1JOCA

Eea1 homodimer of c-terminal fyve domain bound to inositol 1,3-diphosphate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
QDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Early Endosomal Autoantigen 1
publication title Multivalent endosome targeting by homodimeric EEA1.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jocA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jocA02
2MT5A 4FIPA 3N9NA 5LKUA 2ECIA 2FUUA 4UP5A 3U5NA 5AIUA 3L4FA 2MD7B 4YATA 3KQIA 2HDPA 2LXPC 2D8SA 3PUQA 2VNFA 4UI9B 1Z6UA 5B77A 1G25A 3QZVA 2VPGA 2F6NA 1DVPA 2ECGA 3O37A 4C9ZA 2LGLA 2M1RA 2MNYA 4Q6FA 4GB0A 1FP0A 1WEMA 5G05B 2Y43A 3LQJA 4S3OC 2UZGA 4PTBA 3RPGB 3RTRB 1WILA 2VPDA 5FERA 2KREA 5KH7A 3L1ZB 4MVTA 2YSMA 1VD4A 1VFYA 1WEQA 1T1HA 3O34A 3PHDA 5KH9A 5H1TA 2F6JA 3SOUA 4I7DA 4FJCA 2KWOA 2YU4A 4YBTA 4GNEA 2LN0A 3KV5A 5LKZA 1WEVA 4LKAA 4V3LC 2ECVA 4AP4A 2CSZA 4WZ2A 5D1KB 2VPBA 1BORA 2BAYA 2KR4A 1K2FA 3IHPA 3SOXA 2YSJA 5TDRA 2K16A 1ZBDB 4YAXA 3HTKC 4LADB 2L5UA 5H9MA 2C2VS 4N4FA 1WEWA 3EQ2A 4GNFA 5B8DA 4LJNA 2KWNA 2LDRA 5LCWB 4YBSA 3GL6A 2HYED 2RSDA 2KWKA 2VJFB 2CSYA 2JMDA 5TABA 3N9MA 2KWJA 1Z60A 4IC3A 2YURA 4A4CA 1Z2QA 1HYIA 1WEEA 4QF2A 2KFTA 2QJ0A 2K17A 2KYUA 5DKAA 1WEOA 4LLBA 4N3WA 4YBMA 2VJFA 1WEUA 5TBNA 1HYJA 3ZYQA 3CL3D 3N9PA 3ASLA 5LKTA 1JM7B 4FK5A 3VK6A 3ZPV1 2CKLB 2M3HA 1JOCA 3N9LA 3T7LA 3HCUA 2VP7A 1X4IA 1WIMA 3NG2A 2K4DA 3BRTB 3O70A 4L58A 2PUYA 1JM7A 1VYXA 4QF3A 2ECJA 2ZETC 5C11A 4XI1A 1WFKA 2CKLA 4A4BA 2L80A 5I3LA 1MM3A 3L1XA 2YUCA 4MSXA 5H1VA 5B79A 2L43A 5AITA 1WESA 4B86C 2G43A 5H1UA 2XB1A 2G6QA 2W6BA 2XEUA 5JG6A 2YREA 2YKOA 2YKPA 4ZUXU 3BRVB 3ZPVE 5D1MB 2VPEA 2QIZA 5B75A 3U5PA 2VJEB 2F42A 2KIZA 2YW8A 2LQ6A 2L0BA 4NN2A 2MD8C 1WGMA 5DINA 2G45A 4WZ3B 3HCSA 3LQHA 4R2YA 2YKQA 3MHSA 5TDWA 4O64A 2VJEA 2ECWA 2LGGA 5FB0A 2Y1NA 3RPGC 3ZNIA 5D1LB 5J3XA 2KU3A 4A49A 1U6GB 2L75A 2MNZA 2E6RA 1IYMA 4S3OB 4I7CA 1V87A 2MIQA 2MA6A 3DQVR 4P5OB 3MHHA 3U5MA 2YHOA 4IC2A 4LK9A 1LDJB 3HCTA 5C13A 3O7AA 2IDAA 1X4JA 4CCGX 2JMIA 2LGVA 3O36A 4W4UA 2K1JA 2YYRA 4AVXA 4AUQB 2QICA 2PNXA 3M62A 4A0CD 3N9QA 5TRBA 3LRQA 4WZ0A 5G04B 3DPLR 2EGPA 4ZQLA 3L11A 4X3GA 2C2LA 2M6MA 4I7BA 1XWHA 2I50A 2YQMA 1CHCA 3SOWA 3M63A 2KGGA 4AYCB 2H0DB 3C5KA 3C6WA 4FO9A 4L7XA 3SHBA 4ZDTA 3GV4A 4V3KC 3N9OA 1N87A 3KV6A 2LGKA 5FB1A 4YC9A 4AYCA 2H0DA 3U5OA 2FUIA 3ZVZB 1WENA 2DX8A 2ECNA 3ZVYA 3O33A 1MM2A 5B76A 5B78A 4TKPB 3LQIA 3KNVA 3FL2A 3I2DA 1WEPA 1E4UA 4R8PK 2FSAA 2OXQC 2KGIA 2E6SA 2LXHC 2JRJA 2YQLA 5G0FA 2NAAA 2EA6A 4BHWA 5EYAF 1FBVA 4GNGA 4WA6A 1WE9A 3ZTGA 5KH3A 3T6RA 1LDKC 2LRIC 5LKXA 3PURA 4YABA 4CA1A 4UP0A 2RI7A 2ECTA 4GNDA 5FEYA 3O35A 2YT5A 3EB5A 2MUMA 2CT2A 2Y1MA 1RMDA 3EB6A 2JMJA 4BBQA 4F52B 4YADA 4R7EA 2LV9A 2M85A 2MA5A 2KE1A 1F62A 4B7YC 3V43A 1X4UA 2YHNA 3M99A 2EODA 2AN6A 4PPEA
chains in the Genus database with same CATH superfamily
1AVYA 3Q5PA 4L75A 1J2JB 1LTGC 2RR4A 3L74E 4D6TD 2FUUA 3U5NA 2FYUE 4YATA 3RL0C 3LVRE 2PAJA 3KQIA 1LTJB 4N6JA 2VNFA 3PLWA 1ZOYC 4Y99B 1BCCJ 2FKWB 1NU1G 4H13B 2E42A 2ECGA 4C9ZA 3IN6A 1LTBC 1RHZB 2JR8A 1FP0A 4GB0A 5G05B 1NU1D 4I2LC 3LQJA 1LTJA 3CCRP 3KPEA 1NGMB 2EGMA 5AW6B 1N2DC 1WT6A 2ZYDA 2KREA 2XNDH 2E75B 5CCHC 1VD4A 2FYUK 2A06E 4A7PA 2WT7A 2QJYC 1T1HA 1YJWP 5B5EH 4UB8E 1USEA 1PP9D 3SOUA 1FJKA 3H1IG 4H0LB 2KWOA 3HD7C 1JY3P 2QG4A 2M3BA 3KV5A 3LVQE 3H1ID 2YXQB 3L37A 1X79B 1ZV8A 2VPBA 3GLMA 2FFDC 3G3ZA 1K2FA 1N7LA 2D2CD 1ZN5A 3FEHA 1XTGB 2YMKA 3SOXA 2YSJA 1QVGO 2XV5A 4ZNCA 2K16A 4U3FJ 4YAXA 3A3YB 4BXLA 3HTKC 2KLVA 2L5UA 5BU5A 1NTKK 2P1JA 1AA0A 1SFCD 3SWYA 1BCCE 1RQUA 3TSIA 3T97B 5CBOA 4N4FA 1U7MA 1P84E 1IZNB 5B8DA 4UB6H 3MGNA 3RK3E 4YTPC 3B71A 3TDKA 1JY2P 2OYHB 2KWKA 2EXUA 1Q81Q 2ZT9C 1JEKA 1VQMP 3S4RA 5TABA 2P57A 3A0BH 1MKMA 2KZIA 3T97A 4OGEA 4IC3A 2YURA 4A4CA 2G8YA 1M57D 1UIIA 2KFTA 5DKAA 3I56P 2ZAEB 4PV1D 1WEOA 1YBKA 2OYHA 3W67A 2K9JB 2V7QJ 1MZ9A 5KAIH 2E74D 5TBNA 1HUCA 1HYJA 4K3AA 4EDFA 1HJ0A 1JM7B 3CXHE 2WSEJ 3ZPV1 2R5DA 3AE7C 1PL5A 2M3HA 2QEXP 5C39A 1M1JB 4U3FE 1Y8AA 1IK9A 5APQA 5AW8B 2B9BA 1KFMA 1NVOA 2GUSA 1JM7A 5CMZA 4QF3A 1N7SD 1VQ8P 2L80A 1M1JA 4MSXA 4RESB 2UWJE 2FFDA 2HYNA 2NPSB 2I8DA 5JG6A 4H44C 4OVNF 3VYIA 3L74G 3KHUA 2YREA 2YKPA 2FYUG 2M0BA 3BASA 3O47A 3CC2P 1AQ5A 4C46A 1KYOH 2QIZA 2FYUD 1OMIA 2F42A 2KIZA 3Q1DA 1FOSE 2YW8A 1T8ZA 2NPSA 2LKMA 1L4AB 3HE4B 4EOTA 1EXIA 4NN2A 2YIUC 2MD8C 1VF5B 1EDJA 3Q5RA 4WZ3B 1A02J 2FY8A 3MHSA 1MBMA 1NAFA 1OX3A 2LGGA 1S9KE 1VPCA 4F1PA 3K5BA 1L4AA 3HE4A 3I5CA 3LIEA 3AE8C 1L0NJ 5D1LB 3SUBA 2A06G 5AW4B 3D70A 5J3XA 1X0TA 3CI9A 2Q3IA 2BCCJ 1EDKA 2A06D 4NPEA 1NTKD 2E76D 3AE2C 2D2CC 2ZYGA 4ZKUA 2IX7C 3L72D 1X8YA 4L73A 3B4SA 3JCUH 3L71J 1TU3F 5GTIE 2KZJA 3E1RA 1LGHB 1D7MA 1X4JA 3CX5I 4XFJA 4YXDC 3L36A 3DDTA 4H44B 1S5LH 3TYYA 2K1JA 4L74A 1BCCG 2YYRA 2QJPB 2QICA 1QX8A 3PJSK 4IFDK 3CWBE 2YO2A 3DPLR 4XA4A 1QGKB 3U1CA 4PV1C 4YXWH 5AW2B 4X3GA 3RK3D 1W2EA 1G2CB 1XWHA 1NTZJ 2YQMA 4ZMDA 2E74C 3D6ZA 1L0NE 3M63A 2A45I 3HUSC 3C5KA 5AVVB 2P58A 5DJTB 3H32B 2BCCE 2KUBA 1QL2A 4LLHA 5KLIB 3M9QA 1G2CA 1BSNA 3SSUA 5AW1B 5CHXA 1N87A 1LP1A 3U5OA 3ZVZB 3L71E 2DX8A 1BSHA 3ZVYA 3H32A 1KFNA 4Z0OA 3F5HA 5B76A 5B78A 1N7SC 3BCCE 2A45G 1WEPA 4U3FG 4R8PK 4GIFA 2OXQC 5KLVE 1L0NK 3USSA 5B66E 1PGPA 1PGQA 1H88A 3IF4A 4OH8B 2EA6A 3WU2H 1CZQA 1OIPA 4EIJA 1PGJA 1R5SA 4WA6A 4MN4C 2WVRA 5KH3A 3NFQA 1M90Q 1SS1A 4IFMA 3PURA 3S9OA 3V6IA 1JY3N 1NTZE 5AVWB 1EZVE 2YT5A 2YXRB 5KLVK 2HPCB 2C0XA 1RF0A 5GTHE 3P32A 5TISH 3NMDA 1YHQP 1RH5B 3H1HJ 5SVXA 4YADA 2QIWA 2MA5A 1KC8Q 2KE1A 1F62A 1U57A 1JMMA 3SWFA 3M99A 5BVZA 1FZEA 5K5GB 1L2PA 1IFPA 1H89A 4FIPA 1JY2N 3CCQP 1J1EC 2E76C 1S4XA 2I1KA 5AVYB 3E2DA 2E5TA 2D8SA 1NAYA 4PJ0E 3PUQA 2OTJP 3VP8A 2IBZE 2HFED 5B77A 1G25A 1KB9E 1ZRTD 2LGLA 3D71A 3Q5SA 2W27A 1Z56A 2N9YB 3AE3C 5APVA 4EI2A 1IFDA 3JUEA 4S3OC 2RKLA 4R4LA 1URQD 2UZGA 4PTBA 3RPGB 3PTZA 1N7SA 1T3JA 3A5TA 5FERA 5H2FH 5KH7A 2WZ7A 3L1ZB 4MVTA 3L75D 3L70E 1NWQA 4JF7A 1SQVJ 1WEQA 3VMAA 4JYCA 3VMZA 3H1HE 2JWDA 1HVVA 1LT1A 4I7DA 2CPSA 1HTLC 2YU4A 4FJCA 4YBTA 1YYCA 3CWBG 4R4MA 2KIKA 5CCGD 2ECVA 2CSZA 3HE5B 2H43A 2Y0DA 2KNCB 3FXDA 4W80A 3CWBD 