2XP0A

C-terminal cysteine-rich domain of human chfr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
212
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 64
structure length 212
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xp0A01
2XOYA 2XOZA 2XP0A 2XOCA
chains in the Genus database with same CATH superfamily
5J3XA 4B86C 2EA6A 4A0CD 1CHCA 2VPEA 4I7CA 4S3OB 2CKLB 3U5PA 2YVRA 1WEOA 2YU4A 2CONA 2FFWA 4F52B 2H0DA 2KE1A 5AIUA 2D8SA 1WEMA 4BHWA 4MSXA 4A4BA 2JRJA 3EB5A 1X4JA 4LKAA 4FK5A 3RPGC 2VJEA 2E6RA 2KWJA 5D1MB 3N9MA 2EODA 3SOUA 5FB0A 1MM2A 2MD8C 2QICA 2M13A 5C13A 2KKXA 4O64A 3ZPVE 2CSZA 3PUQA 2OXQC 3KQIA 2KWOA 4BBQA 3T6RA 5K3QA 5SVIB 3ZYQA 2FUUA 2LXPC 4L58A 2MNZA 3VK6A 4YBSA 1ZBDB 5TABA 2ECIA 5TDWA 1Z2QA 3SOWA 3O36A 3T9KA 4YAXA 1WILA 3C5KA 2NAAA 2XP0A 2ECJA 5C11A 4GNEA 1X4UA 3RPGB 5FERA 2K1JA 3ZTGA 4V3LC 4ZDTA 2DSMA 4R7EA 3GL6A 2KYUA 1LDKC 5I3LA 2KWNA 2RSDA 4MVTA 2E61A 2F42A 4Z0RA 2FUIA 5TBNA 5H1UA 2JM3A 1E4UA 1K2FA 1T1HA 2K16A 1DCQA 1WEEA 2DJAA 3O35A 2YUCA 3Q1DA 5KH9A 2YREA 3PHDA 3O33A 2CKLA 4V3KC 4GNDA 3ZVZB 4GNGA 3LQJA 5G05B 4AYCB 2L75A 1MBMA 2LAUA 2FD4A 2LV9A 4YBMA 2MA5A 4LLBA 2AN6A 4X3GA 5H9MA 1VFYA 2LDRA 5G04B 1WESA 3N9NA 5B79A 2KU3A 2YSMA 3DDTA 2EGMA 2M1RA 4YATA 4A4CA 3V43A 2XOZA 5B77A 4A49A 4B7YC 3LQHA 1F62A 4FIPA 1HYIA 1V87A 3DWDA 1WE9A 2VP7A 2YHNA 3O47A 1MM3A 1VYXA 4ZQLA 2MUMA 1WEWA 3U5OA 5SVIA 2QJ0A 3ZVYA 3EB6A 2YSJA 3SUBA 3C6WA 3KDEC 2DX8A 5D1KB 2CSVA 4TKPB 1G25A 2H0DB 2P57A 4R8PK 3LVRE 4F1PA 4LK9A 2QIZA 4R2YA 4QF2A 2FSAA 1Z6UA 2L80A 3N9OA 4O62A 1JM7A 1JOCA 4WZ3B 4UP0A 4AVXA 3LRQA 2VJFA 3SHBA 4FO9A 2CRWA 2VNFA 1U6GB 2F6NA 2Y43A 2LXHC 3FL2A 3LJUX 2LN0A 4WA6A 4YBTA 1HYJA 1X4IA 3FANA 2LGVA 3MHSA 2YQLA 2YQMA 5FEYA 2G45A 2HYED 3KV6A 3E2DA 2KFTA 4N4FA 1VD4A 2F6JA 5JG6A 5SVYA 2ECGA 2PNXA 2HDPA 3HCSA 2I50A 2ECVA 2C2VS 2E6SA 1XWHA 4OGEA 3ASLA 4L7XA 3M99A 2IDAA 2L0BA 2LRIC 3HCUA 3DPLR 3U5NA 4GB0A 4WZ0A 2C2LA 5B75A 3IHPA 2MIQA 3KNVA 2LQ6A 5H1TA 2KKYA 2KIZA 5B78A 2RI7A 5TDRA 3M63A 4UP5A 4QQ4A 3O7AA 5LKZA 5LKXA 2CSYA 1Z60A 1FBVA 3O34A 3FAOA 5DKAA 2XEUA 4IC2A 2VPDA 1IYMA 5AITA 2MA6A 4AP4A 