2XP0A

C-terminal cysteine-rich domain of human chfr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
212
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
total genus 64
structure length 212
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xp0A01
2XP0A 2XOYA 2XOCA 2XOZA
chains in the Genus database with same CATH superfamily
3PURA 4MVTA 5KH3A 2KWOA 3LQHA 1Z2QA 2M3HA 2FUUA 4I7BA 2H0DA 2F6NA 2MT5A 3O33A 1K2FA 4YADA 2JUNA 1MM2A 4YAXA 4AYCA 4S3OC 2JRJA 5TRBA 4LK9A 2F6JA 5D1MB 3HTKC 2M13A 2VPBA 2QIZA 5B78A 4FIPA 4IC3A 4N3WA 1HYIA 5D1LB 1V87A 2XB1A 4LADB 3U5OA 3T9KA 2E61A 2RR4A 4WZ0A 1WILA 3LVRE 5JG6A 1WEQA 2CSVA 2CT2A 5H1VA 2EA6A 2VJFB 3N9LA 3RTRB 2K17A 4W4UA 1X4JA 2LXPC 3MHSA 2UZGA 1F62A 2M6MA 4F52B 2ZETC 1HYJA 3DDTA 2B0OE 3PHDA 2LRIC 4LLBA 2JMIA 3KQIA 3L1ZB 2YW8A 2LQ6A 4OGCA 2CONA 2VPGA 5G0FA 5H9MA 2KKYA 2MKEA 4F1PA 3LQJA 3QZVA 2EGMA 2ECWA 2C2VS 5EYAF 5LKTA 2ECJA 1X4UA 5J3XA 2CKLA 3Q1DA 4A4CA 3DWDA 3KV6A 2HYED 3ZTGA 5FERA 3ZNIA 5D1KB 3O7AA 3IHPA 3E2DA 1XWHA 3SOUA 2L43A 2YQMA 5G04B 4FJCA 5LKZA 3C5KA 2VPEA 4AP4A 2LGGA 4A0CD 1WEOA 3O34A 5SVIB 2MUMA 5TABA 5H1UA 1ZBDB 1JOCA 2JM3A 3ZPVE 5I3LA 4FK5A 2P57A 5FB1A 3PLWA 2KFTA 2D8SA 4S3OB 2C2LA 2KYUA 2E6SA 1FP0A 2L7PA 2KGGA 5G05B 4Q6FA 5FEYA 1T1HA 2Y1NA 2KE1A 3L1XA 4PPEA 5LKUA 1JM7B 4Z0RA 5SVXA 3I2DA 3LJUX 1G25A 2KKXA 3O37A 5B8DA 2YVRA 2D8UA 2CSZA 4O64A 4I7DA 1BORA 1WEWA 1X4IA 3N9PA 3N9NA 5TDRA 4UP0A 3M7KA 3DQVR 1FBVA 2PUYA 3T7LA 2KWKA 2VJEA 3EB6A 3ZVZB 4GNEA 2F42A 4MSXA 4YBTA 2MD7B 2YT5A 5TDWA 4QF2A 5DINA 2VPDA 3ZYQA 2E6RA 1WESA 4OGEA 2LDRA 1LDKC 5B76A 1VFYA 4LJNA 4B7YC 2VNFA 2M1RA 1WGMA 3M63A 1WEVA 3H7HA 2L75A 3ZPV1 5AIUA 2EXUA 2L0BA 2YURA 3RPGB 4YABA 2IDAA 4V3KC 3RPGC 1RMDA 5TBNA 4QQ4A 5B75A 2QJ0A 3SOXA 2QICA 4R2YA 5LCWB 4UP5A 4WZ2A 2MNYA 2OWAA 2H0DB 1Z60A 4AUQB 4GB0A 4IC2A 1DCQA 4V3LC 4XI1A 4AYCB 5C11A 2KU3A 3M99A 2AN6A 2ECNA 2Y1MA 2YSMA 2MA6A 2FD4A 3FM8C 2KR4A 5K3QA 4C9ZA 1WEPA 2MA5A 1E4UA 2DSMA 2XEUA 5KH9A 2ECVA 1WEEA 4B86C 2KIZA 5LKXA 1WENA 3GV4A 3V43A 2OXQC 2VJFA 1IYMA 2I50A 3U5MA 3PUQA 2YREA 5FB0A 4ZQLA 2IQJA 2DX8A 3M62A 2EODA 4QF3A 3GL6A 5AITA 3FAOA 