2KR4A 1OW7A 5AW5B 2GA1A 1KTMA 1L0NG 3IHPA 5TDRA 2M5AA 3VMYA 1ZBDB 3LIDA 4I7ZB 1SQQJ 4LADB 1GK4A 5H9MA 1OZHA 4XE5B 5AVZB 1Y47A 2BCCG 2H89C 3HE5A 2W90A 3GMAA 2QJKC 2XOYA 4YPCA 4O9BA 3TGUD 1SQXJ 3GL6A 2RSDA 3L71G 1LWUC 2CSYA 1JCCA 3SFEC 1FC2C 3N4XA 1Z2QA 5KLVG 1WEEA 3KZIH 2K17A 2KYUA 3BCCD 1BGYD 1N86A 3SFDC 3H6PA 4HKZH 5KLVD 1NO4A 3CX5H 2KS1A 2FYNB 3FGAD 3OAKA 2AEFA 2CPBA 3ZYQA 1FDMA 3PP5A 3VK6A 2P67A 2WSCH 2CKLB 3BVHA 3CCUP 1NTZG 3U59A 5E79E 1JOCA 3N9LA 1EZVG 5AW0B 1NKZB 3A2AA 3CCMP 5TJHA 1PZQA 3HCUA 4WY4D 2VP7A 3MDBC 3FJUB 2WT7B 3BRTB 3O70A 1SQPJ 4IL6E 1S3JA 2PUYA 2ECJA 2CKLA 2A45H 2WWWA 1N73B 2ZJSE 2QVAA 5APTA 1G1JA 3H1KJ 1FDIA 2RH0A 2XOCA 1SQXE 1KILC 3G6EP 2YMYA 3FWLA 2G43A 1BE3E 5H1UA 2XB1A 2XEUA 1N73A 4L76A 4U7JA 2Q7CA 1VQ5P 2N1TD 3BRVB 2OARA 2B0OE 5D1MB 3AE4C 3A0HH 5APXA 2ZVNB 2MKVA 3H1JJ 3VTPC 2VJEB 2FYZA 2VRSA 2IBZG 3FM8C 1URQC 2LQ6A 3QH9A 3H1LJ 1KD1Q 2Q3EA 1KQLA 2IBZD 5DINA 1FZCC 2O1JA 5CJ0A 1FZFA 5KJ7A 2O3JA 1KB9D 5SVYA 2PRRA 1GL2C 3B5ND 2D8UA 3GG2A 4HB1A 2VJEA 3RK2D 5FB0A 3V2RA 2OYOA 3RL0B 1R8EA 1HF9A 1S1CX 3L70G 2BASA 5AVXB 3ZNIA 3V2QA 1L0LJ 3JSVC 5CCGC 3L70D 3H1HG 3IR9A 2NZ2A 1U6GB 1SLQA 4HH2A 3VMXA 2H7HA 3P8CE 3H1KE 1YI2P 3M7KA 2OTKE 4GDOA 3CPWO 3CCSP 4PD4I 4I6MC 2G3AA 2I1JA 1AJYA 4LK9A 3HCTA 1Q90D 1ZMEC 1VQPP 3TNUB 3KXDA 1H0TB 1KILB 1OVUA 2QJYB 3TF5A 2LGVA 3V4WA 3H1JE 2OYIC 3O36A 3VP9A 2KKYA 2R32A 2IPPA 1Q2NA 4AUQB 3HD7B 3M62A 3H1LE 4RKUJ 4A0CD 3EFFK 1OVVA 3TNUA 3N9QA 1H0TA 5CCHA 3MIWA 1KILA 1E5WA 3E7KA 2WSFH 3FWNA 3M9HA 2FFDB 1M8OB 4PD4D 2KKXA 2C2LA 2H88C 2KP8A 3M0AA 3MUDC 1VQ7P 2WPRA 3HD7A 1FZCB 1KQSO 3HTKB 1KV4A 1E79H 3CLQA 2KGGA 2C9LY 1GL2B 2R44A 3CCEP 1SQVG 3S1KA 3C6WA 2ZXXA 3HRNA 2E43A 3SHBA 2JM3A 3GV4A 1FZCA 5B5EE 3HTKA 3G9RA 2GM4A 3KV6A 4WY4C 4NPFX 3L74D 1QL1A 4LGDE 1GL2A 3P7KA 2ZT9B 4OGQD 2CSVA 1GU5A 2KB7P 1MM2A 5CBNA 3GHGC 1SP4A 1S72P 1IC2A 2AEJA 2IFMA 2M8RA 3I2DA 3FAOA 2KGIA 4ASWA 2E6SA 2ZVOB 5CCGA 3G71P 3KQGA 2JRJA 2Y9YA 1DH3A 2HG5D 4C7NB 2Z5HA 1USDA 2FD4A 1FBVA 1PGOA 2ITAA 3EFGA 1Q86Q 3H25A 1SQXG 4TLFA 3ZTGA 1OW6A 1SQBJ 4GODA 1LDKC 3H7HA 1BE3G 4C7NA 4UB6E 2HODB 4CA1A 3L73J 1BE3D 2ECTA 2AXTH 1P84I 3O6QB 1NHLA 5FEYA 2WPSA 3O35A 2B88A 1FJPA 2CK3H 1PPJE 1OXZA 2KLUA 3AEDC 1VQ4P 2Y1MA 1VQ6P 1RMDA 4N78E 3B5NC 2HODA 1JCDA 3MTUE 1HH0A 1NTMJ 1SFCC 1W5CE 3RK2C 3RBXA 2JDIH 1DEBA 1VL2A 2P7JA 3PHLA 5KAIE 3O6QA 2Y9ZA 3AEFC 1X4UA 3ITKA 1M1KQ 1ZR4A 5AVQB 5KAFH 2WMMA 3MUDA 1X9VA 2MT5A 2P2UA 3NXSA 2K1AA 1LTAC 3N9NA 2J5UA 2H8PD 2J59M 5LKUA 2ECIA 4UP5A 1BCCD 3LW5H 2E5YA 5APUA 1SQPG 1P84D 1QEXA 2HDPA 2LXPC 1QVFO 2BEZF 4UI9B 3CXHI 1EQ7A 2YIUB 1ZXGA 4D6TJ 3H1KG 4WWIA 1IFIA 2F6NA 1DVPA 1JO5A 4WY4A 4W7ZA 3O37A 1LP1B 1SQBE 2M1RA 3P8CD 3D6YA 1WEMA 2Y43A 1JUNA 1M7LA 3GF3A 1YIJP 3RTRB 1WILA 2VPDA 4H13D 1NU1J 2B89A 3H1JG 1YITP 2R3SA 1DIPA 5KH9A 1EC5A 3WUVA 1KYOE 5H1TA 2D2CB 3H1LG 1NTME 1IK7A 3CXHD 2LXBA 2E61A 1IFJA 4JQ0D 5LKZA 1WEVA 4LKAA 4V3LC 1FS0E 4U3FD 4BRYB 1PP9J 1T2KD 1SFCB 5D1KB 3LW5J 3W68A 2WSSH 2QM8A 4EYYQ 3F89A 4H0LD 1PIXA 3H1IJ 2O01H 1OWAA 1RE4C 4BRYA 4OGQC 1SFCA 1NH4A 2IYPA 1IJDB 1NTMK 1WEWA 4GNFA 2ZXEB 2KWNA 5LCWB 4YBSA 4PV1B 2HYED 2VJFB 1VQ9P 2E74B 4Z1MH 2JMDA 4PD4H 2HR3A 3HUSB 1AV1A 1HYIA 1QLED 5AVTB 1IFNA 3BATA 2VJFA 4JBZA 5AW9B 2JUNA 1NTZK 1S5LE 2ZYAA 1S9KD 1W2BO 3V2NA 3HUSA 3CL3D 1J1DC 3N9PA 3ASLA 2BEQD 4FK5A 1N7SB 2DJAA 1GZLA 3T7LA 3WUUA 3QWOC 3M0DC 1GMJA 1X4IA 1VQNP 1PPJG 5AVRB 3NG2A 1WFKA 1PPJD 1BDCA 1GU4A 1MM3A 2WPVB 3Q1MA 5B79A 3C1LA 4N3YB 2QE7H 1GK6A 2L43A 5AITA 2L5GB 3RBZA 5BU8B 1GW3A 1FZBA 3MZWB 3RK3C 3M9BA 3FANA 1U7JA 1AVOA 2PFXA 2P10A 2JEEA 2M5AB 4ZUXU 2K9YA 3DWDA 4IL6X 1FBMA 4UB8H 1YQ3C 2B87B 2KOGA 5B75A 3U5PA 2IZ1A 3ABVC 1GD2E 5AW7B 2XOZA 2NPSD 3T9KA 2L0BA 4Y99C 1MUUA 3WU2E 1SQBG 1WGMA 2HLOA 1GW4A 1ZLLA 4H13C 2G45A 4OWFA 2FYUJ 4HYTB 3I55P 4AQRD 2B87A 1L0ND 4R2YA 2YKQA 5TDWA 2N9BA 1DD4A 1Q7YQ 3L73G 3AEGC 1J1EB 2E76B 2Y1NA 4GKGA 2V4HA 1L4AD 2BCCD 3V4QA 1FE6A 1VF5D 1RY3A 3LJUX 3VN0A 1NKNA 1P84H 2XNXA 2KS1B 1NTMG 1T2KC 3L71D 5TISE 1EZVI 1KYOD 4S3OB 1NTMD 3GF7A 4H0LC 3TK1A 1SQVE 2MA6A 2K3RA 3DQVR 1NTKJ 2KXPB 3O8ZA 2QM7A 3MHHA 3U5MA 4IC2A 3A7OA 1LDJB 5C13A 4WB4A 3L72J 2IFNA 3JC22 4CCGX 4M3LA 2JMIA 4ASVA 1ZW0A 4W4UA 2XP0A 3RK3B 4AVXA 2C0WA 3AE5C 2PNXA 2WITA 2OQQA 1N8RQ 2Q9IA 2KSEA 3CXHH 1NTZD 1SQQE 2W83C 5G04B 1EZVD 3N7NA 1SQVK 4ZQLA 3L11A 2POHA 4H44D 2M6MA 4I7BA 2OYHC 2IBZI 1CHCA 3SOWA 1KB9I 3OJAB 2AXCA 4AYCB 2H0DB 4QMAA 2W6AA 1JNMA 1IO4A 5H2FE 2QJKB 1OFCX 1DEEG 1JMBA 5M1BA 4L7XA 4ZDTA 3N9OA 2LGKA 4YC9A 1LWUB 1SQQK 4AYCA 2H0DA 2FUIA 1PP9G 1NTKE 1XTCC 3O33A 2JJLA 3LQIA 3PH0A 2WSCJ 1E4UA 3L72E 3IAOA 1SQXK 5EFWB 3RL0g 1M1JC 2V7QH 4WBAA 2JKVA 2LXHC 1LWUA 1HWTC 2Q1KA 2YQLA 5G0FA 4IOIH 1KZUB 2KK7A 5APWA 2O1KA 4BHWA 2LR2A 2CRWA 1X22A 4TT3H 4CPGA 4GNGA 3AEEC 2WSEH 2MJZA 2IQJA 3C8VA 4RO0A 1YQ4C 1SQPE 3T6RA 4GT1A 4JYBA 2PGDA 4DCKA 5LKXA 2PP6A 1LJ2A 4ZKPA 2XDJA 2YVRA 2NPSC 1IFMA 2RI7A 3H1HD 3CC7P 3EB5A 2MUMA 4H9DA 1HJBA 4Y28J 3KZIE 3EB6A 2NRGA 4RJTA 4R7EA 2LV9A 2M85A 2CONA 1L4AC 3CX5E 5GTIH 4B7YC 3V43A 1VF5C 2YHNA 1JY3O 2LAUA 1SQPK 3G4SP 4PPEA 1YJ9P 4JPZB 3CD6P 3Q3DA 1UIXA 1K9MQ 1RF1C 1SVFA 5AIUA 3L4FA 2MD7B 2SPZA 4KHXA 1RQVA 1FAVA 1URQB 5AVUB 3Q2YA 1KQGB 1FZAA 1Z6UA 3AEAC 2K9JA 2XKMA 3QZVA 2VPGA 1KORA 1FOSF 1L0LE 1LTSC 2MNYA 4Q6FA 2Z5IA 1URQA 3CMAP 1JY2O 3MD0A 1SQVD 2JWAA 2K37A 4K35A 3R2PA 2YSMA 2OGUA 2FBWC 1VFYA 3O34A 3PHDA 2R3CA 3A0HE 2F6JA 3L75J 2JO1A 2QJPC 3FX0A 1LNQA 1EDIA 1SQQG 3KDEC 1L0LK 4GNEA 2LN0A 4AP4A 1ZP0C 4WZ2A 1SQQD 1LTIC 2Y0CA 3E1IA 1BORA 2Y0EA 2BAYA 2WSFJ 5APSA 2IDBA 1OVRA 5B66H 2KYVA 2OYIB 2WPQA 2N1TC 3CWBJ 1Q82Q 1BDDA 1SQXD 1S2EA 4W7YA 3CC4P 1KILE 2C2VS 1RF1B 5KLIC 3EQ2A 4C7RA 4LJNA 3CCLP 2LDRA 3WUTA 3A0BE 2OYIA 1NTKG 1OW8A 3R4YA 1A02F 3TGUJ 1ZRTE 2CRRA 2Q5UA 1AQTA 1NYHA 3N9MA 1RF1A 1Z60A 2KWJA 1VQLP 2RMZA 3L72G 5GTHH 4QF2A 1VQOP 2QJ0A 3IFMA 2C9NY 2J58A 4AUWA 4LLBA 2KI7B 4N3WA 1MV8A 4YBMA 1WEUA 3AE9C 3LDYA 3L75E 1K05A 4WY4B 3P8MC 3BCCJ 1BGYJ 2ZFCA 2K88A 4DJGA 4O62A 5KLVJ 5LKTA 4OGCA 3FXEA 3GHGB 4DOJA 1CSBA 3V5BA 2L7PA 3MP7B 1RF0C 1T6AA 1SQPD 2FXPA 3C9IA 2QSIA 4PJ0H 3EWKA 3V2PA 