2XP0A

C-terminal cysteine-rich domain of human chfr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
212
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
total genus 64
structure length 212
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xp0A01
2XP0A 2XOCA 2XOYA 2XOZA
chains in the Genus database with same CATH superfamily
5LKUA 3N9MA 2ECGA 4UP5A 2LXPC 2ZETC 2PNXA 5DKAA 5LKTA 1E4UA 1WGMA 2G6QA 3T6RA 4FO9A 2M1RA 3O70A 2YHNA 2EGMA 2XOCA 5TBNA 2K17A 4LKAA 4X3GA 2YSJA 1VFYA 2C2LA 5FB0A 2CKLB 4XI1A 1F62A 3FAOA 5H9MA 2KWNA 1LDKC 1FBVA 2YYRA 4L58A 3LQIA 4N4FA 3GL6A 4Q6FA 5B8DA 2VJFB 2K4DA 2JM3A 2JMJA 4CCGX 2YU4A 3M99A 5LKXA 5AITA 2M3HA 3O33A 5TABA 2K1JA 5KH9A 3PUQA 4A4CA 1DCQA 2YREA 3PLWA 4ZDTA 4ZQLA 5DINA 4AVXA 3M62A 5AIUA 4AYCA 4W4UA 2MUMA 4YBMA 1WEEA 2XB1A 4BHWA 3O35A 5B75A 2PUYA 2KFTA 4LJNA 3L1XA 2YQMA 5D1KB 4ZUXU 2LGLA 2VJEA 4FJCA 5FB1A 3MHHA 2VPEA 3C6WA 1WIMA 5FEYA 3FM8C 3LRQA 2NAAA 4IC2A 3SUBA 4NN2A 2MNYA 2LDRA 4WZ2A 2Y1NA 3U5OA 4BBQA 2LV9A 3E2DA 3L11A 5B78A 3M7KA 2YW8A 4WZ0A 2ECTA 4MSXA 4R7EA 1XWHA 4F52B 4A4BA 4YBSA 3LQHA 2VPBA 1U6GB 2C2VS 4A0CD 3U5PA 2VJEB 1WILA 5D1LB 2JMDA 3LDYA 5H1UA 2ECNA 2KE1A 2KGIA 3DWDA 3N9OA 3M63A 3KV6A 4A49A 2H0DB 3N9QA 2YVRA 2EXUA 4FK5A 2D8SA 2HYED 2JRJA 2LQ6A 2MKEA 1HYIA 2KIZA 1WEVA 4QQ4A 2B0OE 2RSDA 2FUIA 4N3WA 2OXQC 2YUCA 3HTKC 3RPGC 2LRIC 1FP0A 2VNFA 1WESA 2ECIA 4PPEA 3RTRB 3U5MA 2KU3A 3N9LA 4OGCA 5FERA 2QJ0A 4L7XA 2D8UA 3KV5A 4F1PA 3SOWA 3KDEC 3KNVA 2UZGA 4OGEA 5B79A 4R8PK 3JUEA 1T1HA 2E6RA 4IC3A 5C11A 3SOUA 2BAYA 2OWAA 4LK9A 2DJAA 3ZYQA 3ASLA 4B7YC 3HCUA 3VK6A 2ECJA 4I7BA 1JOCA 3DQVR 1WEPA 1WEQA 2XEUA 2FSAA 2M13A 2VJFA 4UP0A 3FL2A 4P5OB 3MDBC 2G45A 2ECWA 2JUNA 3L1ZB 3PURA 2RI7A 2VP7A 2KGGA 5SVYA 4YABA 3RPGB 1WEWA 3DDTA 2CSYA 5G0FA 2Y43A 2FFWA 2F42A 3GV4A 4O62A 5LKZA 2XOZA 3ZNIA 4O64A 2QICA 5SVIB 2LGGA 3HCTA 4GNFA 1WENA 3DPLR 4WA6A 4QF2A 2DX8A 2YQLA 5I3LA 2H0DA 1DVPA 2MIQA 5H1TA 3QZVA 1IYMA 4TKPB 3MHSA 4FIPA 5TRBA 3C5KA 3HCSA 3Q1DA 4MVTA 4C9ZA 2XP0A 2Y1MA 2F6NA 2M85A 5LCWB 3FJUB 3T7LA 3IHPA 4V3LC 3NG2A 1N87A 2MA6A 4I7DA 4YADA 2AN6A 4WZ3B 3ZTGA 3U5NA 2L43A 3EB6A 