4PTBA 4A49A 4H9DA 2JMJA 3LDYA 2RSDA 2Y43A 3N9QA 4WA6A 5DKAA 4NN2A 2LXHC 2G6QA 3N9MA 2CKLB 3O47A 4ZDTA 1VD4A 2YHOA 2KREA 3O35A 2L5UA 3KNVA 3L11A 3FANA 2LN0A 2KWNA 4YBSA 2KWJA 2LGLA 3SUBA 2JMDA 4TKPB 2LGKA 4R8PK 3HCUA 1DVPA 4P5OB 3KV5A 3MHHA 4CCGX 4BBQA 2XOYA 5SVIA 3KDEC 2ECIA 1MBMA 2RI7A 2XOZA 1WEMA 2LV9A 2ECGA 2EGPA 1VYXA 3SOWA 2M85A 4GNDA 2FSAA 4YATA 4X3GA 1MM3A 2CSYA 3U5NA 2YHNA 2YUCA 1Z6UA 2LGVA 4YC9A 5KH7A 2XOCA 1LDJB 3ZVYA 3VK6A 1N87A 4ZUXU 2YSJA 3JUEA 1JM7A 4I7CA 4Z0OA 2DJAA 2BAYA 4LKAA 4FO9A 2K4DA 4R7EA 4CA1A 2L80A 1WFKA 4GNGA 1WEUA 3NG2A 3ASLA 4WZ3B 2CRRA 2YYRA 2YQLA 4YBMA 3C6WA 2MD8C 2VJEB 4O62A 4L58A 2MNZA 3T6RA 4AVXA 4GNFA 4BHWA 2G45A 2FFWA 3DPLR 3O36A 4A4BA 1CHCA 5B79A 2YU4A 2PNXA 2G43A 3MDBC 2K1JA 3HCTA 1WE9A 2LAUA 3FEHA 4N4FA 3O70A 2MIQA 4L7XA 3LVQE 2VP7A 2NAAA 2FUIA 4UI9B 3SHBA 3EB5A 3LRQA 2XP0A 5SVYA 3U5PA 2K16A 2ECTA 2KGIA 1U6GB 2CRWA 1WIMA 3FL2A 3LQIA 5H1TA 2HDPA 3N9OA 5B77A 3FJUB 5C13A 3HCSA
chains in the Genus database with same CATH topology
3FM8C 2CRRA 3Q1DA 5K3QA 4QQ4A 3O47A 2XOYA 3DWDA 5SVIA 5SVIB 3M7KA 3KDEC 2XOZA 3LVQE 3JUEA 3DDTA 3T9KA 4O62A 2B0OE 2E61A 2RR4A 2OWAA 4H9DA 3LVRE 4Z0RA 2JM3A 3LDYA 2FFWA 4Z0OA 5SVXA 2XP0A 5SVYA 1DCQA 2CSVA 3E2DA 3H7HA 4OGCA 2DJAA 3LJUX 4OGEA 2KKXA 2JUNA 2CONA 2P57A 4F1PA 2CRWA 2KKYA 2EXUA 2MKEA 3PLWA 2YVRA 3FEHA 2EGMA 3SUBA 2D8UA 2L7PA 3MDBC 2YREA 3FJUB 2M13A 2LAUA 2IQJA 2XOCA 2FD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP0 A;  2XOY A;  2XOC A;  2XOZ A; 
#chains in the Genus database with same CATH topology
 3PUR A;  4MVT A;  5KH3 A;  2KWO A;  3LQH A;  1Z2Q A;  2M3H A;  2FUU A;  4I7B A;  2H0D A;  2F6N A;  2MT5 A;  3O33 A;  1K2F A;  4YAD A;  2JUN A;  1MM2 A;  4YAX A;  4AYC A;  4S3O C;  2JRJ A;  5TRB A;  4LK9 A;  2F6J A;  5D1M B;  3HTK C;  2M13 A;  2VPB A;  2QIZ A;  5B78 A;  4FIP A;  4IC3 A;  4N3W A;  1HYI A;  5D1L B;  1V87 A;  2XB1 A;  4LAD B;  3U5O A;  3T9K A;  2E61 A;  2RR4 A;  4WZ0 A;  1WIL A;  3LVR E;  5JG6 A;  1WEQ A;  2CSV A;  2CT2 A;  5H1V A;  2EA6 A;  2VJF B;  3N9L A;  3RTR B;  2K17 A;  4W4U A;  1X4J A;  2LXP C;  3MHS A;  2UZG A;  