3H1KD 1WIMA 2K4DA 2WQYC 4L58A 1K8AQ 1VYXA 3GHGA 3PRJA 1WRGA 2ZETC 1KB9H 4XI1A 5C11A 4A4BA 3L73E 1CW5A 5I3LA 3UIAA 1S5LX 3L1XA 2YUCA 5L8RJ 2QRXA 2N1TB 1YJNP 1Y9BA 5H1VA 1GTWA 4KJMA 1MFZA 1K73Q 1T3UA 1WESA 4B86C 3CX5D 2KSJA 3TGUE 2W6BA 2G6QA 3H1JD 2YKOA 2N1TA 2E75D 3H1LD 1SQBK 1YTZT 3ZPVE 2RN0A 2VPEA 3B5NB 2AEMA 1JM0A 3RK2B 4GOEA 3AE1C 1BGYE 1L0LG 5KTBA 2OWAA 1LT9C 3HCSA 3LQHA 1JTHB 5KJ7D 2IYOA 3B8EB 1L0LD 3B5NA 3CMEP 4O64A 2ECWA 4D6TE 2JP3A 1ZR2A 1PFIA 3RPGC 3AECC 2DSMA 1EXJA 4Z0RA 1K04A 2IZ0A 1FU1A 1KN7A 4QQ4A 1JTHA 1RE3C 2AXTE 5APYA 1LTTC 2KU3A 4A49A 1M56D 2L75A 3JCUE 2MNZA 1H8AA 1NU1E 2E6RA 3RL0D 3M06A 1IYMA 4I7CA 3L70J 2DW3A 5KKZC 1V87A 2MIQA 3M91A 2QA4P 4P5OB 2YHOA 3O7AA 5SVIB 3GW6A 5KAFE 2L91A 5CJ4A 2R5BA 2IDAA 1PV3A 3SWKA 3AE6C 4GOFA 3RGUA 2Q6QA 3OW2O 1PP9E 2HPCA 3MHVA 1MFTA 4I7ZC 1HGZA 3AEBC 2O01J 3PLNA 3L35A 2WTYA 5CCHD 5SVIA 5TRBA 1DD3A 1NU1K 2W8ZA 1G1IA 3H1IE 1KILD 5DJUB 1HGVA 3LRQA 4WZ0A 4B86A 5E79H 2EGPA 3CCJP 2W6JH 2YO3A 2FXMA 4WVZA 3CCVP 2I50A 4I1LA 3HD7D 4N78D 1NJIQ 4IL6H 1LT9B 3KDPB 4LC1A 1FZGA 1KMIZ 1R5LA 4OGQB 1VDFA 3L75G 4FO9A 4V3KC 5AVSB 1LT9A 1RE4A 3II6A 1DCQA 2FYNC 5FB1A 1GL2D 3U1AA 3WMM0 1WENA 2ECNA 2XZRA 1LTJC 2MKEA 4TKPB 1KYOI 3KNVA 3FL2A 2M3EA 3L74J 2YNYA 4KT0J 2FFWA 4NPDA 5KKZB 2FSAA 1RE3A 1NOHA 1HBWA 2NAAA 2LXCB 2ZT9D 1SQBD 4BWNA 3NTNA 5EYAF 1KQFB 1J1DB 2GUVA 2XU6A 1N73C 1WE9A 3L73D 2M13A 2E75C 1EDLA 1VQKP 2LRIC 2O01N 5AW3B 4YABA 3TGUG 4UP0A 2KNCA 1WMKA 1CI6B 4GNDA 1GDTA 1JB0J 1YTZI 4PD4E 4DZOA 2OTLP 4IFFA 4DT0A 2FXOA 3ZDMA 2CT2A 5K3QA 3OA7A 5KJ7C 4HJGH 1DX7A 1BE3J 3KYQA 1AFOA 1FDOA 2Z4EA 2JMJA 4BBQA 4F52B 3BCCG 1BGYG 3M0DA 3VOPA 1CI6A 2EODA 2AN6A 4D6TG
chains in the Genus database with same CATH topology
3MUDA 1X9VA 2MT5A 1J2JB 2P2UA 3NXSA 1H89A 1LTGC 1LTAC 3N9NA 4FIPA 2H8PD 2J59M 5LKUA 1JY2N 2ECIA 1J1EC 2FUUA 1RF1C 4UP5A 3U5NA 1SVFA 5AIUA 3L4FA 3LW5H 2I1KA 5AVYB 3RL0C 2MD7B 5APUA 4YATA 2PAJA 3KQIA 4KHXA 2HDPA 1LTJB 1FAVA 1URQB 2D8SA 2LXPC 4N6JA 5AVUB 3PUQA 2VNFA 4UI9B 3VP8A 1FZAA 4Y99B 1EQ7A 2HFED 1Z6UA 5B77A 2XKMA 2FKWB 1G25A 3QZVA 2VPGA 1IFIA 2F6NA 1DVPA 2E42A 1FOSF 1JO5A 2ECGA 4WY4A 4W7ZA 1LTSC 3O37A 4C9ZA 2LGLA 2M1RA 2MNYA 3P8CD 1LTBC 4Q6FA 4GB0A 2W27A 2Z5IA 1FP0A 1Z56A 1WEMA 5G05B 4I2LC 5APVA 2Y43A 1JUNA 1IFDA 3LQJA 1M7LA 4S3OC 1LTJA 2UZGA 1URQA 1URQD 4PTBA 3KPEA 3RPGB 3RTRB 1JY2O 5AW6B 1WILA 3MD0A 1N2DC 1N7SA 1T3JA 2VPDA 3A5TA 1WT6A 5FERA 2KREA 5KH7A 2WZ7A 3R2PA 3L1ZB 4MVTA 2YSMA 5CCHC 1VD4A 2FYUK 1NWQA 4WZ2A 1VFYA 4JF7A 2WT7A 1WEQA 1T1HA 3O34A 4JYCA 3PHDA 5KH9A 2R3CA 3VMZA 5H1TA 1HVVA 2F6JA 3SOUA 1FJKA 4I7DA 2CPSA 1HTLC 2KWOA 2YU4A 4FJCA 3HD7C 4YBTA 1IFJA 1JY3P 1L0LK 1YYCA 4GNEA 2LN0A 2M3BA 5CCGD 3KV5A 5LKZA 1WEVA 4LKAA 4V3LC 2ECVA 4AP4A 2CSZA 3HE5B 1T2KD 2H43A 1SFCB 3L37A 1X79B 1LTIC 1ZV8A 3E1IA 4W80A 1BORA 2BAYA 2VPBA 5D1KB 2FFDC 2KR4A 3G3ZA 1K2FA 5APSA 1N7LA 1ZN5A 5AW5B 2QM8A 1XTGB 3IHPA 3SOXA 2YSJA 2KYVA 2XV5A 5TDRA 2K16A 3VMYA 1ZBDB 2OYIB 4YAXA 3A3YB 2WPQA 3LIDA 3HTKC 2N1TC 2O01H 1OWAA 1RE4C 2KLVA 4LADB 2L5UA 1GK4A 5H9MA 4XE5B 5BU5A 5AVZB 1NTKK 2P1JA 3HE5A 4W7YA 1SFCD 1SFCA 3SWYA 1NH4A 2C2VS 3TSIA 1RF1B 1IJDB 4N4FA 1NTMK 1WEWA 3EQ2A 4O9BA 4GNFA 5B8DA 4C7RA 2ZXEB 4LJNA 2KWNA 2LDRA 5LCWB 4YBSA 3GL6A 3MGNA 2OYIA 2HYED 2RSDA 1JY2P 2OYHB 2KWKA 2VJFB 1LWUC 1A02F 2CSYA 1JCCA 2JMDA 2Q5UA 5TABA 3N9MA 1RF1A 1Z60A 3T97A 2KWJA 3HUSB 3N4XA 4IC3A 2YURA 4A4CA 1Z2QA 1HYIA 1WEEA 4QF2A 2KFTA 2QJ0A 3IFMA 2K17A 2KYUA 2C9NY 5DKAA 1N86A 1WEOA 2J58A 3H6PA 4AUWA 4LLBA 2OYHA 4N3WA 1MV8A 1NO4A 5AVTB 1IFNA 3BATA 2VJFA 4YBMA 5AW9B 1WEUA 1MZ9A 1NTZK 5TBNA 4WY4B 3OAKA 3P8MC 1HUCA 1S9KD 1HYJA 2CPBA 2ZFCA 3HUSA 3V2NA 3ZYQA 3CL3D 1J1DC 3N9PA 1FDMA 3ASLA 5LKTA 1JM7B 3PP5A 3GHGB 4DOJA 4FK5A 3VK6A 1CSBA 2P67A 3V5BA 3ZPV1 2R5DA 2WSCH 1N7SB 3BVHA 2CKLB 1RF0C 3U59A 2M3HA 1GZLA 1JOCA 3N9LA 3C9IA 5AW0B 1NKZB 3A2AA 3T7LA 1M1JB 3HCUA 4WY4D 2VP7A 1IK9A 3M0DC 1X4IA 3V2PA 5APQA 5AW8B 2WT7B 5AVRB 1WIMA 3NG2A 2K4DA 3BRTB 1KFMA 3O70A 2GUSA 4L58A 2PUYA 1JM7A 5CMZA 3GHGA 1VYXA 2ECJA 1WRGA 2ZETC 4QF3A 4XI1A 5C11A 1WFKA 2CKLA 4A4BA 1N7SD 2A45H 2WWWA 1N73B 2L80A 1CW5A 5I3LA 5APTA 3UIAA 1GU4A 1MM3A 3L1XA 2YUCA 1G1JA 1M1JA 2N1TB 4MSXA 5H1VA 4RESB 1GTWA 1KILC 5B79A 1MFZA 4N3YB 1GK6A 2YMYA 2L43A 5AITA 1T3UA 2L5GB 5BU8B 1GW3A 1FZBA 1WESA 4B86C 2G43A 2FFDA 5H1UA 2HYNA 2NPSB 2XB1A 2KSJA 2G6QA 2W6BA 2XEUA 4PPEA 5JG6A 3VYIA 3RK3C 1N73A 3M9BA 2YREA 2Q7CA 4YC9A 2JEEA 2YKOA 2YKPA 3BASA 4ZUXU 2N1TA 2N1TD 2OARA 3BRVB 1SQBK 1AQ5A 1YTZT 4C46A 5D1MB 3ZPVE 1FBMA 2VPEA 2KOGA 2QIZA 5B75A 3B5NB 5APXA 3U5PA 3VTPC 2VJEB 2F42A 3RK2B 2FYZA 2KIZA 2VRSA 1GD2E 1FOSE 2YW8A 1T8ZA 5AW7B 1URQC 2NPSA 2NPSD 2LKMA 1L4AB 3HE4B 2LQ6A 2L0BA 4EOTA 4Y99C 1MUUA 5KTBA 4NN2A 2MD8C 1KQLA 1WGMA 2HLOA 5DINA 1FZCC 1GW4A 1ZLLA 2O1JA 2G45A 5CJ0A 4WZ3B 1LT9C 1A02J 4HYTB 3HCSA 1FZFA 3LQHA 1JTHB 5KJ7D 4AQRD 5KJ7A 3B8EB 4R2YA 1GL2C 2YKQA 3B5ND 3B5NA 2N9BA 3MHSA 4O64A 5TDWA 1NAFA 2VJEA 2ECWA 2LGGA 3RK2D 1S9KE 1VPCA 5FB0A 1J1EB 2Y1NA 4GKGA 1ZR2A 3V2RA 1PFIA 1L4AA 1L4AD 3HE4A 3RL0B 3I5CA 3RPGC 3V4QA 2BASA 3LIEA 5AVXB 3V2QA 3ZNIA 1FU1A 1RY3A 5D1LB 5AW4B 5J3XA 1JTHA 1RE3C 5APYA 3CI9A 3VN0A 5CCGC 1LTTC 3IR9A 1NKNA 2KU3A 2Q3IA 1U6GB 4A49A 2XNXA 1SLQA 4HH2A 3VMXA 2H7HA 1T2KC 2L75A 3P8CE 2MNZA 1H8AA 2E6RA 3RL0D 3M06A 1IYMA 4S3OB 4I7CA 4ZKUA 3TK1A 1V87A 2MIQA 3M91A 2IX7C 2MA6A 1X8YA 3DQVR 4I6MC 3O8ZA 3MHHA 2QM7A 4P5OB 3U5MA 2I1JA 2YHOA 4IC2A 4LK9A 3A7OA 1LDJB 3HCTA 5C13A 3TNUB 1LGHB 3O7AA 1KILB 4WB4A 5CJ4A 2R5BA 1X4JA 2IDAA 2IFNA 4CCGX 4M3LA 2JMIA 2LGVA 3V4WA 2HPCA 3L36A 2OYIC 3O36A 4W4UA 1HGZA 3RK3B 3TYYA 3VP9A 2K1JA 2R32A 2IPPA 2YYRA 4AVXA 2C0WA 2QICA 3HD7B 3L35A 2PNXA 3M62A 4AUQB 2WITA 4A0CD 2Q9IA 3TNUA 3N9QA 2WTYA 5CCHA 5CCHD 5TRBA 1NU1K 1G1IA 3MIWA 1KILD 1KILA 1E5WA 4IFDK 1HGVA 3LRQA 4WZ0A 5G04B 2YO2A 2WSFH 4B86A 3DPLR 3N7NA 4XA4A 3M9HA 3U1CA 2EGPA 1SQVK 2FFDB 4ZQLA 3L11A 2POHA 2YO3A 5AW2B 4X3GA 3RK3D 1W2EA 2C2LA 2M6MA 4I7BA 2FXMA 1G2CB 1XWHA 2OYHC 2KP8A 3M0AA 2I50A 2YQMA 4I1LA 2WPRA 3HD7A 3HD7D 1CHCA 1FZCB 4N78D 3SOWA 3HTKB 1LT9B 3KDPB 3M63A 3OJAB 3CLQA 2KGGA 4LC1A 1FZGA 