KWKA 4TKPB 3HCTA 3RTRB 2FSAA 4GNDA 4R7EA 5KH9A 2M1RA 5DINA 4I7CA 2MUMA 2G43A 2ZETC 5FERA 2CSYA 3DQVR 2LDRA 4ZQLA 3SOWA 2VPGA 3HCUA 4GNFA 4YABA 2MIQA 1WE9A 5B76A 3U5PA 2EA6A 2KE1A 2ECNA 4LK9A 2CSZA 5B75A 4LJNA 4AVXA 4X3GA 4Q6FA 1X4JA 4I7DA 2K16A 4V3LC 1JM7B 3LQHA 1BORA 3O36A 1RMDA 1WEMA 4YBTA 2UZGA 2YURA 5G0FA 4ZUXU 4C9ZA 2K1JA 4AYCB 4MVTA 1JOCA 2YW8A 3L1XA 2MNZA 5TBNA 3VK6A 2RI7A 1HYJA 1HYIA 2KFTA 3KQIA 4YBSA 4MSXA 4FO9A 2L0BA 2I50A 3O35A 3LQJA 3O70A 2VJEA 4O64A 2MD7B 5I3LA 2ECIA 4AP4A 1WEPA 4YC9A 1WILA 4FIPA 1WEQA 4YAXA 3M99A 2EGPA 2VJFB 2LQ6A 2JMJA 2M3HA 2LGGA 3PURA 5J3XA 1CHCA 3V43A 2JMIA 3N9NA 3M62A 4BBQA 1WEOA 1T1HA 2OXQC 5LKUA 5B78A 2C2LA 2KWOA 2VPDA 2L5UA 1WEUA 4R2YA 3HTKC 4UP0A 2L75A 1N87A 2HYED 5D1LB 1WIMA 4YBMA 2LGVA 5KH7A 2MD8C 1VFYA 2VNFA 1WGMA 3O34A 5LKXA 5G05B 5FB1A 2ECTA 2IDAA 4P5OB 3LQIA 1LDJB 2EODA 2YHNA 1MM2A 2KGGA 5B79A 3EB5A 4N3WA 2VP7A 5FB0A 2FUUA 2KWNA 4A0CD 2G6QA 4B86C 5AIUA 2YQMA 1WFKA 4S3OB 2LN0A 3MHSA 2YU4A 2CKLA 1VYXA 1WESA 2H0DB 2ECVA 1Z6UA 2YUCA 2RSDA 3GL6A 5TDRA 4PPEA 2DX8A 2Y1NA 4B7YC 1WEWA 3T6RA 2Y1MA 3DPLR 3ZPV1 2E6SA 2F6JA 2E6RA 3N9MA 1ZBDB 1F62A 4YATA 5JG6A 2MA5A 3PHDA 3ZPVE 5B8DA
chains in the Genus database with same CATH superfamily
2VJEB 5SVIB 5B77A 1FP0A 4NN2A 1DCQA 3N9OA 1MBMA 3ZVYA 2YQLA 2B0OE 2CRWA 4FJCA 3ZYQA 1JM7A 4OGCA 3IHPA 1G25A 2YVRA 5AITA 3MDBC 1LDKC 4S3OC 3O33A 2QJ0A 2JMDA 3N9QA 2L80A 3U5OA 4IC2A 3SOUA 4BHWA 5EYAF 2G45A 5LKTA 2CSVA 5LKZA 2LGKA 5D1KB 3U5NA 4N4FA 4QF3A 2MA6A 2QIZA 2FUIA 1V87A 2XB1A 2M6MA 2LRIC 2VPEA 4QQ4A 3SUBA 4GB0A 2OWAA 1XWHA 1VD4A 2LGLA 2ECGA 1IYMA 3EB6A 2KGIA 2PUYA 3KNVA 3LVRE 4I7BA 2L43A 2AN6A 4IC3A 1U6GB 4LKAA 2EGMA 3N9LA 2Y43A 1E4UA 2VJFA 4XI1A 3C6WA 4UP5A 1WENA 3KV6A 2PNXA 2K17A 3Q1DA 3ZTGA 4PTBA 2JRJA 1WEVA 1WEEA 2IQJA 3M7KA 3SHBA 4FK5A 5G04B 2D8SA 3KDEC 2C2VS 2XEUA 2MT5A 2CKLB 5TRBA 2F6NA 2LV9A 3L1ZB 1X4UA 3O37A 4WZ3B 5D1MB 2YSMA 4W4UA 2VPBA 2KU3A 1X4IA 5C13A 5C11A 3FL2A 5DKAA 2MNYA 3U5MA 2LXHC 3FAOA 4LADB 4AUQB 1FBVA 2RR4A 4A4CA 4ZDTA 2YSJA 5H1VA 2EXUA 3L11A 2YHOA 3O47A 1K2FA 4L58A 2ECWA 3MHHA 2KWJA 5H9MA 2YREA 4GNGA 4A4BA 2NAAA 4CA1A 2HDPA 3HCSA 2QICA 5TABA 2H0DA 2K4DA 5H1UA 3ZNIA 3GV4A 5LCWB 4F52B 