4B86C 3LVRE 1MM3A 3EB5A 5TDRA 4LADB 4YAXA 3N9NA 1Z60A 1MBMA 2KWKA 1V87A 1VYXA 1MM2A 2MNZA 4QF3A 2CONA 5C13A 2VPDA 3LJUX 4CA1A 2DSMA 1VD4A 1WEOA 2KREA 2JMIA 2MD8C 1X4IA 1G25A 3KQIA 4Z0OA 2YHOA 2LAUA 4GNDA 2LN0A 2E6SA 4GB0A 4S3OB 2MA5A 3T9KA 4GNGA 3ZVZB 3PHDA 2I50A 1RMDA 3LQJA 5D1MB 4H9DA 2K16A 1WEUA 1K2FA 1CHCA 2QIZA 4Z0RA 2ECVA 2L0BA 3SHBA 5SVXA 4S3OC 2KWOA 5J3XA 5TDWA 2LGVA 1WEMA 2CKLA 3O36A 1Z6UA 2YSMA 3N9PA 2FUUA 4AYCB 4UI9B 5H1VA 2CSVA 4AUQB 2IQJA 3O34A 2EODA 2E61A 2CT2A 4V3KC 2KR4A 5K3QA 2L7PA 2RR4A 3LVQE 4YC9A 2LXHC 3O37A 2YT5A 1X4JA 3ZPV1 2EGPA 3O7AA 5B77A 2MT5A 2VPGA 2YURA 2XOYA 1JM7A 1Z2QA 2KKXA 2L5UA 2HDPA 2KYUA 3I2DA 4LLBA 3FANA 5KH3A 4I7CA 2P57A 2CSZA 2KWJA 5JG6A 5EYAF 2CRWA 5G05B 4PTBA 2CRRA 5B76A 3ZVYA 3H7HA 2G43A 2M6MA 5SVIA 2LGKA 3SOXA 1WE9A 4YATA 4GNEA 2EA6A 1X4UA 2KKYA 1ZBDB 3FEHA 2IDAA 1JM7B 4R2YA 3O47A 1HYJA 2FD4A 2MD7B 1LDJB 1WFKA 3ZPVE 3V43A 2L75A 2L80A 2F6JA 5KH7A 4AP4A 1BORA 4YBTA 5G04B
chains in the Genus database with same CATH topology
1DCQA 2JUNA 2OWAA 2YREA 3FM8C 2CONA 4H9DA 3PLWA 5SVIB 2KKYA 2DJAA 3LJUX 3SUBA 3FEHA 5SVYA 4OGCA 2P57A 2CSVA 3LDYA 2IQJA 3DWDA 3O47A 4Z0RA 2FD4A 2D8UA 3E2DA 4F1PA 2YVRA 4Z0OA 3M7KA 5SVXA 3DDTA 2CRWA 2E61A 2EXUA 3LVRE 3MDBC 3KDEC 2LAUA 5K3QA 2XOYA 2FFWA 2CRRA 2JM3A 2L7PA 2MKEA 3Q1DA 4OGEA 3H7HA 2EGMA 2KKXA 2XOCA 2M13A 4O62A 2XOZA 3T9KA 2XP0A 5SVIA 3JUEA 4QQ4A 2B0OE 2RR4A 3FJUB 3LVQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP0 A;  2XOC A;  2XOY A;  2XOZ A; 
#chains in the Genus database with same CATH topology
 5LKU A;  3N9M A;  2ECG A;  4UP5 A;  2LXP C;  2ZET C;  2PNX A;  5DKA A;  5LKT A;  1E4U A;  1WGM A;  2G6Q A;  3T6R A;  4FO9 A;  2M1R A;  3O70 A;  2YHN A;  2EGM A;  2XOC A;  5TBN A;  2K17 A;  4LKA A;  4X3G A;  2YSJ A;  1VFY A;  2C2L A;  5FB0 A;  2CKL B;  4XI1 A;  1F62 A;  3FAO A;  5H9M A;  2KWN A;  1LDK C;  1FBV A;  2YYR A;  4L58 A;  3LQI A;  4N4F A;  3GL6 A;  4Q6F A;  5B8D A;  2VJF B;  2K4D A;  2JM3 A;  2JMJ A;  4CCG X;  2YU4 A;  3M99 A;  5LKX A;  5AIT A;  2M3H A;  3O33 A;  5TAB A;  2K1J A;  5KH9 A;  3PUQ A;  4A4C A;  1DCQ A;  2YRE A;  