2A45I 2C9LY 1GL2B 3HUSC 2H0DB 4AYCB 2W6AA 3C5KA 1JNMA 5AVVB 1IO4A 1VDFA 3C6WA 3H32B 1QL2A 4LLHA 3HRNA 2E43A 4FO9A 4L7XA 3SHBA 3M9QA 1G2CA 4ZDTA 3GV4A 1FZCA 5AVSB 4V3KC 5AW1B 3HTKA 1LT9A 1RE4A 3II6A 5CHXA 3N9OA 2GM4A 1N87A 3KV6A 4WY4C 2LGKA 5FB1A 1QL1A 1LWUB 4LGDE 1GL2D 1GL2A 1SQQK 3P7KA 4AYCA 3U1AA 3WMM0 2FUIA 2H0DA 3U5OA 3ZVZB 1WENA 1GU5A 2DX8A 2ECNA 1XTCC 2XZRA 3ZVYA 3H32A 1KFNA 1LTJC 2KB7P 1MM2A 3O33A 5B76A 5B78A 2JJLA 3GHGC 4TKPB 1SP4A 3KNVA 3LQIA 3FL2A 1IC2A 1N7SC 2YNYA 2IFMA 2A45G 2M8RA 1WEPA 3I2DA 1E4UA 4R8PK 4GIFA 2FSAA 2OXQC 1SQXK 1L0NK 2KGIA 1M1JC 1RE3A 4WBAA 2E6SA 2LXHC 1LWUA 5CCGA 3KQGA 1NOHA 1HWTC 1HBWA 1DH3A 2JRJA 2NAAA 2YQLA 5G0FA 2HG5D 4C7NB 1H88A 1KZUB 4OH8B 5APWA 2EA6A 3NTNA 2O1KA 4BHWA 2Z5HA 1CZQA 5EYAF 1FBVA 1J1DB 2GUVA 3EFGA 2XU6A 4EIJA 4GNGA 4WA6A 1N73C 1WE9A 3ZTGA 2WSEH 2MJZA 5KH3A 3NFQA 3T6RA 1LDKC 4GT1A 4JYBA 4IFMA 2LRIC 4C7NA 5LKXA 5AW3B 2PP6A 3PURA 4YABA 2HODB 1JY3N 4ZKPA 4CA1A 2XDJA 4UP0A 5AVWB 1CI6B 2NPSC 1IFMA 2ECTA 2RI7A 4GNDA 1GDTA 5FEYA 1NHLA 2WPSA 3O35A 1YTZI 2YT5A 3EB5A 4DZOA 5KLVK 2HPCB 1FJPA 2MUMA 4IFFA 2C0XA 1OXZA 1RF0A 2CT2A 3P32A 1HJBA 2Y1MA 3OA7A 5KJ7C 1RMDA 3NMDA 4N78E 1DX7A 3EB6A 3KYQA 2JMJA 1AFOA 3B5NC 2Z4EA 4BBQA 2HODA 1JCDA 3MTUE 1HH0A 1SFCC 4F52B 3RK2C 4R7EA 4YADA 2LV9A 3M0DA 2M85A 1DEBA 3VOPA 1CI6A 2P7JA 1L4AC 2MA5A 2KE1A 1F62A 4B7YC 1JMMA 3V43A 3SWFA 1X4UA 2YHNA 3M99A 1JY3O 1SQPK 5BVZA 2EODA 2AN6A 1FZEA 1ZR4A 5AVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MT5 A;  4FIP A;  3N9N A;  5LKU A;  2ECI A;  2FUU A;  4UP5 A;  3U5N A;  5AIU A;  3L4F A;  2MD7 B;  4YAT A;  3KQI A;  2HDP A;  2LXP C;  2D8S A;  3PUQ A;  2VNF A;  4UI9 B;  1Z6U A;  5B77 A;  1G25 A;  3QZV A;  2VPG A;  2F6N A;  1DVP A;  2ECG A;  3O37 A;  4C9Z A;  2LGL A;  2M1R A;  2MNY A;  4Q6F A;  4GB0 A;  1FP0 A;  1WEM A;  5G05 B;  2Y43 A;  3LQJ A;  4S3O C;  2UZG A;  4PTB A;  3RPG B;  3RTR B;  1WIL A;  2VPD A;  5FER A;  2KRE A;  5KH7 A;  3L1Z B;  4MVT A;  2YSM A;  1VD4 A;  1VFY A;  1WEQ A;  1T1H A;  3O34 A;  3PHD A;  5KH9 A;  5H1T A;  2F6J A;  3SOU A;  4I7D A;  4FJC A;  2KWO A;  2YU4 A;  4YBT A;  4GNE A;  2LN0 A;  3KV5 A;  5LKZ A;  1WEV A;  4LKA A;  4V3L C;  2ECV A;  4AP4 A;  2CSZ A;  4WZ2 A;  5D1K B;  2VPB A;  1BOR A;  2BAY A;  2KR4 A;  1K2F A;  3IHP A;  3SOX A;  2YSJ A;  5TDR A;  2K16 A;  1ZBD B;  4YAX A;  3HTK C;  4LAD B;  2L5U A;  5H9M A;  2C2V S;  4N4F A;  1WEW A;  3EQ2 A;  4GNF A;  5B8D A;  4LJN A;  2KWN A;  2LDR A;  5LCW B;  4YBS A;  3GL6 A;  2HYE D;  2RSD A;  2KWK A;  2VJF B;  2CSY A;  2JMD A;  5TAB A;  3N9M A;  2KWJ A;  1Z60 A;  4IC3 A;  2YUR A;  4A4C A;  1Z2Q A;  1HYI A;  1WEE A;  4QF2 A;  2KFT A;  2QJ0 A;  2K17 A;  2KYU A;  5DKA A;  1WEO A;  4LLB A;  4N3W A;  4YBM A;  2VJF A;  1WEU A;  5TBN A;  1HYJ A;  3ZYQ A;  3CL3 D;  3N9P A;  3ASL A;  5LKT A;  1JM7 B;  4FK5 A;  3VK6 A;  3ZPV 1;  2CKL B;  2M3H A;  1JOC A;  3N9L A;  3T7L A;  3HCU A;  2VP7 A;  1X4I A;  1WIM A;  3NG2 A;  2K4D A;  3BRT B;  3O70 A;  4L58 A;  2PUY A;  1JM7 A;  1VYX A;  4QF3 A;  2ECJ A;  2ZET C;  5C11 A;  4XI1 A;  1WFK A;  2CKL A;  4A4B A;  2L80 A;  5I3L A;  1MM3 A;  3L1X A;  2YUC A;  4MSX A;  5H1V A;  5B79 A;  2L43 A;  5AIT A;  1WES A;  4B86 C;  2G43 A;  5H1U A;  2XB1 A;  2G6Q A;  2W6B A;  2XEU A;  5JG6 A;  2YRE A;  2YKO A;  2YKP A;  4ZUX U;  3BRV B;  3ZPV E;  5D1M B;  2VPE A;  2QIZ A;  5B75 A;  3U5P A;  2VJE B;  2F42 A;  2KIZ A;  2YW8 A;  2LQ6 A;  2L0B A;  4NN2 A;  2MD8 C;  1WGM A;  5DIN A;  2G45 A;  4WZ3 B;  3HCS A;  3LQH A;  4R2Y A;  2YKQ A;  3MHS A;  5TDW A;  4O64 A;  2VJE A;  2ECW A;  2LGG A;  5FB0 A;  2Y1N A;  3RPG C;  3ZNI A;  5D1L B;  5J3X A;  2KU3 A;  4A49 A;  1U6G B;  2L75 A;  2MNZ A;  2E6R A;  1IYM A;  4S3O B;  4I7C A;  1V87 A;  2MIQ A;  2MA6 A;  3DQV R;  4P5O B;  3MHH A;  3U5M A;  2YHO A;  4IC2 A;  4LK9 A;  1LDJ B;  3HCT A;  5C13 A;  3O7A A;  2IDA A;  1X4J A;  4CCG X;  2JMI A;  2LGV A;  3O36 A;  4W4U A;  2K1J A;  2YYR A;  4AVX A;  4AUQ B;  2QIC A;  2PNX A;  3M62 A;  4A0C D;  3N9Q A;  5TRB A;  3LRQ A;  4WZ0 A;  5G04 B;  3DPL R;  2EGP A;  4ZQL A;  3L11 A;  4X3G A;  2C2L A;  2M6M A;  4I7B A;  1XWH A;  2I50 A;  2YQM A;  1CHC A;  3SOW A;  3M63 A;  2KGG A;  4AYC B;  2H0D B;  3C5K A;  3C6W A;  4FO9 A;  4L7X A;  3SHB A;  4ZDT A;  3GV4 A;  4V3K C;  3N9O A;  1N87 A;  3KV6 A;  2LGK A;  5FB1 A;  4YC9 A;  4AYC A;  2H0D A;  3U5O A;  2FUI A;  3ZVZ B;  1WEN A;  2DX8 A;  2ECN A;  3ZVY A;  3O33 A;  1MM2 A;  5B76 A;  5B78 A;  4TKP B;  3LQI A;  3KNV A;  3FL2 A;  3I2D A;  1WEP A;  1E4U A;  4R8P K;  2FSA A;  2OXQ C;  2KGI A;  2E6S A;  2LXH C;  2JRJ A;  2YQL A;  5G0F A;  2NAA A;  2EA6 A;  4BHW A;  5EYA F;  1FBV A;  4GNG A;  4WA6 A;  1WE9 A;  3ZTG A;  5KH3 A;  3T6R A;  1LDK C;  2LRI C;  5LKX A;  3PUR A;  4YAB A;  4CA1 A;  4UP0 A;  2RI7 A;  2ECT A;  4GND A;  5FEY A;  3O35 A;  2YT5 A;  3EB5 A;  2MUM A;  2CT2 A;  2Y1M A;  1RMD A;  3EB6 A;  2JMJ A;  4BBQ A;  4F52 B;  4YAD A;  4R7E A;  2LV9 A;  2M85 A;  2MA5 A;  2KE1 A;  1F62 A;  4B7Y C;  3V43 A;  1X4U A;  2YHN A;  3M99 A;  2EOD A;  2AN6 A;  4PPE A; 
#chains in the Genus database with same CATH topology
 1AVY A;  3Q5P A;  4L75 A;  1J2J B;  1LTG C;  2RR4 A;  3L74 E;  4D6T D;  2FUU A;  3U5N A;  2FYU E;  4YAT A;  3RL0 C;  3LVR E;  2PAJ A;  3KQI A;  1LTJ B;  4N6J A;  2VNF A;  3PLW A;  1ZOY C;  4Y99 B;  1BCC J;  2FKW B;  1NU1 G;  4H13 B;  2E42 A;  2ECG A;  4C9Z A;  3IN6 A;  1LTB C;  1RHZ B;  2JR8 A;  1FP0 A;  4GB0 A;  5G05 B;  1NU1 D;  4I2L C;  3LQJ A;  1LTJ A;  3CCR P;  3KPE A;  1NGM B;  2EGM A;  5AW6 B;  1N2D C;  1WT6 A;  2ZYD A;  2KRE A;  2XND H;  2E75 B;  5CCH C;  1VD4 A;  2FYU K;  2A06 E;  4A7P A;  2WT7 A;  2QJY C;  1T1H A;  1YJW P;  5B5E H;  4UB8 E;  1USE A;  1PP9 D;  3SOU A;  1FJK A;  3H1I G;  4H0L B;  2KWO A;  3HD7 C;  1JY3 P;  2QG4 A;  2M3B A;  3KV5 A;  3LVQ E;  3H1I D;  2YXQ B;  3L37 A;  1X79 B;  1ZV8 A;  2VPB A;  3GLM A;  2FFD C;  3G3Z A;  1K2F A;  1N7L A;  2D2C D;  1ZN5 A;  3FEH A;  1XTG B;  2YMK A;  3SOX A;  2YSJ A;  1QVG O;  2XV5 A;  4ZNC A;  2K16 A;  4U3F J;  4YAX A;  3A3Y B;  