3QZVA 5KH3A 4R8PK 1Z60A 2YT5A 2M85A 3O7AA 2XOZA 2YYRA 3ZVZB 2KIZA 2LXPC 3I2DA 2F42A 4AYCA 3RPGB 2CONA 2P57A 3N9PA 2BAYA 3LRQA 3SOXA 2CT2A 4V3KC 4WA6A 5SVIA 3PUQA 4WZ0A 4QF2A 3KV5A 2MKEA 5K3QA 4WZ2A 4UI9B 1Z2QA 3ASLA 4LLBA 5SVXA 2KYUA 3M63A 4CCGX 3FEHA 5H1TA 3T7LA 1DVPA 4L7XA 4OGEA 2KR4A 3NG2A 5FEYA 3LJUX 2KREA 1MM3A 3C5KA 4GNEA 3RPGC 4YADA 5TDWA 4A49A 2ECJA 2KWKA 4TKPB 3HCTA 3RTRB 2FSAA 4GNDA 4R7EA 5KH9A 2M1RA 5DINA 3T9KA 4I7CA 2MUMA 2G43A 2ZETC 5FERA 2CSYA 3DQVR 2LDRA 4ZQLA 2M13A 3SOWA 2VPGA 3HCUA 3E2DA 4GNFA 4YABA 2MIQA 1WE9A 5B76A 3U5PA 2EA6A 5SVYA 2FFWA 4H9DA 2KE1A 2ECNA 4LK9A 2CSZA 5B75A 3FANA 4LJNA 4AVXA 4X3GA 4Q6FA 2L7PA 1X4JA 4I7DA 2K16A 2XOYA 4V3LC 2DSMA 1JM7B 3LQHA 1BORA 4Z0RA 3O36A 1RMDA 1WEMA 4YBTA 2JM3A 2UZGA 2YURA 5G0FA 4ZUXU 3DDTA 4C9ZA 2K1JA 4AYCB 4MVTA 1JOCA 2YW8A 3L1XA 2MNZA 5TBNA 3VK6A 3H7HA 2RI7A 1HYJA 1HYIA 2KFTA 3KQIA 4Z0OA 4YBSA 4MSXA 4FO9A 2L0BA 2I50A 3O35A 3LQJA 3O70A 2VJEA 4O64A 2MD7B 5I3LA 2ECIA 4AP4A 2CRRA 1WEPA 4YC9A 1WILA 4FIPA 1WEQA 4YAXA 3M99A 2EGPA 4F1PA 3LDYA 2VJFB 2LQ6A 2JMJA 2XOCA 2M3HA 2LGGA 3PURA 5J3XA 1CHCA 2XP0A 3FJUB 3V43A 2JMIA 3DWDA 3N9NA 3M62A 4O62A 4BBQA 1WEOA 1T1HA 2OXQC 5LKUA 5B78A 2C2LA 2KWOA 2VPDA 2L5UA 1WEUA 4R2YA 3HTKC 4UP0A 2L75A 1N87A 2HYED 5D1LB 3JUEA 2KKYA 1WIMA 2FD4A 4YBMA 2LGVA 5KH7A 2MD8C 1VFYA 2VNFA 1WGMA 3O34A 5LKXA 5G05B 5FB1A 2ECTA 2IDAA 4P5OB 3LQIA 3LVQE 2D8UA 1LDJB 3FM8C 2EODA 2YHNA 1MM2A 2KGGA 5B79A 3EB5A 4N3WA 2KKXA 2VP7A 5FB0A 2FUUA 2KWNA 2LAUA 4A0CD 2G6QA 4B86C 5AIUA 2YQMA 2DJAA 1WFKA 2JUNA 4S3OB 2LN0A 3MHSA 2YU4A 2CKLA 1VYXA 1WESA 2H0DB 2ECVA 1Z6UA 2YUCA 2RSDA 3GL6A 5TDRA 4PPEA 2DX8A 2Y1NA 4B7YC 1WEWA 3T6RA 3PLWA 2Y1MA 3DPLR 3ZPV1 2E6SA 2F6JA 2E6RA 3N9MA 1ZBDB 1F62A 4YATA 5JG6A 2MA5A 3PHDA 2E61A 3ZPVE 5B8DA
chains in the Genus database with same CATH topology
2VJEB 5B77A 1FP0A 4NN2A 3N9OA 3ZVYA 2YQLA 4FJCA 3ZYQA 1JM7A 3IHPA 1G25A 5AITA 1LDKC 4S3OC 3O33A 2QJ0A 2JMDA 3N9QA 2L80A 3U5OA 4IC2A 3SOUA 4BHWA 5EYAF 2G45A 5LKTA 5LKZA 2LGKA 5D1KB 3U5NA 4N4FA 4QF3A 2MA6A 2QIZA 2FUIA 1V87A 2XB1A 2M6MA 2LRIC 2VPEA 4GB0A 1XWHA 1VD4A 2LGLA 2ECGA 1IYMA 3EB6A 2KGIA 2PUYA 3KNVA 4I7BA 2L43A 2AN6A 4IC3A 1U6GB 4LKAA 3N9LA 2Y43A 1E4UA 