1F62 A;  2M6M A;  4F52 B;  2ZET C;  1HYJ A;  3DDT A;  2B0O E;  3PHD A;  2LRI C;  4LLB A;  2JMI A;  3KQI A;  3L1Z B;  2YW8 A;  2LQ6 A;  4OGC A;  2CON A;  2VPG A;  5G0F A;  5H9M A;  2KKY A;  2MKE A;  4F1P A;  3LQJ A;  3QZV A;  2EGM A;  2ECW A;  2C2V S;  5EYA F;  5LKT A;  2ECJ A;  1X4U A;  5J3X A;  2CKL A;  3Q1D A;  4A4C A;  3DWD A;  3KV6 A;  2HYE D;  3ZTG A;  5FER A;  3ZNI A;  5D1K B;  3O7A A;  3IHP A;  3E2D A;  1XWH A;  3SOU A;  2L43 A;  2YQM A;  5G04 B;  4FJC A;  5LKZ A;  3C5K A;  2VPE A;  4AP4 A;  2LGG A;  4A0C D;  1WEO A;  3O34 A;  5SVI B;  2MUM A;  5TAB A;  5H1U A;  1ZBD B;  1JOC A;  2JM3 A;  3ZPV E;  5I3L A;  4FK5 A;  2P57 A;  5FB1 A;  3PLW A;  2KFT A;  2D8S A;  4S3O B;  2C2L A;  2KYU A;  2E6S A;  1FP0 A;  2L7P A;  2KGG A;  5G05 B;  4Q6F A;  5FEY A;  1T1H A;  2Y1N A;  2KE1 A;  3L1X A;  4PPE A;  5LKU A;  1JM7 B;  4Z0R A;  5SVX A;  3I2D A;  3LJU X;  1G25 A;  2KKX A;  3O37 A;  5B8D A;  2YVR A;  2D8U A;  2CSZ A;  4O64 A;  4I7D A;  1BOR A;  1WEW A;  1X4I A;  3N9P A;  3N9N A;  5TDR A;  4UP0 A;  3M7K A;  3DQV R;  1FBV A;  2PUY A;  3T7L A;  2KWK A;  2VJE A;  3EB6 A;  3ZVZ B;  4GNE A;  2F42 A;  4MSX A;  4YBT A;  2MD7 B;  2YT5 A;  5TDW A;  4QF2 A;  5DIN A;  2VPD A;  3ZYQ A;  2E6R A;  1WES A;  4OGE A;  2LDR A;  1LDK C;  5B76 A;  1VFY A;  4LJN A;  4B7Y C;  2VNF A;  2M1R A;  1WGM A;  3M63 A;  1WEV A;  3H7H A;  2L75 A;  3ZPV 1;  5AIU A;  2EXU A;  2L0B A;  2YUR A;  3RPG B;  4YAB A;  2IDA A;  4V3K C;  3RPG C;  1RMD A;  5TBN A;  4QQ4 A;  5B75 A;  2QJ0 A;  3SOX A;  2QIC A;  4R2Y A;  5LCW B;  4UP5 A;  4WZ2 A;  2MNY A;  2OWA A;  2H0D B;  1Z60 A;  4AUQ B;  4GB0 A;  4IC2 A;  1DCQ A;  4V3L C;  4XI1 A;  4AYC B;  5C11 A;  2KU3 A;  3M99 A;  2AN6 A;  2ECN A;  2Y1M A;  2YSM A;  2MA6 A;  2FD4 A;  3FM8 C;  2KR4 A;  5K3Q A;  4C9Z A;  1WEP A;  2MA5 A;  1E4U A;  2DSM A;  2XEU A;  5KH9 A;  2ECV A;  1WEE A;  4B86 C;  2KIZ A;  5LKX A;  1WEN A;  3GV4 A;  3V43 A;  2OXQ C;  2VJF A;  1IYM A;  2I50 A;  3U5M A;  3PUQ A;  2YRE A;  5FB0 A;  4ZQL A;  2IQJ A;  2DX8 A;  3M62 A;  2EOD A;  4QF3 A;  3GL6 A;  5AIT A;  3FAO A;  4PTB A;  4A49 A;  4H9D A;  