1JOCA

Eea1 homodimer of c-terminal fyve domain bound to inositol 1,3-diphosphate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
b'QDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Early Endosomal Autoantigen 1
publication title Multivalent endosome targeting by homodimeric EEA1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jocA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jocA02
1E4UA 2I50A 1ZBDB 2YQMA 3M63A 2ECVA 4LKAA 4YBSA 2W6BA 4GNDA 4PPEA 3NG2A 3BRVB 5D1LB 2MIQA 4N4FA 1WEMA 4L7XA 1G25A 1JM7A 4UI9B 2F42A 2YREA 2LXHC 4O64A 5TRBA 1K2FA 2E6SA 3MHSA 1F62A 3T6RA 1MM2A 2OXQC 4N3WA 1X4IA 2KYUA 3O70A 4BHWA 2D8SA 5FEYA 2KGGA 3PUQA 4W4UA 5KH9A 2VJFA 2KFTA 2JRJA 5TDWA 2QJ0A 2JMIA 4L58A 2YUCA 2H0DB 4GNFA 2RI7A 3KV6A 3SHBA 2CKLB 2YU4A 3U5MA 2ECWA 5B76A 4X3GA 2IDAA 2CT2A 4R2YA 3RPGC 3M99A 4YBTA 5FB1A 1Z2QA 2F6JA 2Y1NA 2M1RA 2MD7B 4FO9A 2UZGA 4UP5A 5AIUA 5C11A 4I7CA 2KGIA 2LGGA 1LDKC 2VPDA 4A4BA 2NAAA 2KWKA 2MNYA 3DPLR 1WEEA 4LLBA 3ZYQA 3HCSA 2KWOA 1WE9A 4F52B 3GV4A 1HYIA 3EQ2A 4GNEA 4YABA 5LCWB 5DKAA 3ZVYA 2VPBA 2ECIA 2ZETC 5G04B 3HCTA 2HDPA 3T7LA 4B7YC 2YQLA 2VJEA 3HTKC 5I3LA 1U6GB 2FUUA 2LRIC 2C2VS 2ECNA 1X4UA 1CHCA 4LJNA 3ZPVE 4WA6A 2FSAA 3ZVZB 4MVTA 4YC9A 3SOXA 2CSYA 4P5OB 2Y43A 4Q6FA 3ZTGA 4ZUXU 5D1KB 1WESA 3ZNIA 1N87A 5TABA 1WEQA 4AYCA 1XWHA 2JMJA 3N9PA 1V87A 2DX8A 3O33A 2VPGA 3KQIA 3U5NA 4R8PK 2ECGA 3O34A 4LK9A 2ECJA 3CL3D 2K17A 2YW8A 5FERA 2HYED 2KWNA 4QF2A 3C5KA 4S3OC 2KIZA 3U5OA 3N9QA 3L1ZB 2KREA 4GNGA 3N9OA 4FIPA 5H1UA 3PURA 1T1HA 2YHOA 2YHNA 2G45A 2KE1A 5KH3A 2QIZA 2YYRA 2RSDA 2F6NA 2XEUA 4C9ZA 2G43A 1WEUA 2G6QA 5LKXA 2MA5A 2KR4A 1JM7B 3PHDA 5DINA 1WIMA 2K4DA 4UP0A 2MA6A 2CSZA 4B86C 4YADA 3MHHA 1VYXA 4IC2A 1WEPA 4S3OB 4I7BA 2YURA 1FP0A 