2VJFA 4XI1A 3C6WA 4UP5A 1WENA 3KV6A 2PNXA 2K17A 3ZTGA 4PTBA 2JRJA 1WEVA 1WEEA 3SHBA 4FK5A 5G04B 2D8SA 2C2VS 2XEUA 2MT5A 2CKLB 5TRBA 2F6NA 2LV9A 3L1ZB 1X4UA 3O37A 4WZ3B 5D1MB 2YSMA 4W4UA 2VPBA 2KU3A 1X4IA 5C13A 5C11A 3FL2A 5DKAA 2MNYA 3U5MA 2LXHC 4LADB 4AUQB 1FBVA 4A4CA 4ZDTA 2YSJA 5H1VA 3L11A 2YHOA 1K2FA 4L58A 2ECWA 3MHHA 2KWJA 5H9MA 2YREA 4GNGA 4A4BA 2NAAA 4CA1A 2HDPA 3HCSA 2QICA 5TABA 2H0DA 2K4DA 5H1UA 3ZNIA 3GV4A 5LCWB 4F52B 3QZVA 5KH3A 4R8PK 1Z60A 2YT5A 2M85A 3O7AA 2YYRA 3ZVZB 2KIZA 2LXPC 3I2DA 2F42A 4AYCA 3RPGB 3N9PA 2BAYA 3LRQA 3SOXA 2CT2A 4V3KC 4WA6A 3PUQA 4WZ0A 4QF2A 3KV5A 4WZ2A 4UI9B 1Z2QA 3ASLA 4LLBA 2KYUA 3M63A 4CCGX 5H1TA 3T7LA 1DVPA 4L7XA 2KR4A 3NG2A 5FEYA 2KREA 1MM3A 3C5KA 3RPGC 4GNEA 4YADA 5TDWA 4A49A 2ECJA 2KWKA 4TKPB 3HCTA 3RTRB 2FSAA 4GNDA 4R7EA 5KH9A 2M1RA 5DINA 4I7CA 2MUMA 2G43A 2ZETC 5FERA 2CSYA 3DQVR 2LDRA 4ZQLA 3SOWA 2VPGA 3HCUA 4GNFA 4YABA 2MIQA 1WE9A 5B76A 3U5PA 2EA6A 2KE1A 2ECNA 4LK9A 2CSZA 5B75A 4LJNA 4AVXA 4X3GA 4Q6FA 1X4JA 4I7DA 2K16A 4V3LC 1JM7B 3LQHA 1BORA 3O36A 1RMDA 1WEMA 4YBTA 2UZGA 2YURA 5G0FA 4ZUXU 4C9ZA 2K1JA 4AYCB 4MVTA 1JOCA 2YW8A 3L1XA 2MNZA 5TBNA 3VK6A 2RI7A 1HYJA 1HYIA 2KFTA 3KQIA 4YBSA 4MSXA 4FO9A 2L0BA 2I50A 3O35A 3LQJA 3O70A 2VJEA 4O64A 2MD7B 5I3LA 2ECIA 4AP4A 1WEPA 4YC9A 1WILA 4FIPA 1WEQA 4YAXA 3M99A 2EGPA 2VJFB 2LQ6A 2JMJA 2M3HA 2LGGA 3PURA 5J3XA 1CHCA 3V43A 2JMIA 3N9NA 3M62A 4BBQA 1WEOA 1T1HA 2OXQC 5LKUA 5B78A 2C2LA 2KWOA 2VPDA 2L5UA 1WEUA 4R2YA 3HTKC 4UP0A 2L75A 1N87A 2HYED 5D1LB 1WIMA 4YBMA 2LGVA 5KH7A 2MD8C 1VFYA 2VNFA 1WGMA 3O34A 5LKXA 5G05B 5FB1A 2ECTA 2IDAA 4P5OB 3LQIA 1LDJB 2EODA 2YHNA 1MM2A 2KGGA 5B79A 3EB5A 4N3WA 2VP7A 5FB0A 2FUUA 2KWNA 4A0CD 2G6QA 4B86C 5AIUA 2YQMA 1WFKA 4S3OB 2LN0A 3MHSA 2YU4A 2CKLA 1VYXA 1WESA 2H0DB 2ECVA 1Z6UA 2YUCA 2RSDA 3GL6A 5TDRA 4PPEA 2DX8A 2Y1NA 4B7YC 1WEWA 3T6RA 2Y1MA 3DPLR 3ZPV1 2E6SA 2F6JA 2E6RA 3N9MA 1ZBDB 1F62A 4YATA 5JG6A 2MA5A 3PHDA 3ZPVE 5B8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE B;  5B77 A;  1FP0 A;  4NN2 A;  3N9O A;  3ZVY A;  2YQL A;  4FJC A;  3ZYQ A;  1JM7 A;  3IHP A;  1G25 A;  5AIT A;  1LDK C;  4S3O C;  3O33 A;  2QJ0 A;  2JMD A;  3N9Q A;  2L80 A;  3U5O A;  4IC2 A;  3SOU