3PLW A;  4ZDT A;  4ZQL A;  5DIN A;  4AVX A;  3M62 A;  5AIU A;  4AYC A;  4W4U A;  2MUM A;  4YBM A;  1WEE A;  2XB1 A;  4BHW A;  3O35 A;  5B75 A;  2PUY A;  2KFT A;  4LJN A;  3L1X A;  2YQM A;  5D1K B;  4ZUX U;  2LGL A;  2VJE A;  4FJC A;  5FB1 A;  3MHH A;  2VPE A;  3C6W A;  1WIM A;  5FEY A;  3FM8 C;  3LRQ A;  2NAA A;  4IC2 A;  3SUB A;  4NN2 A;  2MNY A;  2LDR A;  4WZ2 A;  2Y1N A;  3U5O A;  4BBQ A;  2LV9 A;  3E2D A;  3L11 A;  5B78 A;  3M7K A;  2YW8 A;  4WZ0 A;  2ECT A;  4MSX A;  4R7E A;  1XWH A;  4F52 B;  4A4B A;  4YBS A;  3LQH A;  2VPB A;  1U6G B;  2C2V S;  4A0C D;  3U5P A;  2VJE B;  1WIL A;  5D1L B;  2JMD A;  3LDY A;  5H1U A;  2ECN A;  2KE1 A;  2KGI A;  3DWD A;  3N9O A;  3M63 A;  3KV6 A;  4A49 A;  2H0D B;  3N9Q A;  2YVR A;  2EXU A;  4FK5 A;  2D8S A;  2HYE D;  2JRJ A;  2LQ6 A;  2MKE A;  1HYI A;  2KIZ A;  1WEV A;  4QQ4 A;  2B0O E;  2RSD A;  2FUI A;  4N3W A;  2OXQ C;  2YUC A;  3HTK C;  3RPG C;  2LRI C;  1FP0 A;  2VNF A;  1WES A;  2ECI A;  4PPE A;  3RTR B;  3U5M A;  2KU3 A;  3N9L A;  4OGC A;  5FER A;  2QJ0 A;  4L7X A;  2D8U A;  3KV5 A;  4F1P A;  3SOW A;  3KDE C;  3KNV A;  2UZG A;  4OGE A;  5B79 A;  4R8P K;  3JUE A;  1T1H A;  2E6R A;  4IC3 A;  5C11 A;  3SOU A;  2BAY A;  2OWA A;  4LK9 A;  2DJA A;  3ZYQ A;  3ASL A;  4B7Y C;  3HCU A;  3VK6 A;  2ECJ A;  4I7B A;  1JOC A;  3DQV R;  1WEP A;  1WEQ A;  2XEU A;  2FSA A;  2M13 A;  2VJF A;  4UP0 A;  3FL2 A;  4P5O B;  3MDB C;  2G45 A;  2ECW A;  2JUN A;  3L1Z B;  3PUR A;  2RI7 A;  2VP7 A;  2KGG A;  5SVY A;  4YAB A;  3RPG B;  1WEW A;  3DDT A;  2CSY A;  5G0F A;  2Y43 A;  2FFW A;  2F42 A;  3GV4 A;  4O62 A;  5LKZ A;  2XOZ A;  3ZNI A;  4O64 A;  2QIC A;  5SVI B;  2LGG A;  3HCT A;  4GNF A;  1WEN A;  3DPL R;  4WA6 A;  4QF2 A;  2DX8 A;  2YQL A;  5I3L A;  2H0D A;  1DVP A;  2MIQ A;  5H1T A;  3QZV A;  1IYM A;  4TKP B;  3MHS A;  4FIP A;  5TRB A;  3C5K A;  3HCS A;  3Q1D A;  4MVT A;  4C9Z A;  2XP0 A;  2Y1M A;  2F6N A;  2M85 A;  5LCW B;  3FJU B;  3T7L A;  3IHP A;  4V3L C;  3NG2 A;  1N87 A;  2MA6 A;  4I7D A;  4YAD A;  2AN6 A;  4WZ3 B;  3ZTG A;  3U5N A;  2L43 A;  3EB6 A;  4B86 C;  3LVR E;  1MM3 A;  