2FUIA 3KNVA 2PNXA 5H1VA 3N9NA 1JOCA 2LQ6A 2VJFB 5EYAF 2L5UA 2KU3A 4FK5A 2M85A 2MT5A 2LGVA 4R7EA 5J3XA 2EA6A 2YKOA 2H0DA 2M6MA 3LQHA 3FL2A 2ECTA 5H9MA 1VD4A 3U5PA 4A49A 4QF3A 2CKLA 2LXPC 3N9MA 4CA1A 3L1XA 2L80A 3EB6A 5B79A 2BAYA 4A4CA 2L0BA 5LKZA 1VFYA 4AVXA 1HYJA 4WZ3B 1Z60A 3N9LA 4V3KC 2L75A 3GL6A 5TBNA 5LKUA 3BRTB 3M62A 3SOWA 3IHPA 2VP7A 3LQJA 2VNFA 4ZDTA 5D1MB 3DQVR 4XI1A 3O35A 2EODA 2LN0A 5C13A 3O36A 1MM3A 3SOUA 2LGKA 2MD8C 4BBQA 2QICA 3C6WA 5KH7A 1Z6UA 4A0CD 1WFKA 3V43A 2LDRA 4FJCA 1WILA 4GB0A 5B75A 1RMDA 1WEWA 1BORA 1LDJB 4NN2A 2VJEB 3O7AA 4YATA 4V3LC 3ASLA 2XB1A 2E6RA 5B77A 1WGMA 1FBVA 5G05B 2YKPA 4MSXA 2Y1MA 5B8DA 3VK6A 5G0FA 2KWJA 2MNZA 4AUQB 3ZPV1 2YSMA 4IC3A 4CCGX 1X4JA 1WEVA 4AYCB 2MUMA 5TDRA 3EB5A 2M3HA 4YBMA 2LGLA 2L43A 1WENA 3KV5A 5FB0A 3QZVA 3LQIA 3I2DA 2YT5A 4LADB 2K16A 3O37A 2C2LA 2K1JA 2EGPA 4WZ2A 2JMDA 3HCUA 3LRQA 4AP4A 2LV9A 5JG6A 5LKTA 3L4FA 1WEOA 5H1TA 2PUYA 1DVPA 2YSJA 4TKPB 4I7DA 4WZ0A 3RTRB 3RPGB 4PTBA 5AITA 3L11A 2VPEA 2YKQA 5B78A 1IYMA 2AN6A 4ZQLA 4YAXA
chains in the Genus database with same CATH superfamily
3CCRP 3CPWO 3E7KA 4JBZA 1HH0A 3M63A 2W6BA 5KAFE 4GNDA 3NG2A 5C39A 3CC2P 1NTZD 1G25A 2E61A 3BCCD 2BASA 4XA4A 3KYQA 2YREA 3MHSA 4H9DA 1F62A 4YXDC 2KYUA 1KILE 3RK3E 3RK2D 2N1TA 5E79H 4BHWA 1N7SB 3PUQA 3F5HA 2FFWA 4W4UA 2ZYGA 2A06D 1RF1A 1RE4A 2KSEA 2KB7P 1KORA 3RGUA 4AUWA 1Y47A 3U59A 4RJTA 1K8AQ 2L91A 3K5BA 5APWA 1LTJB 2ZXEB 1JB0J 1KYOH 2IBZD 3HRNA 5AW8B 3KV6A 3L74D 1XTCC 4LLHA 2RN0A 5CCHA 4I1LA 4EYYQ 2QRXA 3TNUA 2NPSA 1NU1J 1X0TA 4W80A 2CRWA 2M1RA 3HUSB 2MD7B 2KZJA 1NH4A 2FKWB 4L73A 5AIUA 5C11A 2KNCB 2ZVOB 5GTIE 2BCCE 2KXPB 2MNYA 4LLBA 4H44D 3ZYQA 1JY2N 2MKVA 1HYIA 3AEAC 4OVNF 5CHXA 2Y0DA 3JCUE 1VQ5P 1P84E 2XV5A 2W27A 1U7JA 3V4WA 