A;  4BHW A;  5EYA F;  2G45 A;  5LKT A;  5LKZ A;  2LGK A;  5D1K B;  3U5N A;  4N4F A;  4QF3 A;  2MA6 A;  2QIZ A;  2FUI A;  1V87 A;  2XB1 A;  2M6M A;  2LRI C;  2VPE A;  4GB0 A;  1XWH A;  1VD4 A;  2LGL A;  2ECG A;  1IYM A;  3EB6 A;  2KGI A;  2PUY A;  3KNV A;  4I7B A;  2L43 A;  2AN6 A;  4IC3 A;  1U6G B;  4LKA A;  3N9L A;  2Y43 A;  1E4U A;  2VJF A;  4XI1 A;  3C6W A;  4UP5 A;  1WEN A;  3KV6 A;  2PNX A;  2K17 A;  3ZTG A;  4PTB A;  2JRJ A;  1WEV A;  1WEE A;  3SHB A;  4FK5 A;  5G04 B;  2D8S A;  2C2V S;  2XEU A;  2MT5 A;  2CKL B;  5TRB A;  2F6N A;  2LV9 A;  3L1Z B;  1X4U A;  3O37 A;  4WZ3 B;  5D1M B;  2YSM A;  4W4U A;  2VPB A;  2KU3 A;  1X4I A;  5C13 A;  5C11 A;  3FL2 A;  5DKA A;  2MNY A;  3U5M A;  2LXH C;  4LAD B;  4AUQ B;  1FBV A;  4A4C A;  4ZDT A;  2YSJ A;  5H1V A;  3L11 A;  2YHO A;  1K2F A;  4L58 A;  2ECW A;  3MHH A;  2KWJ A;  5H9M A;  2YRE A;  4GNG A;  4A4B A;  2NAA A;  4CA1 A;  2HDP A;  3HCS A;  2QIC A;  5TAB A;  2H0D A;  2K4D A;  5H1U A;  3ZNI A;  3GV4 A;  5LCW B;  4F52 B;  3QZV A;  5KH3 A;  4R8P K;  1Z60 A;  2YT5 A;  2M85 A;  3O7A A;  2YYR A;  3ZVZ B;  2KIZ A;  2LXP C;  3I2D A;  2F42 A;  4AYC A;  3RPG B;  3N9P A;  2BAY A;  3LRQ A;  3SOX A;  2CT2 A;  4V3K C;  4WA6 A;  3PUQ A;  4WZ0 A;  4QF2 A;  3KV5 A;  4WZ2 A;  4UI9 B;  1Z2Q A;  3ASL A;  4LLB A;  2KYU A;  3M63 A;  4CCG X;  5H1T A;  3T7L A;  1DVP A;  4L7X A;  2KR4 A;  3NG2 A;  5FEY A;  2KRE A;  1MM3 A;  3C5K A;  3RPG C;  4GNE A;  4YAD A;  5TDW A;  4A49 A;  2ECJ A;  2KWK A;  4TKP B;  3HCT A;  3RTR B;  2FSA A;  4GND A;  4R7E A;  5KH9 A;  2M1R A;  5DIN A;  4I7C A;  2MUM A;  2G43 A;  2ZET C;  5FER A;  2CSY A;  3DQV R;  2LDR A;  4ZQL A;  3SOW A;  2VPG A;  3HCU A;  4GNF A;  4YAB A;  2MIQ A;  1WE9 A;  5B76 A;  3U5P A;  2EA6 A;  2KE1 A;  2ECN A;  4LK9 A;  2CSZ A;  5B75 A;  4LJN A;  4AVX A;  4X3G A;  4Q6F A;  1X4J A;  4I7D A;  2K16 A;  4V3L C;  1JM7 B;  3LQH A;  1BOR A;  3O36 A;  1RMD A;  1WEM A;  4YBT A;  2UZG A;  2YUR A;  5G0F A;  4ZUX U;  4C9Z A;  2K1J A;  4AYC B;  4MVT A;  1JOC A;  2YW8 A;  3L1X A;  2MNZ A;  5TBN A;  3VK6 A;  2RI7 A;  1HYJ A;  1HYI A;  2KFT A;  3KQI A;  4YBS A;  4MSX A;  4FO9 A;  2L0B A;  2I50 A;  3O35 A;  3LQJ A;  3O70 