4BXL A;  3HTK C;  2KLV A;  2L5U A;  5BU5 A;  1NTK K;  2P1J A;  1AA0 A;  1SFC D;  3SWY A;  1BCC E;  1RQU A;  3TSI A;  3T97 B;  5CBO A;  4N4F A;  1U7M A;  1P84 E;  1IZN B;  5B8D A;  4UB6 H;  3MGN A;  3RK3 E;  4YTP C;  3B71 A;  3TDK A;  1JY2 P;  2OYH B;  2KWK A;  2EXU A;  1Q81 Q;  2ZT9 C;  1JEK A;  1VQM P;  3S4R A;  5TAB A;  2P57 A;  3A0B H;  1MKM A;  2KZI A;  3T97 A;  4OGE A;  4IC3 A;  2YUR A;  4A4C A;  2G8Y A;  1M57 D;  1UII A;  2KFT A;  5DKA A;  3I56 P;  2ZAE B;  4PV1 D;  1WEO A;  1YBK A;  2OYH A;  3W67 A;  2K9J B;  2V7Q J;  1MZ9 A;  5KAI H;  2E74 D;  5TBN A;  1HUC A;  1HYJ A;  4K3A A;  4EDF A;  1HJ0 A;  1JM7 B;  3CXH E;  2WSE J;  3ZPV 1;  2R5D A;  3AE7 C;  1PL5 A;  2M3H A;  2QEX P;  5C39 A;  1M1J B;  4U3F E;  1Y8A A;  1IK9 A;  5APQ A;  5AW8 B;  2B9B A;  1KFM A;  1NVO A;  2GUS A;  1JM7 A;  5CMZ A;  4QF3 A;  1N7S D;  1VQ8 P;  2L80 A;  1M1J A;  4MSX A;  4RES B;  2UWJ E;  2FFD A;  2HYN A;  2NPS B;  2I8D A;  5JG6 A;  4H44 C;  4OVN F;  3VYI A;  3L74 G;  3KHU A;  2YRE A;  2YKP A;  2FYU G;  2M0B A;  3BAS A;  3O47 A;  3CC2 P;  1AQ5 A;  4C46 A;  1KYO H;  2QIZ A;  2FYU D;  1OMI A;  2F42 A;  2KIZ A;  3Q1D A;  1FOS E;  2YW8 A;  1T8Z A;  2NPS A;  2LKM A;  1L4A B;  3HE4 B;  4EOT A;  1EXI A;  4NN2 A;  2YIU C;  2MD8 C;  1VF5 B;  1EDJ A;  3Q5R A;  4WZ3 B;  1A02 J;  2FY8 A;  3MHS A;  1MBM A;  1NAF A;  1OX3 A;  2LGG A;  1S9K E;  1VPC A;  4F1P A;  3K5B A;  1L4A A;  3HE4 A;  3I5C A;  3LIE A;  3AE8 C;  1L0N J;  5D1L B;  3SUB A;  2A06 G;  5AW4 B;  3D70 A;  5J3X A;  1X0T A;  3CI9 A;  2Q3I A;  2BCC J;  1EDK A;  2A06 D;  4NPE A;  1NTK D;  2E76 D;  3AE2 C;  2D2C C;  2ZYG A;  4ZKU A;  2IX7 C;  3L72 D;  1X8Y A;  4L73 A;  3B4S A;  3JCU H;  3L71 J;  1TU3 F;  5GTI E;  2KZJ A;  3E1R A;  1LGH B;  1D7M A;  1X4J A;  3CX5 I;  4XFJ A;  4YXD C;  3L36 A;  3DDT A;  4H44 B;  1S5L H;  3TYY A;  2K1J A;  4L74 A;  1BCC G;  2YYR A;  2QJP B;  2QIC A;  1QX8 A;  3PJS K;  4IFD K;  3CWB E;  2YO2 A;  3DPL R;  4XA4 A;  1QGK B;  3U1C A;  4PV1 C;  4YXW H;  5AW2 B;  4X3G A;  3RK3 D;  1W2E A;  1G2C B;  1XWH A;  1NTZ J;  2YQM A;  4ZMD A;  2E74 C;  3D6Z A;  1L0N E;  3M63 A;  2A45 I;  3HUS C;  3C5K A;  5AVV B;  2P58 A;  5DJT B;  3H32 B;  2BCC E;  2KUB A;  1QL2 A;  4LLH A;  5KLI B;  3M9Q A;  1G2C A;  1BSN A;  3SSU A;  5AW1 B;  5CHX A;  1N87 A;  1LP1 A;  3U5O A;  3ZVZ B;  3L71 E;  2DX8 A;  1BSH A;  3ZVY A;  3H32 A;  1KFN A;  4Z0O A;  3F5H A;  5B76 A;  5B78 A;  1N7S C;  3BCC E;  2A45 G;  1WEP A;  4U3F G;  4R8P K;  4GIF A;  2OXQ C;  5KLV E;  1L0N K;  3USS A;  5B66 E;  1PGP A;  1PGQ A;  1H88 A;  3IF4 A;  4OH8 B;  2EA6 A;  3WU2 H;  1CZQ A;  1OIP A;  4EIJ A;  1PGJ A;  1R5S A;  4WA6 A;  4MN4 C;  2WVR A;  5KH3 A;  3NFQ A;  1M90 Q;  1SS1 A;  4IFM A;  3PUR A;  3S9O A;  3V6I A;  1JY3 N;  1NTZ E;  5AVW B;  1EZV E;  2YT5 A;  2YXR B;  5KLV K;  2HPC B;  2C0X A;  1RF0 A;  5GTH E;  3P32 A;  5TIS H;  3NMD A;  1YHQ P;  1RH5 B;  3H1H J;  5SVX A;  4YAD A;  2QIW A;  2MA5 A;  1KC8 Q;  2KE1 A;  1F62 A;  1U57 A;  1JMM A;  3SWF A;  3M99 A;  5BVZ A;  1FZE A;  5K5G B;  1L2P A;  1IFP A;  1H89 A;  4FIP A;  1JY2 N;  3CCQ P;  1J1E C;  2E76 C;  1S4X A;  2I1K A;  5AVY B;  3E2D A;  2E5T A;  2D8S A;  1NAY A;  4PJ0 E;  3PUQ A;  2OTJ P;  3VP8 A;  2IBZ E;  2HFE D;  5B77 A;  1G25 A;  1KB9 E;  1ZRT D;  2LGL A;  3D71 A;  3Q5S A;  2W27 A;  1Z56 A;  2N9Y B;  3AE3 C;  5APV A;  4EI2 A;  1IFD A;  3JUE A;  4S3O C;  2RKL A;  4R4L A;  1URQ D;  2UZG A;  4PTB A;  3RPG B;  3PTZ A;  1N7S A;  1T3J A;  3A5T A;  5FER A;  5H2F H;  5KH7 A;  2WZ7 A;  3L1Z B;  4MVT A;  3L75 D;  3L70 E;  1NWQ A;  4JF7 A;  1SQV J;  1WEQ A;  3VMA A;  4JYC A;  3VMZ A;  3H1H E;  2JWD A;  1HVV A;  1LT1 A;  4I7D A;  2CPS A;  1HTL C;  2YU4 A;  4FJC A;  4YBT A;  1YYC A;  3CWB G;  4R4M A;  2KIK A;  5CCG D;  2ECV A;  2CSZ A;  3HE5 B;  2H43 A;  2Y0D A;  2KNC B;  3FXD A;  4W80 A;  3CWB D;  2KR4 A;  1OW7 A;  5AW5 B;  2GA1 A;  1KTM A;  1L0N G;  3IHP A;  5TDR A;  2M5A A;  3VMY A;  1ZBD B;  3LID A;  4I7Z B;  1SQQ J;  4LAD B;  1GK4 A;  5H9M A;  1OZH A;  4XE5 B;  5AVZ B;  1Y47 A;  2BCC G;  2H89 C;  3HE5 A;  2W90 A;  3GMA A;  2QJK C;  2XOY A;  4YPC A;  4O9B A;  3TGU D;  1SQX J;  3GL6 A;  2RSD A;  3L71 G;  1LWU C;  2CSY A;  1JCC A;  3SFE C;  1FC2 C;  3N4X A;  1Z2Q A;  5KLV G;  1WEE A;  3KZI H;  2K17 A;  2KYU A;  3BCC D;  1BGY D;  1N86 A;  3SFD C;  3H6P A;  4HKZ H;  5KLV D;  1NO4 A;  3CX5 H;  2KS1 A;  2FYN B;  3FGA D;  3OAK A;  2AEF A;  2CPB A;  3ZYQ A;  1FDM A;  3PP5 A;  3VK6 A;  2P67 A;  2WSC H;  2CKL B;  3BVH A;  3CCU P;  1NTZ G;  3U59 A;  5E79 E;  1JOC A;  3N9L A;  1EZV G;  5AW0 B;  1NKZ B;  3A2A A;  3CCM P;  5TJH A;  1PZQ A;  3HCU A;  4WY4 D;  2VP7 A;  3MDB C;  3FJU B;  2WT7 B;  3BRT B;  3O70 A;  1SQP J;  4IL6 E;  1S3J A;  2PUY A;  2ECJ A;  2CKL A;  2A45 H;  2WWW A;  1N73 B;  2ZJS E;  2QVA A;  5APT A;  1G1J A;  3H1K J;  1FDI A;  2RH0 A;  2XOC A;  1SQX E;  1KIL C;  3G6E P;  2YMY A;  3FWL A;  2G43 A;  1BE3 E;  5H1U A;  2XB1 A;  2XEU A;  1N73 A;  4L76 A;  4U7J A;  2Q7C A;  1VQ5 P;  2N1T D;  3BRV B;  2OAR A;  2B0O E;  5D1M B;  3AE4 C;  3A0H H;  5APX A;  2ZVN B;  2MKV A;  3H1J J;  3VTP C;  2VJE B;  2FYZ A;  2VRS A;  2IBZ G;  3FM8 C;  1URQ C;  2LQ6 A;  3QH9 A;  3H1L J;  1KD1 Q;  2Q3E A;  1KQL A;  2IBZ D;  5DIN A;  1FZC C;  2O1J A;  5CJ0 A;  1FZF A;  5KJ7 A;  2O3J A;  1KB9 D;  5SVY A;  2PRR A;  1GL2 C;  3B5N D;  2D8U A;  3GG2 A;  4HB1 A;  2VJE A;  3RK2 D;  5FB0 A;  3V2R A;  2OYO A;  3RL0 B;  1R8E A;  1HF9 A;  1S1C X;  3L70 G;  2BAS A;  5AVX B;  3ZNI A;  3V2Q A;  1L0L J;  3JSV C;  5CCG C;  3L70 D;  3H1H G;  3IR9 A;  2NZ2 A;  1U6G B;  1SLQ A;  4HH2 A;  3VMX A;  2H7H A;  3P8C E;  3H1K E;  1YI2 P;  3M7K A;  2OTK E;  4GDO A;  3CPW O;  3CCS P;  4PD4 I;  4I6M C;  2G3A A;  2I1J A;  1AJY A;  4LK9 A;  3HCT A;  1Q90 D;  1ZME C;  1VQP P;  3TNU B;  3KXD A;  1H0T B;  1KIL B;  1OVU A;  2QJY B;  3TF5 A;  2LGV A;  3V4W A;  3H1J E;  2OYI C;  3O36 A;  3VP9 A;  2KKY A;  2R32 A;  2IPP A;  1Q2N A;  4AUQ B;  3HD7 B;  3M62 A;  3H1L E;  4RKU J;  4A0C D;  3EFF K;  1OVV A;  3TNU A;  3N9Q A;  