2HDPA 3T7LA 2JJLA 4IL6H 1YBKA 4EDFA 2EXUA 2HLOA 2K9JB 3I5CA 3U1CA 1NAFA 1NTME 1LT9C 2K3RA 3UIAA 2C2VS 2ECNA 1X4UA 1YQ4C 1SFCC 3H1HD 3T97B 3ZPVE 1SQQK 2W6JH 1JCDA 4MVTA 4YC9A 3CXHE 2POHA 5AW6B 3L70G 3PH0A 1T6AA 3HE5A 3SWKA 1XWHA 1VDFA 1PV3A 2CRRA 4YXWH 3HD7A 2CONA 3O33A 2E74D 4WBAA 1T3JA 2H89C 2QEXP 1LT9B 4GKGA 2QM8A 1LWUB 3B71A 3CL3D 2K17A 5AW4B 2JWAA 5FERA 2HYED 1JNMA 4D6TD 2KWNA 1PPJD 1GL2C 1M8OB 3CC4P 4S3OC 2KIZA 3NXSA 2FBWC 3R2PA 3P32A 3U5OA 3DDTA 3A0BH 1SQQG 3L1ZB 3TGUG 1BSHA 4NPDA 3H6PA 1OWAA 2G45A 3FAOA 1N73C 4KT0J 2YYRA 1FS0E 2P67A 2F6NA 1Y9BA 3CCVP 1WEUA 2JUNA 2FY8A 1DEBA 1YTZI 2QJKC 3BCCJ 4C46A 1GK6A 2W90A 5CJ4A 3PHDA 2N9BA 4PV1D 2ZT9B 2CSZA 2Z4EA 2M8RA 4M3LA 4B86C 3C1LA 3B8EB 3RL0C 1WEPA 1L0LE 3KPEA 4S3OB 2WSCJ 2YURA 1JMBA 1L0LJ 2WWWA 5APQA 1URQA 3L72D 1SS1A 2R5BA 3KNVA 1E79H 1L4AB 1BE3G 4EOTA 5H1VA 2EGMA 1M7LA 3FXDA 1M1JC 5CCGD 1NTKK 5EYAF 3V2RA 1OW7A 2M85A 3FWLA 3H1JG 2LGVA 1IC2A 3HE4A 2FD4A 5AVWB 2H0DA 2M6MA 3LQHA 3F89A 3L74J 1J1DC 3U5PA 1S9KD 3ABVC 4A49A 1AA0A 4QF3A 2KLVA 2WTYA 3RBXA 3RK2C 3A0HE 1FZCB 5B79A 1VQLP 1SQVE 4A4CA 1SQVJ 2XZRA 2MKEA 1VFYA 1USDA 3CCMP 5AVXB 4BRYB 1OIPA 1U7MA 1BDDA 2XNDH 3VOPA 1IO4A 2O1KA 1Z60A 1N7SD 2L75A 5TBNA 1HVVA 4C7NB 4N6JA 3M62A 3SOWA 1KMIZ 2FYUD 3IHPA 5DJTB 3L73G 3VTPC 3LQJA 1CZQA 2KIKA 1NTKG 1ZRTE 2QIWA 4XI1A 5APYA 3O36A 3SOUA 2QSIA 4HKZH 3H1ID 2LGKA 1J1DB 1IZNB 3AEBC 2QICA 5KH7A 3RK2B 2XOZA 3PLWA 3L71D 4FJCA 4GB0A 2W83C 3SWFA 3MUDA 1LGHB 4I7ZC 1JCCA 2WSFJ 1M90Q 3LW5J 3BVHA 1HGZA 4YATA 3D6ZA 1DD4A 4EIJA 2HG5D 1T3UA 4U3FD 3MIWA 3H1HJ 4H44C 1X9VA 3CX5H 2KZIA 3KQGA 2OYIC 4HJGH 1IFJA 1WGMA 1FBVA 2ZVNB 2Y1MA 4PJ0H 2I1KA 3TGUE 1BGYE 4IFMA 3ZPV1 1BGYJ 2YSMA 2Q7CA 2C9NY 4WB4A 4UB6H 1KQFB 2E75B 1WENA 2JP3A 1M56D 4I7ZB 