2YW8A 4W4UA 2ECWA 4H9DA 4CCGX 4Q6FA 2OWAA 5G0FA 1DVPA 5B8DA 1WEQA 2EXUA 4LJNA 3H7HA 4PPEA 2KGGA 2LGLA 5SVXA 4ZUXU 3U5MA 3O37A 2KREA 3HTKC 2L5UA 5LKUA 5TRBA 4OGCA 2UZGA 2EGPA 3MDBC 2IQJA 2ECTA 2K17A 3L1XA 2CT2A 1FP0A 2Y1MA 3FM8C 3KV5A 5EYAF 2K4DA 3N9LA 4N3WA 1RMDA 5H1VA 2M6MA 3NG2A 3DQVR 2KGIA 3ZNIA 5LKTA 4YABA 5KH7A 2L7PA 3N9PA 2KR4A 2ZETC 1WEUA 4LADB 2D8UA 2VJEB 3JUEA 4AUQB 4NN2A 2ECNA 2JUNA 3SOXA 2MKEA 2YURA 3L1ZB 3LQIA 3FJUB 5B76A 1WEPA 3N9QA 2VPBA 3ZPV1 4C9ZA 3L11A 2KWKA 3PURA 1BORA 1WGMA 4XI1A 3FEHA 2VPGA 4I7BA 2YHOA 2YT5A 4UI9B 5LCWB 4IC3A 3GV4A 3LDYA 2XOCA 4I7DA 1JM7B 3M62A 5FB1A 4QF3A 2M85A 4GNFA 5D1LB 2VJFB 2Y1NA 4S3OC 2L43A 1LDJB 4YADA 3T7LA 2G43A 4PTBA 2LGKA 4WZ2A 4AYCA 2YYRA 4YC9A 3LVQE 1WIMA 1WFKA 1WEVA 2MNYA 5KH3A 4Z0OA 2XB1A 4P5OB 2MD7B 2LGGA 1N87A 2RR4A 4CA1A 2BAYA 2XOYA 4FJCA 2JMDA 5DINA 2PUYA 2M3HA 2CRRA 3M7KA 3QZVA 3PLWA 3RTRB 2JMJA 2JMIA 2G6QA 3HCTA 3I2DA 3MHHA 2MT5A 3O70A 2B0OE 1WENA
chains in the Genus database with same CATH topology
2E61A 4OGCA 2XP0A 2CSVA 3DWDA 2CRWA 2D8UA 3JUEA 3LDYA 2XOCA 2LAUA 3E2DA 4Z0RA 2FD4A 5K3QA 5SVIB 2JM3A 2RR4A 2XOYA 2JUNA 3MDBC 2MKEA 5SVYA 2CRRA 2P57A 3O47A 2IQJA 2YVRA 3LVRE 3M7KA 3LJUX 1DCQA 3FJUB 3PLWA 4F1PA 2DJAA 2CONA 3Q1DA 4H9DA 2FFWA 2YREA 3FM8C 5SVIA 2OWAA 4O62A 2KKYA 3DDTA 2EXUA 2EGMA 2M13A 2KKXA 3LVQE 4OGEA 3FEHA 3SUBA 3H7HA 4QQ4A 2B0OE 3T9KA 5SVXA 2XOZA 2L7PA 3KDEC 4Z0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOY A;  2XOZ A;  2XP0 A;  2XOC A; 
#chains in the Genus database with same CATH topology
 5J3X A;  4B86 C;  2EA6 A;  4A0C D;  1CHC A;  2VPE A;  4I7C A;  4S3O B;  2CKL B;  3U5P A;  2YVR A;  1WEO A;  2YU4 A;  2CON A;  2FFW A;  4F52 B;  2H0D A;  2KE1 A;  5AIU A;  2D8S A;  1WEM A;  4BHW A;  4MSX A;  4A4B A;  2JRJ A;  3EB5 A;  1X4J A;  4LKA A;  4FK5 A;  3RPG C;  2VJE A;  2E6R A;  2KWJ A;  5D1M B;  3N9M A;  2EOD A;  3SOU A;  5FB0 A;  1MM2 A;  2MD8 C;  2QIC A;  2M13 A;  5C13 A;  2KKX A;  4O64 A;  3ZPV E;  2CSZ A;  3PUQ A;  2OXQ C;  3KQI A;  2KWO A;  4BBQ A;  3T6R A;  5K3Q A;  5SVI B;  3ZYQ A;  2FUU A;  2LXP C;  4L58 A;  2MNZ A;  3VK6 