2JMJ A;  3LDY A;  2RSD A;  2Y43 A;  3N9Q A;  4WA6 A;  5DKA A;  4NN2 A;  2LXH C;  2G6Q A;  3N9M A;  2CKL B;  3O47 A;  4ZDT A;  1VD4 A;  2YHO A;  2KRE A;  3O35 A;  2L5U A;  3KNV A;  3L11 A;  3FAN A;  2LN0 A;  2KWN A;  4YBS A;  2KWJ A;  2LGL A;  3SUB A;  2JMD A;  4TKP B;  2LGK A;  4R8P K;  3HCU A;  1DVP A;  4P5O B;  3KV5 A;  3MHH A;  4CCG X;  4BBQ A;  2XOY A;  5SVI A;  3KDE C;  2ECI A;  1MBM A;  2RI7 A;  2XOZ A;  1WEM A;  2LV9 A;  2ECG A;  2EGP A;  1VYX A;  3SOW A;  2M85 A;  4GND A;  2FSA A;  4YAT A;  4X3G A;  1MM3 A;  2CSY A;  3U5N A;  2YHN A;  2YUC A;  1Z6U A;  2LGV A;  4YC9 A;  5KH7 A;  2XOC A;  1LDJ B;  3ZVY A;  3VK6 A;  1N87 A;  4ZUX U;  2YSJ A;  3JUE A;  1JM7 A;  4I7C A;  4Z0O A;  2DJA A;  2BAY A;  4LKA A;  4FO9 A;  2K4D A;  4R7E A;  4CA1 A;  2L80 A;  1WFK A;  4GNG A;  1WEU A;  3NG2 A;  3ASL A;  4WZ3 B;  2CRR A;  2YYR A;  2YQL A;  4YBM A;  3C6W A;  2MD8 C;  2VJE B;  4O62 A;  4L58 A;  2MNZ A;  3T6R A;  4AVX A;  4GNF A;  4BHW A;  2G45 A;  2FFW A;  3DPL R;  3O36 A;  4A4B A;  1CHC A;  5B79 A;  2YU4 A;  2PNX A;  2G43 A;  3MDB C;  2K1J A;  3HCT A;  1WE9 A;  2LAU A;  3FEH A;  4N4F A;  3O70 A;  2MIQ A;  4L7X A;  3LVQ E;  2VP7 A;  2NAA A;  2FUI A;  4UI9 B;  3SHB A;  3EB5 A;  3LRQ A;  2XP0 A;  5SVY A;  3U5P A;  2K16 A;  2ECT A;  2KGI A;  1U6G B;  2CRW A;  1WIM A;  3FL2 A;  3LQI A;  5H1T A;  2HDP A;  3N9O A;  5B77 A;  3FJU B;  5C13 A;  3HCS A; 
#chains in the Genus database with same CATH homology
 3FM8 C;  2CRR A;  3Q1D A;  5K3Q A;  4QQ4 A;  3O47 A;  2XOY A;  3DWD A;  5SVI A;  5SVI B;  3M7K A;  3KDE C;  2XOZ A;  3LVQ E;  3JUE A;  3DDT A;  3T9K A;  4O62 A;  2B0O E;  2E61 A;  2RR4 A;  2OWA A;  4H9D A;  3LVR E;  4Z0R A;  2JM3 A;  3LDY A;  2FFW A;  4Z0O A;  5SVX A;  2XP0 A;  5SVY A;  1DCQ A;  2CSV A;  3E2D A;  3H7H A;  4OGC A;  2DJA A;  3LJU X;  4OGE A;  2KKX A;  2JUN A;  2CON A;  2P57 A;  4F1P A;  2CRW A;  2KKY A;  2EXU A;  2MKE A;  3PLW A;  2YVR A;  3FEH A;  2EGM A;  3SUB A;  2D8U A;  2L7P A;  3MDB C;  2YRE A;  3FJU B;  2M13 A;  2LAU A;  2IQJ A;  2XOC A;  2FD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...