1FJPA 5H2FH 1KILD 3RK3D 5CBOA 3N7NA 2E5TA 2K1JA 4WZ2A 1J1EC 2V7QH 1YIJP 4H44B 3IR9A 2LV9A 2OYIB 3G4SP 3M7KA 1WEOA 4DJGA 2PUYA 1DVPA 5E79E 1SQPK 1GMJA 4I7DA 3C8VA 1PP9G 3L11A 2WQYC 2YKQA 5CCHD 2B9BA 1QX8A 2XOCA 3SSUA 1RHZB 2E74C 1IYMA 3NMDA 2NPSD 2AN6A 1PFIA 2FYNC 1G2CB 1ZR2A 2IZ0A 1DX7A 1E4UA 2I50A 1KYOE 3AEEC 1BCCG 3BRVB 1J1EB 1JM7A 2IDBA 1EZVG 2LAUA 3E1IA 3FEHA 1JTHB 4O64A 4WY4C 2E6SA 2BCCD 2O01H 3TK1A 3T6RA 1MM2A 1IFNA 1LTAC 2GM4A 2KS1B 3L72J 3Q2YA 2HODB 5B66H 3W68A 2QE7H 2E76D 1MFTA 1KTMA 3V2NA 2E74B 1SQPG 1N86A 1P84D 4OGEA 1NTKE 5AVTB 1PGOA 5TDWA 1ZN5A 1SVFA 4PV1C 2N9YB 4K35A 2FFDB 1FOSE 5CJ0A 1T8ZA 4GNFA 1NTMD 3IN6A 2RI7A 2YU4A 2ECWA 4IL6E 4L75A 3TYYA 3H32A 1RF0A 5FB1A 3MDBC 1MKMA 1Z56A 3CXHD 3KZIH 4HB1A 5CMZA 3CCQP 2M5AB 1H88A 2GUSA 3B5NA 5SVIB 2UZGA 1BDCA 1L4AD 1EXIA 1SQXK 3Q5SA 1AQ5A 2KGIA 4I7CA 3OAKA 4A4BA 4JYCA 2Y0EA 3DPLR 4PV1B 3HCSA 2C0XA 2LR2A 3H1IJ 1SQBK 3EQ2A 4YABA 5LCWB 3L71J 3E2DA 2G3AA 1EDJA 3GLMA 1CW5A 3HCTA 4QQ4A 2XKMA 1VQ4P 5AW5B 3RL0g 3L36A 2YIUB 2VJEA 1N7SC 3MD0A 4U3FJ 1U6GB 4GIFA 1QGKB 2QJPC 2JO1A 3D70A 2CSVA 3C9IA 1VL2A 4WWIA 1GW3A 4LJNA 4BWNA 1PP9E 4WA6A 3LVRE 5EFWB 1L0NE 2E43A 4P5OB 4JF7A 3CWBE 1IFMA 3A0BE 1L0NJ 4LGDE 1H0TA 1LTJC 3GG2A 4Q6FA 1SQXG 2FXOA 2J58A 3USSA 5D1KB 4IL6X 1WESA 5AVZB 4XE5B 3ZNIA 2J59M 2KKYA 3SFDC 1NTZK 3A3YB 1URQD 1FE6A 1OMIA 1BCCE 5APXA 1SQBG 3H1LG 1Y8AA 1L0LD 1VQ8P 3HUSC 5KJ7D 1EXJA 4RESB 2QJPB 4LK9A 2IQJA 2YW8A 1SP4A 3V2QA 1Q86Q 1KB9I 2R3CA 1EDIA 4BXLA 3M9HA 5KAIH 1EZVI 3DWDA 3C5KA 2WMMA 2Z5IA 1GW4A 3KHUA 1JY3P 1GK4A 1KC8Q 2R5DA 2JR8A 2YHOA 3CLQA 2KYVA 4PD4I 1KILC 1FZEA 2H88C 2QG4A 5KH3A 1RE3C 5KLVE 1SQVD 5KLVJ 1EDLA 2E75D 3PP5A 3CI9A 2IYPA 3D6YA 1NTZG 2G43A 2YNYA 2G6QA 2P58A 5LKXA 3T9KA 2MA5A 1IK9A 2Z5HA 