1H0T A;  5CCH A;  3MIW A;  1KIL A;  1E5W A;  3E7K A;  2WSF H;  3FWN A;  3M9H A;  2FFD B;  1M8O B;  4PD4 D;  2KKX A;  2C2L A;  2H88 C;  2KP8 A;  3M0A A;  3MUD C;  1VQ7 P;  2WPR A;  3HD7 A;  1FZC B;  1KQS O;  3HTK B;  1KV4 A;  1E79 H;  3CLQ A;  2KGG A;  2C9L Y;  1GL2 B;  2R44 A;  3CCE P;  1SQV G;  3S1K A;  3C6W A;  2ZXX A;  3HRN A;  2E43 A;  3SHB A;  2JM3 A;  3GV4 A;  1FZC A;  5B5E E;  3HTK A;  3G9R A;  2GM4 A;  3KV6 A;  4WY4 C;  4NPF X;  3L74 D;  1QL1 A;  4LGD E;  1GL2 A;  3P7K A;  2ZT9 B;  4OGQ D;  2CSV A;  1GU5 A;  2KB7 P;  1MM2 A;  5CBN A;  3GHG C;  1SP4 A;  1S72 P;  1IC2 A;  2AEJ A;  2IFM A;  2M8R A;  3I2D A;  3FAO A;  2KGI A;  4ASW A;  2E6S A;  2ZVO B;  5CCG A;  3G71 P;  3KQG A;  2JRJ A;  2Y9Y A;  1DH3 A;  2HG5 D;  4C7N B;  2Z5H A;  1USD A;  2FD4 A;  1FBV A;  1PGO A;  2ITA A;  3EFG A;  1Q86 Q;  3H25 A;  1SQX G;  4TLF A;  3ZTG A;  1OW6 A;  1SQB J;  4GOD A;  1LDK C;  3H7H A;  1BE3 G;  4C7N A;  4UB6 E;  2HOD B;  4CA1 A;  3L73 J;  1BE3 D;  2ECT A;  2AXT H;  1P84 I;  3O6Q B;  1NHL A;  5FEY A;  2WPS A;  3O35 A;  2B88 A;  1FJP A;  2CK3 H;  1PPJ E;  1OXZ A;  2KLU A;  3AED C;  1VQ4 P;  2Y1M A;  1VQ6 P;  1RMD A;  4N78 E;  3B5N C;  2HOD A;  1JCD A;  3MTU E;  1HH0 A;  1NTM J;  1SFC C;  1W5C E;  3RK2 C;  3RBX A;  2JDI H;  1DEB A;  1VL2 A;  2P7J A;  3PHL A;  5KAI E;  3O6Q A;  2Y9Z A;  3AEF C;  1X4U A;  3ITK A;  1M1K Q;  1ZR4 A;  5AVQ B;  5KAF H;  2WMM A;  3MUD A;  1X9V A;  2MT5 A;  2P2U A;  3NXS A;  2K1A A;  1LTA C;  3N9N A;  2J5U A;  2H8P D;  2J59 M;  5LKU A;  2ECI A;  4UP5 A;  1BCC D;  3LW5 H;  2E5Y A;  5APU A;  1SQP G;  1P84 D;  1QEX A;  2HDP A;  2LXP C;  1QVF O;  2BEZ F;  4UI9 B;  3CXH I;  1EQ7 A;  2YIU B;  1ZXG A;  4D6T J;  3H1K G;  4WWI A;  1IFI A;  2F6N A;  1DVP A;  1JO5 A;  4WY4 A;  4W7Z A;  3O37 A;  1LP1 B;  1SQB E;  2M1R A;  3P8C D;  3D6Y A;  1WEM A;  2Y43 A;  1JUN A;  1M7L A;  3GF3 A;  1YIJ P;  3RTR B;  1WIL A;  2VPD A;  4H13 D;  1NU1 J;  2B89 A;  3H1J G;  1YIT P;  2R3S A;  1DIP A;  5KH9 A;  1EC5 A;  3WUV A;  1KYO E;  5H1T A;  2D2C B;  3H1L G;  1NTM E;  1IK7 A;  3CXH D;  2LXB A;  2E61 A;  1IFJ A;  4JQ0 D;  5LKZ A;  1WEV A;  4LKA A;  4V3L C;  1FS0 E;  4U3F D;  4BRY B;  1PP9 J;  1T2K D;  1SFC B;  5D1K B;  3LW5 J;  3W68 A;  2WSS H;  2QM8 A;  4EYY Q;  3F89 A;  4H0L D;  1PIX A;  3H1I J;  2O01 H;  1OWA A;  1RE4 C;  4BRY A;  4OGQ C;  1SFC A;  1NH4 A;  2IYP A;  1IJD B;  1NTM K;  1WEW A;  4GNF A;  2ZXE B;  2KWN A;  5LCW B;  4YBS A;  4PV1 B;  2HYE D;  2VJF B;  1VQ9 P;  2E74 B;  4Z1M H;  2JMD A;  4PD4 H;  2HR3 A;  3HUS B;  1AV1 A;  1HYI A;  1QLE D;  5AVT B;  1IFN A;  3BAT A;  2VJF A;  4JBZ A;  5AW9 B;  2JUN A;  1NTZ K;  1S5L E;  2ZYA A;  1S9K D;  1W2B O;  3V2N A;  3HUS A;  3CL3 D;  1J1D C;  3N9P A;  3ASL A;  2BEQ D;  4FK5 A;  1N7S B;  2DJA A;  1GZL A;  3T7L A;  3WUU A;  3QWO C;  3M0D C;  1GMJ A;  1X4I A;  1VQN P;  1PPJ G;  5AVR B;  3NG2 A;  1WFK A;  1PPJ D;  1BDC A;  1GU4 A;  1MM3 A;  2WPV B;  3Q1M A;  5B79 A;  3C1L A;  4N3Y B;  2QE7 H;  1GK6 A;  2L43 A;  5AIT A;  2L5G B;  3RBZ A;  5BU8 B;  1GW3 A;  1FZB A;  3MZW B;  3RK3 C;  3M9B A;  3FAN A;  1U7J A;  1AVO A;  2PFX A;  2P10 A;  2JEE A;  2M5A B;  4ZUX U;  2K9Y A;  3DWD A;  4IL6 X;  1FBM A;  4UB8 H;  1YQ3 C;  2B87 B;  2KOG A;  5B75 A;  3U5P A;  2IZ1 A;  3ABV C;  1GD2 E;  5AW7 B;  2XOZ A;  2NPS D;  3T9K A;  2L0B A;  4Y99 C;  1MUU A;  3WU2 E;  1SQB G;  1WGM A;  2HLO A;  1GW4 A;  1ZLL A;  4H13 C;  2G45 A;  4OWF A;  2FYU J;  4HYT B;  3I55 P;  4AQR D;  2B87 A;  1L0N D;  4R2Y A;  2YKQ A;  5TDW A;  2N9B A;  1DD4 A;  1Q7Y Q;  3L73 G;  3AEG C;  1J1E B;  2E76 B;  2Y1N A;  4GKG A;  2V4H A;  1L4A D;  2BCC D;  3V4Q A;  1FE6 A;  1VF5 D;  1RY3 A;  3LJU X;  3VN0 A;  1NKN A;  1P84 H;  2XNX A;  2KS1 B;  1NTM G;  1T2K C;  3L71 D;  5TIS E;  1EZV I;  1KYO D;  4S3O B;  1NTM D;  3GF7 A;  4H0L C;  3TK1 A;  1SQV E;  2MA6 A;  2K3R A;  3DQV R;  1NTK J;  2KXP B;  3O8Z A;  2QM7 A;  3MHH A;  3U5M A;  4IC2 A;  3A7O A;  1LDJ B;  5C13 A;  4WB4 A;  3L72 J;  2IFN A;  3JC2 2;  4CCG X;  4M3L A;  2JMI A;  4ASV A;  1ZW0 A;  4W4U A;  2XP0 A;  3RK3 B;  4AVX A;  2C0W A;  3AE5 C;  2PNX A;  2WIT A;  2OQQ A;  1N8R Q;  2Q9I A;  2KSE A;  3CXH H;  1NTZ D;  1SQQ E;  2W83 C;  5G04 B;  1EZV D;  3N7N A;  1SQV K;  4ZQL A;  3L11 A;  2POH A;  4H44 D;  2M6M A;  4I7B A;  2OYH C;  2IBZ I;  1CHC A;  3SOW A;  1KB9 I;  3OJA B;  2AXC A;  4AYC B;  2H0D B;  4QMA A;  2W6A A;  1JNM A;  1IO4 A;  5H2F E;  2QJK B;  1OFC X;  1DEE G;  1JMB A;  5M1B A;  4L7X A;  4ZDT A;  3N9O A;  2LGK A;  4YC9 A;  1LWU B;  1SQQ K;  4AYC A;  2H0D A;  2FUI A;  1PP9 G;  1NTK E;  1XTC C;  3O33 A;  2JJL A;  3LQI A;  3PH0 A;  2WSC J;  1E4U A;  3L72 E;  3IAO A;  1SQX K;  5EFW B;  3RL0 g;  1M1J C;  2V7Q H;  4WBA A;  2JKV A;  2LXH C;  1LWU A;  1HWT C;  2Q1K A;  2YQL A;  5G0F A;  4IOI H;  1KZU B;  2KK7 A;  5APW A;  2O1K A;  4BHW A;  2LR2 A;  2CRW A;  1X22 A;  4TT3 H;  4CPG A;  4GNG A;  3AEE C;  2WSE H;  2MJZ A;  2IQJ A;  3C8V A;  4RO0 A;  1YQ4 C;  1SQP E;  3T6R A;  4GT1 A;  4JYB A;  2PGD A;  4DCK A;  5LKX A;  2PP6 A;  1LJ2 A;  4ZKP A;  2XDJ A;  2YVR A;  2NPS C;  1IFM A;  2RI7 A;  3H1H D;  3CC7 P;  3EB5 A;  2MUM A;  4H9D A;  1HJB A;  4Y28 J;  3KZI E;  3EB6 A;  2NRG A;  4RJT A;  4R7E A;  2LV9 A;  2M85 A;  2CON A;  1L4A C;  3CX5 E;  5GTI H;  4B7Y C;  3V43 A;  1VF5 C;  2YHN A;  1JY3 O;  2LAU A;  1SQP K;  3G4S P;  4PPE A;  1YJ9 P;  4JPZ B;  3CD6 P;  3Q3D A;  1UIX A;  1K9M Q;  1RF1 C;  1SVF A;  5AIU A;  3L4F A;  2MD7 B;  2SPZ A;  4KHX A;  1RQV A;  1FAV A;  1URQ B;  5AVU B;  3Q2Y A;  1KQG B;  1FZA A;  1Z6U A;  3AEA C;  2K9J A;  2XKM A;  3QZV A;  2VPG A;  1KOR A;  1FOS F;  1L0L E;  1LTS C;  2MNY A;  4Q6F A;  2Z5I A;  1URQ A;  3CMA P;  1JY2 O;  3MD0 A;  1SQV D;  2JWA A;  2K37 A;  4K35 A;  3R2P A;  2YSM A;  2OGU A;  2FBW C;  1VFY A;  3O34 A;  3PHD A;  2R3C A;  3A0H E;  2F6J A;  3L75 J;  2JO1 A;  2QJP C;  3FX0 A;  1LNQ A;  1EDI A;  1SQQ G;  3KDE C;  1L0L K;  4GNE A;  2LN0 A;  4AP4 A;  1ZP0 C;  4WZ2 A;  1SQQ D;  1LTI C;  2Y0C A;  3E1I A;  1BOR A;  2Y0E A;  2BAY A;  2WSF J;  