3EB5 A;  5TDR A;  4LAD B;  4YAX A;  3N9N A;  1Z60 A;  1MBM A;  2KWK A;  1V87 A;  1VYX A;  1MM2 A;  2MNZ A;  4QF3 A;  2CON A;  5C13 A;  2VPD A;  3LJU X;  4CA1 A;  2DSM A;  1VD4 A;  1WEO A;  2KRE A;  2JMI A;  2MD8 C;  1X4I A;  1G25 A;  3KQI A;  4Z0O A;  2YHO A;  2LAU A;  4GND A;  2LN0 A;  2E6S A;  4GB0 A;  4S3O B;  2MA5 A;  3T9K A;  4GNG A;  3ZVZ B;  3PHD A;  2I50 A;  1RMD A;  3LQJ A;  5D1M B;  4H9D A;  2K16 A;  1WEU A;  1K2F A;  1CHC A;  2QIZ A;  4Z0R A;  2ECV A;  2L0B A;  3SHB A;  5SVX A;  4S3O C;  2KWO A;  5J3X A;  5TDW A;  2LGV A;  1WEM A;  2CKL A;  3O36 A;  1Z6U A;  2YSM A;  3N9P A;  2FUU A;  4AYC B;  4UI9 B;  5H1V A;  2CSV A;  4AUQ B;  2IQJ A;  3O34 A;  2EOD A;  2E61 A;  2CT2 A;  4V3K C;  2KR4 A;  5K3Q A;  2L7P A;  2RR4 A;  3LVQ E;  4YC9 A;  2LXH C;  3O37 A;  2YT5 A;  1X4J A;  3ZPV 1;  2EGP A;  3O7A A;  5B77 A;  2MT5 A;  2VPG A;  2YUR A;  2XOY A;  1JM7 A;  1Z2Q A;  2KKX A;  2L5U A;  2HDP A;  2KYU A;  3I2D A;  4LLB A;  3FAN A;  5KH3 A;  4I7C A;  2P57 A;  2CSZ A;  2KWJ A;  5JG6 A;  5EYA F;  2CRW A;  5G05 B;  4PTB A;  2CRR A;  5B76 A;  3ZVY A;  3H7H A;  2G43 A;  2M6M A;  5SVI A;  2LGK A;  3SOX A;  1WE9 A;  4YAT A;  4GNE A;  2EA6 A;  1X4U A;  2KKY A;  1ZBD B;  3FEH A;  2IDA A;  1JM7 B;  4R2Y A;  3O47 A;  1HYJ A;  2FD4 A;  2MD7 B;  1LDJ B;  1WFK A;  3ZPV E;  3V43 A;  2L75 A;  2L80 A;  2F6J A;  5KH7 A;  4AP4 A;  1BOR A;  4YBT A;  5G04 B; 
#chains in the Genus database with same CATH homology
 1DCQ A;  2JUN A;  2OWA A;  2YRE A;  3FM8 C;  2CON A;  4H9D A;  3PLW A;  5SVI B;  2KKY A;  2DJA A;  3LJU X;  3SUB A;  3FEH A;  5SVY A;  4OGC A;  2P57 A;  2CSV A;  3LDY A;  2IQJ A;  3DWD A;  3O47 A;  4Z0R A;  2FD4 A;  2D8U A;  3E2D A;  4F1P A;  2YVR A;  4Z0O A;  3M7K A;  5SVX A;  3DDT A;  2CRW A;  2E61 A;  2EXU A;  3LVR E;  3MDB C;  3KDE C;  2LAU A;  5K3Q A;  2XOY A;  2FFW A;  2CRR A;  2JM3 A;  2L7P A;  2MKE A;  3Q1D A;  4OGE A;  3H7H A;  2EGM A;  2KKX A;  2XOC A;  2M13 A;  4O62 A;  2XOZ A;  3T9K A;  2XP0 A;  5SVI A;  3JUE A;  4QQ4 A;  2B0O E;  2RR4 A;  3FJU B;  3LVQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...