A;  4YBS A;  1ZBD B;  5TAB A;  2ECI A;  5TDW A;  1Z2Q A;  3SOW A;  3O36 A;  3T9K A;  4YAX A;  1WIL A;  3C5K A;  2NAA A;  2XP0 A;  2ECJ A;  5C11 A;  4GNE A;  1X4U A;  3RPG B;  5FER A;  2K1J A;  3ZTG A;  4V3L C;  4ZDT A;  2DSM A;  4R7E A;  3GL6 A;  2KYU A;  1LDK C;  5I3L A;  2KWN A;  2RSD A;  4MVT A;  2E61 A;  2F42 A;  4Z0R A;  2FUI A;  5TBN A;  5H1U A;  2JM3 A;  1E4U A;  1K2F A;  1T1H A;  2K16 A;  1DCQ A;  1WEE A;  2DJA A;  3O35 A;  2YUC A;  3Q1D A;  5KH9 A;  2YRE A;  3PHD A;  3O33 A;  2CKL A;  4V3K C;  4GND A;  3ZVZ B;  4GNG A;  3LQJ A;  5G05 B;  4AYC B;  2L75 A;  1MBM A;  2LAU A;  2FD4 A;  2LV9 A;  4YBM A;  2MA5 A;  4LLB A;  2AN6 A;  4X3G A;  5H9M A;  1VFY A;  2LDR A;  5G04 B;  1WES A;  3N9N A;  5B79 A;  2KU3 A;  2YSM A;  3DDT A;  2EGM A;  2M1R A;  4YAT A;  4A4C A;  3V43 A;  2XOZ A;  5B77 A;  4A49 A;  4B7Y C;  3LQH A;  1F62 A;  4FIP A;  1HYI A;  1V87 A;  3DWD A;  1WE9 A;  2VP7 A;  2YHN A;  3O47 A;  1MM3 A;  1VYX A;  4ZQL A;  2MUM A;  1WEW A;  3U5O A;  5SVI A;  2QJ0 A;  3ZVY A;  3EB6 A;  2YSJ A;  3SUB A;  3C6W A;  3KDE C;  2DX8 A;  5D1K B;  2CSV A;  4TKP B;  1G25 A;  2H0D B;  2P57 A;  4R8P K;  3LVR E;  4F1P A;  4LK9 A;  2QIZ A;  4R2Y A;  4QF2 A;  2FSA A;  1Z6U A;  2L80 A;  3N9O A;  4O62 A;  1JM7 A;  1JOC A;  4WZ3 B;  4UP0 A;  4AVX A;  3LRQ A;  2VJF A;  3SHB A;  4FO9 A;  2CRW A;  2VNF A;  1U6G B;  2F6N A;  2Y43 A;  2LXH C;  3FL2 A;  3LJU X;  2LN0 A;  4WA6 A;  4YBT A;  1HYJ A;  1X4I A;  3FAN A;  2LGV A;  3MHS A;  2YQL A;  2YQM A;  5FEY A;  2G45 A;  2HYE D;  3KV6 A;  3E2D A;  2KFT A;  4N4F A;  1VD4 A;  2F6J A;  5JG6 A;  5SVY A;  2ECG A;  2PNX A;  2HDP A;  3HCS A;  2I50 A;  2ECV A;  2C2V S;  2E6S A;  1XWH A;  4OGE A;  3ASL A;  4L7X A;  3M99 A;  2IDA A;  2L0B A;  2LRI C;  3HCU A;  3DPL R;  3U5N A;  4GB0 A;  4WZ0 A;  2C2L A;  5B75 A;  3IHP A;  2MIQ A;  3KNV A;  2LQ6 A;  5H1T A;  2KKY A;  2KIZ A;  5B78 A;  2RI7 A;  5TDR A;  3M63 A;  4UP5 A;  4QQ4 A;  3O7A A;  5LKZ A;  5LKX A;  2CSY A;  1Z60 A;  1FBV A;  3O34 A;  3FAO A;  5DKA A;  2XEU A;  4IC2 A;  2VPD A;  1IYM A;  5AIT A;  2MA6 A;  4AP4 A;  2YW8 A;  4W4U A;  