5APS A;  2IDB A;  1OVR A;  5B66 H;  2KYV A;  2OYI B;  2WPQ A;  2N1T C;  3CWB J;  1Q82 Q;  1BDD A;  1SQX D;  1S2E A;  4W7Y A;  3CC4 P;  1KIL E;  2C2V S;  1RF1 B;  5KLI C;  3EQ2 A;  4C7R A;  4LJN A;  3CCL P;  2LDR A;  3WUT A;  3A0B E;  2OYI A;  1NTK G;  1OW8 A;  3R4Y A;  1A02 F;  3TGU J;  1ZRT E;  2CRR A;  2Q5U A;  1AQT A;  1NYH A;  3N9M A;  1RF1 A;  1Z60 A;  2KWJ A;  1VQL P;  2RMZ A;  3L72 G;  5GTH H;  4QF2 A;  1VQO P;  2QJ0 A;  3IFM A;  2C9N Y;  2J58 A;  4AUW A;  4LLB A;  2KI7 B;  4N3W A;  1MV8 A;  4YBM A;  1WEU A;  3AE9 C;  3LDY A;  3L75 E;  1K05 A;  4WY4 B;  3P8M C;  3BCC J;  1BGY J;  2ZFC A;  2K88 A;  4DJG A;  4O62 A;  5KLV J;  5LKT A;  4OGC A;  3FXE A;  3GHG B;  4DOJ A;  1CSB A;  3V5B A;  2L7P A;  3MP7 B;  1RF0 C;  1T6A A;  1SQP D;  2FXP A;  3C9I A;  2QSI A;  4PJ0 H;  3EWK A;  3V2P A;  3H1K D;  1WIM A;  2K4D A;  2WQY C;  4L58 A;  1K8A Q;  1VYX A;  3GHG A;  3PRJ A;  1WRG A;  2ZET C;  1KB9 H;  4XI1 A;  5C11 A;  4A4B A;  3L73 E;  1CW5 A;  5I3L A;  3UIA A;  1S5L X;  3L1X A;  2YUC A;  5L8R J;  2QRX A;  2N1T B;  1YJN P;  1Y9B A;  5H1V A;  1GTW A;  4KJM A;  1MFZ A;  1K73 Q;  1T3U A;  1WES A;  4B86 C;  3CX5 D;  2KSJ A;  3TGU E;  2W6B A;  2G6Q A;  3H1J D;  2YKO A;  2N1T A;  2E75 D;  3H1L D;  1SQB K;  1YTZ T;  3ZPV E;  2RN0 A;  2VPE A;  3B5N B;  2AEM A;  1JM0 A;  3RK2 B;  4GOE A;  3AE1 C;  1BGY E;  1L0L G;  5KTB A;  2OWA A;  1LT9 C;  3HCS A;  3LQH A;  1JTH B;  5KJ7 D;  2IYO A;  3B8E B;  1L0L D;  3B5N A;  3CME P;  4O64 A;  2ECW A;  4D6T E;  2JP3 A;  1ZR2 A;  1PFI A;  3RPG C;  3AEC C;  2DSM A;  1EXJ A;  4Z0R A;  1K04 A;  2IZ0 A;  1FU1 A;  1KN7 A;  4QQ4 A;  1JTH A;  1RE3 C;  2AXT E;  5APY A;  1LTT C;  2KU3 A;  4A49 A;  1M56 D;  2L75 A;  3JCU E;  2MNZ A;  1H8A A;  1NU1 E;  2E6R A;  3RL0 D;  3M06 A;  1IYM A;  4I7C A;  3L70 J;  2DW3 A;  5KKZ C;  1V87 A;  2MIQ A;  3M91 A;  2QA4 P;  4P5O B;  2YHO A;  3O7A A;  5SVI B;  3GW6 A;  5KAF E;  2L91 A;  5CJ4 A;  2R5B A;  2IDA A;  1PV3 A;  3SWK A;  3AE6 C;  4GOF A;  3RGU A;  2Q6Q A;  3OW2 O;  1PP9 E;  2HPC A;  3MHV A;  1MFT A;  4I7Z C;  1HGZ A;  3AEB C;  2O01 J;  3PLN A;  3L35 A;  2WTY A;  5CCH D;  5SVI A;  5TRB A;  1DD3 A;  1NU1 K;  2W8Z A;  1G1I A;  3H1I E;  1KIL D;  5DJU B;  1HGV A;  3LRQ A;  4WZ0 A;  4B86 A;  5E79 H;  2EGP A;  3CCJ P;  2W6J H;  2YO3 A;  2FXM A;  4WVZ A;  3CCV P;  2I50 A;  4I1L A;  3HD7 D;  4N78 D;  1NJI Q;  4IL6 H;  1LT9 B;  3KDP B;  4LC1 A;  1FZG A;  1KMI Z;  1R5L A;  4OGQ B;  1VDF A;  3L75 G;  4FO9 A;  4V3K C;  5AVS B;  1LT9 A;  1RE4 A;  3II6 A;  1DCQ A;  2FYN C;  5FB1 A;  1GL2 D;  3U1A A;  3WMM 0;  1WEN A;  2ECN A;  2XZR A;  1LTJ C;  2MKE A;  4TKP B;  1KYO I;  3KNV A;  3FL2 A;  2M3E A;  3L74 J;  2YNY A;  4KT0 J;  2FFW A;  4NPD A;  5KKZ B;  2FSA A;  1RE3 A;  1NOH A;  1HBW A;  2NAA A;  2LXC B;  2ZT9 D;  1SQB D;  4BWN A;  3NTN A;  5EYA F;  1KQF B;  1J1D B;  2GUV A;  2XU6 A;  1N73 C;  1WE9 A;  3L73 D;  2M13 A;  2E75 C;  1EDL A;  1VQK P;  2LRI C;  2O01 N;  5AW3 B;  4YAB A;  3TGU G;  4UP0 A;  2KNC A;  1WMK A;  1CI6 B;  4GND A;  1GDT A;  1JB0 J;  1YTZ I;  4PD4 E;  4DZO A;  2OTL P;  4IFF A;  4DT0 A;  2FXO A;  3ZDM A;  2CT2 A;  5K3Q A;  3OA7 A;  5KJ7 C;  4HJG H;  1DX7 A;  1BE3 J;  3KYQ A;  1AFO A;  1FDO A;  2Z4E A;  2JMJ A;  4BBQ A;  4F52 B;  3BCC G;  1BGY G;  3M0D A;  3VOP A;  1CI6 A;  2EOD A;  2AN6 A;  4D6T G; 
#chains in the Genus database with same CATH homology
 3MUD A;  1X9V A;  2MT5 A;  1J2J B;  2P2U A;  3NXS A;  1H89 A;  1LTG C;  1LTA C;  3N9N A;  4FIP A;  2H8P D;  2J59 M;  5LKU A;  1JY2 N;  2ECI A;  1J1E C;  2FUU A;  1RF1 C;  4UP5 A;  3U5N A;  1SVF A;  5AIU A;  3L4F A;  3LW5 H;  2I1K A;  5AVY B;  3RL0 C;  2MD7 B;  5APU A;  4YAT A;  2PAJ A;  3KQI A;  4KHX A;  2HDP A;  1LTJ B;  1FAV A;  1URQ B;  2D8S A;  2LXP C;  4N6J A;  5AVU B;  3PUQ A;  2VNF A;  4UI9 B;  3VP8 A;  1FZA A;  4Y99 B;  1EQ7 A;  2HFE D;  1Z6U A;  5B77 A;  2XKM A;  2FKW B;  1G25 A;  3QZV A;  2VPG A;  1IFI A;  2F6N A;  1DVP A;  2E42 A;  1FOS F;  1JO5 A;  2ECG A;  4WY4 A;  4W7Z A;  1LTS C;  3O37 A;  4C9Z A;  2LGL A;  2M1R A;  2MNY A;  3P8C D;  1LTB C;  4Q6F A;  4GB0 A;  2W27 A;  2Z5I A;  1FP0 A;  1Z56 A;  1WEM A;  5G05 B;  4I2L C;  5APV A;  2Y43 A;  1JUN A;  1IFD A;  3LQJ A;  1M7L A;  4S3O C;  1LTJ A;  2UZG A;  1URQ A;  1URQ D;  4PTB A;  3KPE A;  3RPG B;  3RTR B;  1JY2 O;  5AW6 B;  1WIL A;  3MD0 A;  1N2D C;  1N7S A;  1T3J A;  2VPD A;  3A5T A;  1WT6 A;  5FER A;  2KRE A;  5KH7 A;  2WZ7 A;  3R2P A;  3L1Z B;  4MVT A;  2YSM A;  5CCH C;  1VD4 A;  2FYU K;  1NWQ A;  4WZ2 A;  1VFY A;  4JF7 A;  2WT7 A;  1WEQ A;  1T1H A;  3O34 A;  4JYC A;  3PHD A;  5KH9 A;  2R3C A;  3VMZ A;  5H1T A;  1HVV A;  2F6J A;  3SOU A;  1FJK A;  4I7D A;  2CPS A;  1HTL C;  2KWO A;  2YU4 A;  4FJC A;  3HD7 C;  4YBT A;  1IFJ A;  1JY3 P;  1L0L K;  1YYC A;  4GNE A;  2LN0 A;  2M3B A;  5CCG D;  3KV5 A;  5LKZ A;  1WEV A;  4LKA A;  4V3L C;  2ECV A;  4AP4 A;  2CSZ A;  3HE5 B;  1T2K D;  2H43 A;  1SFC B;  3L37 A;  1X79 B;  1LTI C;  1ZV8 A;  3E1I A;  4W80 A;  1BOR A;  2BAY A;  2VPB A;  5D1K B;  2FFD C;  2KR4 A;  3G3Z A;  1K2F A;  5APS A;  1N7L A;  1ZN5 A;  5AW5 B;  2QM8 A;  1XTG B;  3IHP A;  3SOX A;  2YSJ A;  2KYV A;  2XV5 A;  5TDR A;  2K16 A;  3VMY A;  1ZBD B;  2OYI B;  4YAX A;  3A3Y B;  2WPQ A;  3LID A;  3HTK C;  2N1T C;  2O01 H;  1OWA A;  1RE4 C;  2KLV A;  4LAD B;  2L5U A;  1GK4 A;  5H9M A;  4XE5 B;  5BU5 A;  5AVZ B;  1NTK K;  2P1J A;  3HE5 A;  4W7Y A;  1SFC D;  1SFC A;  3SWY A;  1NH4 A;  2C2V S;  3TSI A;  1RF1 B;  1IJD B;  4N4F A;  1NTM K;  1WEW A;  3EQ2 A;  4O9B A;  4GNF A;  5B8D A;  4C7R A;  2ZXE B;  4LJN A;  2KWN A;  2LDR A;  5LCW B;  4YBS A;  3GL6 A;  3MGN A;  2OYI A;  2HYE D;  2RSD A;  1JY2 P;  2OYH B;  2KWK A;  2VJF B;  1LWU C;  1A02 F;  2CSY A;  1JCC A;  2JMD A;  2Q5U A;  5TAB A;  3N9M A;  1RF1 A;  1Z60 A;  3T97 A;  2KWJ A;  3HUS B;  3N4X A;  4IC3 A;  2YUR A;  4A4C A;  1Z2Q A;  1HYI A;  1WEE A;  4QF2 A;  2KFT A;  2QJ0 A;  3IFM A;  2K17 A;  2KYU A;  2C9N Y;  5DKA A;  1N86 A;  1WEO A;  2J58 A;  3H6P A;  4AUW A;  4LLB A;  2OYH A;  4N3W