A;  2VJE A;  4O64 A;  2MD7 B;  5I3L A;  2ECI A;  4AP4 A;  1WEP A;  4YC9 A;  1WIL A;  4FIP A;  1WEQ A;  4YAX A;  3M99 A;  2EGP A;  2VJF B;  2LQ6 A;  2JMJ A;  2M3H A;  2LGG A;  3PUR A;  5J3X A;  1CHC A;  3V43 A;  2JMI A;  3N9N A;  3M62 A;  4BBQ A;  1WEO A;  1T1H A;  2OXQ C;  5LKU A;  5B78 A;  2C2L A;  2KWO A;  2VPD A;  2L5U A;  1WEU A;  4R2Y A;  3HTK C;  4UP0 A;  2L75 A;  1N87 A;  2HYE D;  5D1L B;  1WIM A;  4YBM A;  2LGV A;  5KH7 A;  2MD8 C;  1VFY A;  2VNF A;  1WGM A;  3O34 A;  5LKX A;  5G05 B;  5FB1 A;  2ECT A;  2IDA A;  4P5O B;  3LQI A;  1LDJ B;  2EOD A;  2YHN A;  1MM2 A;  2KGG A;  5B79 A;  3EB5 A;  4N3W A;  2VP7 A;  5FB0 A;  2FUU A;  2KWN A;  4A0C D;  2G6Q A;  4B86 C;  5AIU A;  2YQM A;  1WFK A;  4S3O B;  2LN0 A;  3MHS A;  2YU4 A;  2CKL A;  1VYX A;  1WES A;  2H0D B;  2ECV A;  1Z6U A;  2YUC A;  2RSD A;  3GL6 A;  5TDR A;  4PPE A;  2DX8 A;  2Y1N A;  4B7Y C;  1WEW A;  3T6R A;  2Y1M A;  3DPL R;  3ZPV 1;  2E6S A;  2F6J A;  2E6R A;  3N9M A;  1ZBD B;  1F62 A;  4YAT A;  5JG6 A;  2MA5 A;  3PHD A;  3ZPV E;  5B8D A; 
#chains in the Genus database with same CATH topology
 2VJE B;  5SVI B;  5B77 A;  1FP0 A;  4NN2 A;  1DCQ A;  3N9O A;  1MBM A;  3ZVY A;  2YQL A;  2B0O E;  2CRW A;  4FJC A;  3ZYQ A;  1JM7 A;  4OGC A;  3IHP A;  1G25 A;  2YVR A;  5AIT A;  3MDB C;  1LDK C;  4S3O C;  3O33 A;  2QJ0 A;  2JMD A;  3N9Q A;  2L80 A;  3U5O A;  4IC2 A;  3SOU A;  4BHW A;  5EYA F;  2G45 A;  5LKT A;  2CSV A;  5LKZ A;  2LGK A;  5D1K B;  3U5N A;  4N4F A;  4QF3 A;  2MA6 A;  2QIZ A;  2FUI A;  1V87 A;  2XB1 A;  2M6M A;  2LRI C;  2VPE A;  4QQ4 A;  3SUB A;  4GB0 A;  2OWA A;  1XWH A;  1VD4 A;  2LGL A;  2ECG A;  1IYM A;  3EB6 A;  2KGI A;  2PUY A;  3KNV A;  3LVR E;  4I7B A;  2L43 A;  2AN6 A;  4IC3 A;  1U6G B;  4LKA A;  2EGM A;  3N9L A;  2Y43 A;  1E4U A;  2VJF A;  4XI1 A;  3C6W A;  4UP5 A;  1WEN A;  3KV6 A;  2PNX A;  2K17 A;  3Q1D A;  3ZTG A;  4PTB A;  2JRJ A;  1WEV A;  1WEE A;  2IQJ A;  3M7K A;  3SHB A;  4FK5 A;  5G04 B;  2D8S A;  3KDE C;  2C2V S;  2XEU A;  2MT5 A;  2CKL B;  5TRB A;  2F6N A;  2LV9 A;  3L1Z B;  1X4U A;  3O37 A;  4WZ3 B;  5D1M B;  2YSM A;  4W4U A;  2VPB A;  2KU3 A;  1X4I A;  5C13 A;  5C11 A;  3FL2 A;  5DKA