2ECW A;  4H9D A;  4CCG X;  4Q6F A;  2OWA A;  5G0F A;  1DVP A;  5B8D A;  1WEQ A;  2EXU A;  4LJN A;  3H7H A;  4PPE A;  2KGG A;  2LGL A;  5SVX A;  4ZUX U;  3U5M A;  3O37 A;  2KRE A;  3HTK C;  2L5U A;  5LKU A;  5TRB A;  4OGC A;  2UZG A;  2EGP A;  3MDB C;  2IQJ A;  2ECT A;  2K17 A;  3L1X A;  2CT2 A;  1FP0 A;  2Y1M A;  3FM8 C;  3KV5 A;  5EYA F;  2K4D A;  3N9L A;  4N3W A;  1RMD A;  5H1V A;  2M6M A;  3NG2 A;  3DQV R;  2KGI A;  3ZNI A;  5LKT A;  4YAB A;  5KH7 A;  2L7P A;  3N9P A;  2KR4 A;  2ZET C;  1WEU A;  4LAD B;  2D8U A;  2VJE B;  3JUE A;  4AUQ B;  4NN2 A;  2ECN A;  2JUN A;  3SOX A;  2MKE A;  2YUR A;  3L1Z B;  3LQI A;  3FJU B;  5B76 A;  1WEP A;  3N9Q A;  2VPB A;  3ZPV 1;  4C9Z A;  3L11 A;  2KWK A;  3PUR A;  1BOR A;  1WGM A;  4XI1 A;  3FEH A;  2VPG A;  4I7B A;  2YHO A;  2YT5 A;  4UI9 B;  5LCW B;  4IC3 A;  3GV4 A;  3LDY A;  2XOC A;  4I7D A;  1JM7 B;  3M62 A;  5FB1 A;  4QF3 A;  2M85 A;  4GNF A;  5D1L B;  2VJF B;  2Y1N A;  4S3O C;  2L43 A;  1LDJ B;  4YAD A;  3T7L A;  2G43 A;  4PTB A;  2LGK A;  4WZ2 A;  4AYC A;  2YYR A;  4YC9 A;  3LVQ E;  1WIM A;  1WFK A;  1WEV A;  2MNY A;  5KH3 A;  4Z0O A;  2XB1 A;  4P5O B;  2MD7 B;  2LGG A;  1N87 A;  2RR4 A;  4CA1 A;  2BAY A;  2XOY A;  4FJC A;  2JMD A;  5DIN A;  2PUY A;  2M3H A;  2CRR A;  3M7K A;  3QZV A;  3PLW A;  3RTR B;  2JMJ A;  2JMI A;  2G6Q A;  3HCT A;  3I2D A;  3MHH A;  2MT5 A;  3O70 A;  2B0O E;  1WEN A; 
#chains in the Genus database with same CATH homology
 2E61 A;  4OGC A;  2XP0 A;  2CSV A;  3DWD A;  2CRW A;  2D8U A;  3JUE A;  3LDY A;  2XOC A;  2LAU A;  3E2D A;  4Z0R A;  2FD4 A;  5K3Q A;  5SVI B;  2JM3 A;  2RR4 A;  2XOY A;  2JUN A;  3MDB C;  2MKE A;  5SVY A;  2CRR A;  2P57 A;  3O47 A;  2IQJ A;  2YVR A;  3LVR E;  3M7K A;  3LJU X;  1DCQ A;  3FJU B;  3PLW A;  4F1P A;  2DJA A;  2CON A;  3Q1D A;  4H9D A;  2FFW A;  2YRE A;  3FM8 C;  5SVI A;  2OWA A;  4O62 A;  2KKY A;  3DDT A;  2EXU A;  2EGM A;  2M13 A;  2KKX A;  3LVQ E;  4OGE A;  3FEH A;  3SUB A;  3H7H A;  4QQ4 A;  2B0O E;  3T9K A;  5SVX A;  2XOZ A;  2L7P A;  3KDE C;  4Z0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...