A;  1MV8 A;  1NO4 A;  5AVT B;  1IFN A;  3BAT A;  2VJF A;  4YBM A;  5AW9 B;  1WEU A;  1MZ9 A;  1NTZ K;  5TBN A;  4WY4 B;  3OAK A;  3P8M C;  1HUC A;  1S9K D;  1HYJ A;  2CPB A;  2ZFC A;  3HUS A;  3V2N A;  3ZYQ A;  3CL3 D;  1J1D C;  3N9P A;  1FDM A;  3ASL A;  5LKT A;  1JM7 B;  3PP5 A;  3GHG B;  4DOJ A;  4FK5 A;  3VK6 A;  1CSB A;  2P67 A;  3V5B A;  3ZPV 1;  2R5D A;  2WSC H;  1N7S B;  3BVH A;  2CKL B;  1RF0 C;  3U59 A;  2M3H A;  1GZL A;  1JOC A;  3N9L A;  3C9I A;  5AW0 B;  1NKZ B;  3A2A A;  3T7L A;  1M1J B;  3HCU A;  4WY4 D;  2VP7 A;  1IK9 A;  3M0D C;  1X4I A;  3V2P A;  5APQ A;  5AW8 B;  2WT7 B;  5AVR B;  1WIM A;  3NG2 A;  2K4D A;  3BRT B;  1KFM A;  3O70 A;  2GUS A;  4L58 A;  2PUY A;  1JM7 A;  5CMZ A;  3GHG A;  1VYX A;  2ECJ A;  1WRG A;  2ZET C;  4QF3 A;  4XI1 A;  5C11 A;  1WFK A;  2CKL A;  4A4B A;  1N7S D;  2A45 H;  2WWW A;  1N73 B;  2L80 A;  1CW5 A;  5I3L A;  5APT A;  3UIA A;  1GU4 A;  1MM3 A;  3L1X A;  2YUC A;  1G1J A;  1M1J A;  2N1T B;  4MSX A;  5H1V A;  4RES B;  1GTW A;  1KIL C;  5B79 A;  1MFZ A;  4N3Y B;  1GK6 A;  2YMY A;  2L43 A;  5AIT A;  1T3U A;  2L5G B;  5BU8 B;  1GW3 A;  1FZB A;  1WES A;  4B86 C;  2G43 A;  2FFD A;  5H1U A;  2HYN A;  2NPS B;  2XB1 A;  2KSJ A;  2G6Q A;  2W6B A;  2XEU A;  4PPE A;  5JG6 A;  3VYI A;  3RK3 C;  1N73 A;  3M9B A;  2YRE A;  2Q7C A;  4YC9 A;  2JEE A;  2YKO A;  2YKP A;  3BAS A;  4ZUX U;  2N1T A;  2N1T D;  2OAR A;  3BRV B;  1SQB K;  1AQ5 A;  1YTZ T;  4C46 A;  5D1M B;  3ZPV E;  1FBM A;  2VPE A;  2KOG A;  2QIZ A;  5B75 A;  3B5N B;  5APX A;  3U5P A;  3VTP C;  2VJE B;  2F42 A;  3RK2 B;  2FYZ A;  2KIZ A;  2VRS A;  1GD2 E;  1FOS E;  2YW8 A;  1T8Z A;  5AW7 B;  1URQ C;  2NPS A;  2NPS D;  2LKM A;  1L4A B;  3HE4 B;  2LQ6 A;  2L0B A;  4EOT A;  4Y99 C;  1MUU A;  5KTB A;  4NN2 A;  2MD8 C;  1KQL A;  1WGM A;  2HLO A;  5DIN A;  1FZC C;  1GW4 A;  1ZLL A;  2O1J A;  2G45 A;  5CJ0 A;  4WZ3 B;  1LT9 C;  1A02 J;  4HYT B;  3HCS A;  1FZF A;  3LQH A;  1JTH B;  5KJ7 D;  4AQR D;  5KJ7 A;  3B8E B;  4R2Y A;  1GL2 C;  2YKQ A;  3B5N D;  3B5N A;  2N9B A;  3MHS A;  4O64 A;  5TDW A;  1NAF A;  2VJE A;  2ECW A;  2LGG A;  3RK2 D;  1S9K E;  1VPC A;  5FB0 A;  1J1E B;  2Y1N A;  4GKG A;  1ZR2 A;  3V2R A;  1PFI A;  1L4A A;  1L4A D;  3HE4 A;  3RL0 B;  3I5C A;  3RPG C;  3V4Q A;  2BAS A;  3LIE A;  5AVX B;  3V2Q A;  3ZNI A;  1FU1 A;  1RY3 A;  5D1L B;  5AW4 B;  5J3X A;  1JTH A;  1RE3 C;  5APY A;  3CI9 A;  3VN0 A;  5CCG C;  1LTT C;  3IR9 A;  1NKN A;  2KU3 A;  2Q3I A;  1U6G B;  4A49 A;  2XNX A;  1SLQ A;  4HH2 A;  3VMX A;  2H7H A;  1T2K C;  2L75 A;  3P8C E;  2MNZ A;  1H8A A;  2E6R A;  3RL0 D;  3M06 A;  1IYM A;  4S3O B;  4I7C A;  4ZKU A;  3TK1 A;  1V87 A;  2MIQ A;  3M91 A;  2IX7 C;  2MA6 A;  1X8Y A;  3DQV R;  4I6M C;  3O8Z A;  3MHH A;  2QM7 A;  4P5O B;  3U5M A;  2I1J A;  2YHO A;  4IC2 A;  4LK9 A;  3A7O A;  1LDJ B;  3HCT A;  5C13 A;  3TNU B;  1LGH B;  3O7A A;  1KIL B;  4WB4 A;  5CJ4 A;  2R5B A;  1X4J A;  2IDA A;  2IFN A;  4CCG X;  4M3L A;  2JMI A;  2LGV A;  3V4W A;  2HPC A;  3L36 A;  2OYI C;  3O36 A;  4W4U A;  1HGZ A;  3RK3 B;  3TYY A;  3VP9 A;  2K1J A;  2R32 A;  2IPP A;  2YYR A;  4AVX A;  2C0W A;  2QIC A;  3HD7 B;  3L35 A;  2PNX A;  3M62 A;  4AUQ B;  2WIT A;  4A0C D;  2Q9I A;  3TNU A;  3N9Q A;  2WTY A;  5CCH A;  5CCH D;  5TRB A;  1NU1 K;  1G1I A;  3MIW A;  1KIL D;  1KIL A;  1E5W A;  4IFD K;  1HGV A;  3LRQ A;  4WZ0 A;  5G04 B;  2YO2 A;  2WSF H;  4B86 A;  3DPL R;  3N7N A;  4XA4 A;  3M9H A;  3U1C A;  2EGP A;  1SQV K;  2FFD B;  4ZQL A;  3L11 A;  2POH A;  2YO3 A;  5AW2 B;  4X3G A;  3RK3 D;  1W2E A;  2C2L A;  2M6M A;  4I7B A;  2FXM A;  1G2C B;  1XWH A;  2OYH C;  2KP8 A;  3M0A A;  2I50 A;  2YQM A;  4I1L A;  2WPR A;  3HD7 A;  3HD7 D;  1CHC A;  1FZC B;  4N78 D;  3SOW A;  3HTK B;  1LT9 B;  3KDP B;  3M63 A;  3OJA B;  3CLQ A;  2KGG A;  4LC1 A;  1FZG A;  2A45 I;  2C9L Y;  1GL2 B;  3HUS C;  2H0D B;  4AYC B;  2W6A A;  3C5K A;  1JNM A;  5AVV B;  1IO4 A;  1VDF A;  3C6W A;  3H32 B;  1QL2 A;  4LLH A;  3HRN A;  2E43 A;  4FO9 A;  4L7X A;  3SHB A;  3M9Q A;  1G2C A;  4ZDT A;  3GV4 A;  1FZC A;  5AVS B;  4V3K C;  5AW1 B;  3HTK A;  1LT9 A;  1RE4 A;  3II6 A;  5CHX A;  3N9O A;  2GM4 A;  1N87 A;  3KV6 A;  4WY4 C;  2LGK A;  5FB1 A;  1QL1 A;  1LWU B;  4LGD E;  1GL2 D;  1GL2 A;  1SQQ K;  3P7K A;  4AYC A;  3U1A A;  3WMM 0;  2FUI A;  2H0D A;  3U5O A;  3ZVZ B;  1WEN A;  1GU5 A;  2DX8 A;  2ECN A;  1XTC C;  2XZR A;  3ZVY A;  3H32 A;  1KFN A;  1LTJ C;  2KB7 P;  1MM2 A;  3O33 A;  5B76 A;  5B78 A;  2JJL A;  3GHG C;  4TKP B;  1SP4 A;  3KNV A;  3LQI A;  3FL2 A;  1IC2 A;  1N7S C;  2YNY A;  2IFM A;  2A45 G;  2M8R A;  1WEP A;  3I2D A;  1E4U A;  4R8P K;  4GIF A;  2FSA A;  2OXQ C;  1SQX K;  1L0N K;  2KGI A;  1M1J C;  1RE3 A;  4WBA A;  2E6S A;  2LXH C;  1LWU A;  5CCG A;  3KQG A;  1NOH A;  1HWT C;  1HBW A;  1DH3 A;  2JRJ A;  2NAA A;  2YQL A;  5G0F A;  2HG5 D;  4C7N B;  1H88 A;  1KZU B;  4OH8 B;  5APW A;  2EA6 A;  3NTN A;  2O1K A;  4BHW A;  2Z5H A;  1CZQ A;  5EYA F;  1FBV A;  1J1D B;  2GUV A;  3EFG A;  2XU6 A;  4EIJ A;  4GNG A;  4WA6 A;  1N73 C;  1WE9 A;  3ZTG A;  2WSE H;  2MJZ A;  5KH3 A;  3NFQ A;  3T6R A;  1LDK C;  4GT1 A;  4JYB A;  4IFM A;  2LRI C;  4C7N A;  5LKX A;  5AW3 B;  2PP6 A;  3PUR A;  4YAB A;  2HOD B;  1JY3 N;  4ZKP A;  4CA1 A;  2XDJ A;  4UP0 A;  5AVW B;  1CI6 B;  2NPS C;  1IFM A;  2ECT A;  2RI7 A;  4GND A;  1GDT A;  5FEY A;  1NHL A;  2WPS A;  3O35 A;  1YTZ I;  2YT5 A;  3EB5 A;  4DZO A;  5KLV K;  2HPC B;  1FJP A;  2MUM A;  4IFF A;  2C0X A;  1OXZ A;  1RF0 A;  2CT2 A;  3P32 A;  1HJB A;  2Y1M A;  3OA7 A;  5KJ7 C;  1RMD A;  3NMD A;  4N78 E;  1DX7 A;  3EB6 A;  3KYQ A;  2JMJ A;  1AFO A;  3B5N C;  2Z4E A;  4BBQ A;  2HOD A;  1JCD A;  3MTU E;  1HH0 A;  1SFC C;  4F52 B;  3RK2 C;  4R7E A;  4YAD A;  2LV9 A;  3M0D A;  2M85 A;  1DEB A;  3VOP A;  1CI6 A;  2P7J A;  1L4A C;  2MA5 A;  2KE1 A;  1F62 A;  4B7Y C;  1JMM A;  3V43 A;  3SWF A;  1X4U A;  2YHN A;  3M99 A;  1JY3 O;  1SQP K;  5BVZ A;  2EOD A;  2AN6 A;  1FZE A;  1ZR4 A;  5AVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...