A;  2MNY A;  3U5M A;  2LXH C;  3FAO A;  4LAD B;  4AUQ B;  1FBV A;  2RR4 A;  4A4C A;  4ZDT A;  2YSJ A;  5H1V A;  2EXU A;  3L11 A;  2YHO A;  3O47 A;  1K2F A;  4L58 A;  2ECW A;  3MHH A;  2KWJ A;  5H9M A;  2YRE A;  4GNG A;  4A4B A;  2NAA A;  4CA1 A;  2HDP A;  3HCS A;  2QIC A;  5TAB A;  2H0D A;  2K4D A;  5H1U A;  3ZNI A;  3GV4 A;  5LCW B;  4F52 B;  3QZV A;  5KH3 A;  4R8P K;  1Z60 A;  2YT5 A;  2M85 A;  3O7A A;  2XOZ A;  2YYR A;  3ZVZ B;  2KIZ A;  2LXP C;  3I2D A;  2F42 A;  4AYC A;  3RPG B;  2CON A;  2P57 A;  3N9P A;  2BAY A;  3LRQ A;  3SOX A;  2CT2 A;  4V3K C;  4WA6 A;  5SVI A;  3PUQ A;  4WZ0 A;  4QF2 A;  3KV5 A;  2MKE A;  5K3Q A;  4WZ2 A;  4UI9 B;  1Z2Q A;  3ASL A;  4LLB A;  5SVX A;  2KYU A;  3M63 A;  4CCG X;  3FEH A;  5H1T A;  3T7L A;  1DVP A;  4L7X A;  4OGE A;  2KR4 A;  3NG2 A;  5FEY A;  3LJU X;  2KRE A;  1MM3 A;  3C5K A;  4GNE A;  3RPG C;  4YAD A;  5TDW A;  4A49 A;  2ECJ A;  2KWK A;  4TKP B;  3HCT A;  3RTR B;  2FSA A;  4GND A;  4R7E A;  5KH9 A;  2M1R A;  5DIN A;  3T9K A;  4I7C A;  2MUM A;  2G43 A;  2ZET C;  5FER A;  2CSY A;  3DQV R;  2LDR A;  4ZQL A;  2M13 A;  3SOW A;  2VPG A;  3HCU A;  3E2D A;  4GNF A;  4YAB A;  2MIQ A;  1WE9 A;  5B76 A;  3U5P A;  2EA6 A;  5SVY A;  2FFW A;  4H9D A;  2KE1 A;  2ECN A;  4LK9 A;  2CSZ A;  5B75 A;  3FAN A;  4LJN A;  4AVX A;  4X3G A;  4Q6F A;  2L7P A;  1X4J A;  4I7D A;  2K16 A;  2XOY A;  4V3L C;  2DSM A;  1JM7 B;  3LQH A;  1BOR A;  4Z0R A;  3O36 A;  1RMD A;  1WEM A;  4YBT A;  2JM3 A;  2UZG A;  2YUR A;  5G0F A;  4ZUX U;  3DDT A;  4C9Z A;  2K1J A;  4AYC B;  4MVT A;  1JOC A;  2YW8 A;  3L1X A;  2MNZ A;  5TBN A;  3VK6 A;  3H7H A;  2RI7 A;  1HYJ A;  1HYI A;  2KFT A;  3KQI A;  4Z0O A;  4YBS A;  4MSX A;  4FO9 A;  2L0B A;  2I50 A;  3O35 A;  3LQJ A;  3O70 A;  2VJE A;  4O64 A;  2MD7 B;  5I3L A;  2ECI A;  4AP4 A;  2CRR A;  1WEP A;  4YC9 A;  1WIL A;  4FIP A;  1WEQ A;  4YAX A;  3M99 A;  2EGP A;  4F1P A;  3LDY A;  2VJF B;  2LQ6 A;  2JMJ A;  2XOC A;  2M3H A;  2LGG A;  3PUR A;  5J3X A;  1CHC A;  2XP0 A;  3FJU B;  3V43 A;  2JMI A;  3DWD A;  3N9N A;  3M62 A;  4O62 A;  4BBQ A;  1WEO A;  1T1H A;  2OXQ C;  5LKU A;  5B78 A;  2C2L A;  2KWO A;  2VPD A;  2L5U A;  1WEU A;  4R2Y A;  3HTK C;  4UP0 A;  2L75 A;  1N87 A;  2HYE D;  5D1L B;  3JUE A;  2KKY A;  1WIM A;  2FD4 A;  4YBM A;  2LGV A;  5KH7 A;  2MD8 C;  1VFY A;  2VNF A;  1WGM A;  3O34 A;  5LKX A;  5G05 B;  5FB1 A;  2ECT A;  2IDA A;  4P5O B;  3LQI A;  3LVQ E;  2D8U A;  1LDJ B;  3FM8 C;  2EOD A;  2YHN A;  1MM2 A;  2KGG A;  5B79 A;  3EB5 A;  4N3W A;  2KKX A;  2VP7 A;  5FB0 A;  2FUU A;  2KWN A;  2LAU A;  4A0C D;  2G6Q A;  4B86 C;  5AIU A;  2YQM A;  2DJA A;  1WFK A;  2JUN A;  4S3O B;  2LN0 A;  3MHS A;  2YU4 A;  2CKL A;  1VYX A;  1WES A;  2H0D B;  2ECV A;  1Z6U A;  2YUC A;  2RSD A;  3GL6 A;  5TDR A;  4PPE A;  2DX8 A;  2Y1N A;  4B7Y C;  1WEW A;  3T6R A;  3PLW A;  2Y1M A;  3DPL R;  3ZPV 1;  2E6S A;  2F6J A;  2E6R A;  3N9M A;  1ZBD B;  1F62 A;  4YAT A;  5JG6 A;  2MA5 A;  3PHD A;  2E61 A;  3ZPV E;  5B8D A; 
#chains in the Genus database with same CATH homology
 2VJE B;  5B77 A;  1FP0 A;  4NN2 A;  3N9O A;  3ZVY A;  2YQL A;  4FJC A;  3ZYQ A;  1JM7 A;  3IHP A;  1G25 A;  5AIT A;  1LDK C;  4S3O C;  3O33 A;  2QJ0 A;  2JMD A;  3N9Q A;  2L80 A;  3U5O A;  4IC2 A;  3SOU A;  4BHW A;  5EYA F;  2G45 A;  5LKT A;  5LKZ A;  2LGK A;  5D1K B;  3U5N A;  4N4F A;  4QF3 A;  2MA6 A;  2QIZ A;  2FUI A;  1V87 A;  2XB1 A;  2M6M A;  2LRI C;  2VPE A;  4GB0 A;  1XWH A;  1VD4 A;  2LGL A;  2ECG A;  1IYM A;  3EB6 A;  2KGI A;  2PUY A;  3KNV A;  4I7B A;  2L43 A;  2AN6 A;  4IC3 A;  1U6G B;  4LKA A;  3N9L A;  2Y43 A;  1E4U A;  2VJF A;  4XI1 A;  3C6W A;  4UP5 A;  1WEN A;  3KV6 A;  2PNX A;  2K17 A;  3ZTG A;  4PTB A;  2JRJ A;  1WEV A;  1WEE A;  3SHB A;  4FK5 A;  5G04 B;  2D8S A;  2C2V S;  2XEU A;  2MT5 A;  2CKL B;  5TRB A;  2F6N A;  2LV9 A;  3L1Z B;  1X4U A;  3O37 A;  4WZ3 B;  5D1M B;  2YSM A;  4W4U A;  2VPB A;  2KU3 A;  1X4I A;  5C13 A;  5C11 A;  3FL2 A;  5DKA A;  2MNY A;  3U5M A;  2LXH C;  4LAD B;  4AUQ B;  1FBV A;  4A4C A;  4ZDT A;  2YSJ A;  5H1V A;  3L11 A;  2YHO A;  1K2F A;  4L58 A;  2ECW A;  3MHH A;  2KWJ A;  5H9M A;  2YRE A;  4GNG A;  4A4B A;  2NAA A;  4CA1 A;  2HDP A;  3HCS A;  2QIC A;  5TAB A;  2H0D A;  2K4D A;  5H1U A;  3ZNI A;  3GV4 A;  5LCW B;  4F52 B;  3QZV A;  5KH3 A;  4R8P K;  1Z60 A;  2YT5 A;  2M85 A;  3O7A A;  2YYR A;  3ZVZ B;  2KIZ A;  2LXP C;  3I2D A;  2F42 A;  4AYC A;  3RPG B;  3N9P A;  2BAY A;  3LRQ A;  3SOX A;  2CT2 A;  4V3K C;  4WA6 A;  3PUQ A;  4WZ0 A;  4QF2 A;  3KV5 A;  4WZ2 A;  4UI9 B;  1Z2Q A;  3ASL A;  4LLB A;  2KYU A;  3M63 A;  4CCG X;  5H1T A;  3T7L A;  1DVP A;  4L7X A;  2KR4 A;  3NG2 A;  5FEY A;  2KRE A;  1MM3 A;  3C5K A;  3RPG C;  4GNE A;  4YAD A;  5TDW A;  4A49 A;  2ECJ A;  2KWK A;  4TKP B;  3HCT A;  3RTR B;  2FSA A;  4GND A;  4R7E A;  5KH9 A;  2M1R A;  5DIN A;  4I7C A;  2MUM A;  2G43 A;  2ZET C;  5FER A;  2CSY A;  3DQV R;  2LDR A;  4ZQL A;  3SOW A;  2VPG A;  3HCU A;  4GNF A;  4YAB A;  2MIQ A;  1WE9 A;  5B76 A;  3U5P A;  2EA6 A;  2KE1 A;  2ECN A;  4LK9 A;  2CSZ A;  5B75 A;  4LJN A;  4AVX A;  4X3G A;  4Q6F A;  1X4J A;  4I7D A;  2K16 A;  4V3L C;  1JM7 B;  3LQH A;  1BOR A;  3O36 A;  1RMD A;  1WEM A;  4YBT A;  2UZG A;  2YUR A;  5G0F A;  4ZUX U;  4C9Z A;  2K1J A;  4AYC B;  4MVT A;  1JOC A;  2YW8 A;  3L1X A;  2MNZ A;  5TBN A;  3VK6 A;  2RI7 A;  1HYJ A;  1HYI A;  2KFT A;  3KQI A;  4YBS A;  4MSX A;  4FO9 A;  2L0B A;  2I50 A;  3O35 A;  3LQJ A;  3O70 A;  2VJE A;  4O64 A;  2MD7 B;  5I3L A;  2ECI A;  4AP4 A;  1WEP A;  4YC9 A;  1WIL A;  4FIP A;  1WEQ A;  4YAX A;  3M99 A;  2EGP A;  2VJF B;  2LQ6 A;  2JMJ A;  2M3H A;  2LGG A;  3PUR A;  5J3X A;  1CHC A;  3V43 A;  2JMI A;  3N9N A;  3M62 A;  4BBQ A;  1WEO A;  1T1H A;  2OXQ C;  5LKU A;  5B78 A;  2C2L A;  2KWO A;  2VPD A;  2L5U A;  1WEU A;  4R2Y A;  3HTK C;  4UP0 A;  2L75 A;  1N87 A;  2HYE D;  5D1L B;  1WIM A;  4YBM A;  2LGV A;  5KH7 A;  2MD8 C;  1VFY A;  2VNF A;  1WGM A;  3O34 A;  5LKX A;  5G05 B;  5FB1 A;  2ECT A;  2IDA A;  4P5O B;  3LQI A;  1LDJ B;  2EOD A;  2YHN A;  1MM2 A;  2KGG A;  5B79 A;  3EB5 A;  4N3W A;  2VP7 A;  5FB0 A;  2FUU A;  2KWN A;  4A0C D;  2G6Q A;  4B86 C;  5AIU A;  2YQM A;  1WFK A;  4S3O B;  2LN0 A;  3MHS A;  2YU4 A;  2CKL A;  1VYX A;  1WES A;  2H0D B;  2ECV A;  1Z6U A;  2YUC A;  2RSD A;  3GL6 A;  5TDR A;  4PPE A;  2DX8 A;  2Y1N A;  4B7Y C;  1WEW A;  3T6R A;  2Y1M A;  3DPL R;  3ZPV 1;  2E6S A;  2F6J A;  2E6R A;  3N9M A;  1ZBD B;  1F62 A;  4YAT A;  5JG6 A;  2MA5 A;  3PHD A;  3ZPV E;  5B8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...