2L7PA 4UP0A 3L75E 2SPZA 2BCCJ 3AEFC 3L75J 3WUUA 5B5EH 1VYXA 1W2EA 1ZRTD 2A45I 1H8AA 2R3SA 1LTIC 2N1TB 1KN7A 5TISH 2PRRA 4I2LC 4Z0RA 2M3BA 1KILB 3RK3B 1LNQA 2HR3A 1NJIQ 4A7PA 3AECC 1FC2C 1SFCA 2B0OE 3W67A 4FK5A 1AFOA 3NTNA 1JUNA 1OW6A 1NTMJ 2IBZG 1LWUC 2VRSA 2JM3A 2RKLA 3JUEA 4Y99C 2ECTA 3N4XA 3KXDA 2NZ2A 2CKLA 3CCUP 2LXPC 4CA1A 4JYBA 3EB6A 3GF7A 1FDIA 1USEA 1Q81Q 5AVVB 2E76C 3TGUD 1K73Q 1X8YA 2L0BA 1BGYD 3TNUB 2NPSB 4TLFA 1HYJA 1LTGC 3CX5E 1Q82Q 3FXEA 1N7LA 3N9LA 1FOSF 3GL6A 5LKUA 4PJ0E 1SQXE 5KLIC 2VP7A 1NGMB 5L8RJ 3CX5I 3ZDMA 1NVOA 3DQVR 1GL2A 2EODA 4Y99B 1A02F 5C13A 4ZKPA 1MM3A 2ZT9C 4AQRD 4UB6E 2YXQB 4BBQA 4IFDK 3SUBA 5H2FE 2IFNA 3GHGA 2E76B 4NN2A 1L4AC 3AE2C 1N73A 2PAJA 3O7AA 1S5LH 2K9YA 4GDOA 2LKMA 1NWQA 4ASVA 1VF5D 3O6QA 1EC5A 2E6RA 5KLIB 5G05B 1KB9H 4DCKA 5B8DA 3TSIA 5G0FA 1KYOD 1VQMP 2MNZA 1FZAA 3TF5A 1S72P 1KFNA 1K9MQ 3M0DA 3I55P 3HE5B 1XTGB 1X4JA 1JMMA 5TDRA 1FZCC 1AVYA 1MFZA 1HJBA 3EB5A 1QLED 4PD4H 1M1JA 3KV5A 3HD7B 2E42A 1RQVA 1N8RQ 5GTHH 3SWYA 4LADB 2K16A 1U57A 3HTKA 3O37A 2WSEH 2C2LA 1DH3A 2UWJE 2XP0A 2QJYB 2WVRA 2EGPA 2JMDA 3LRQA 4AP4A 4D6TG 3Q5PA 4TT3H 1OZHA 2KP8A 1NTKD 1FZGA 3L4FA 1FJKA 3PRJA 3VYIA 5B66E 2YSJA 3V2PA 4GODA 4TKPB 1W2BO 1YJ9P 3AE1C 3RTRB 3RPGB 1Q7YQ 1JY2P 1LP1A 1URQC 2Q1KA 2A45H 3SFEC 2OYOA 3LDYA 3H1KG 3VMZA 5KJ7C 1CI6B 4ZQLA 1K2FA 2I1JA 1NAYA 5AW9B 1Q90D 1ZBDB 2YQMA 4YBSA 5D1LB 2MIQA 1WEMA 1QVGO 1NHLA 4YTPC 2IBZI 4UI9B 3L70E 2F42A 1GU5A 2LXHC 5TRBA 3L70J 3VP8A 5AW0B 3KZIE 1ZR4A 2OXQC 3L72G 2FYUK 2WPQA 3MZWB 1T2KD 1QEXA 4IFFA 1MV8A 2JKVA 1URQB 2D8SA 5FEYA 1QVFO 2KGGA 3LVQE 3O8ZA 2E75C 1E5WA 2VJFA 2KFTA 3WU2H 2AEMA 3M9QA 2JRJA 4CPGA 1OW8A 4QMAA 2HPCA 2YMYA 3HE4B 1YHQP 2QJ0A 1YTZT 2YMKA 2JMIA 4L58A 2YUCA 1ZLLA 3RBZA 2H0DB 2QA4P 1SQQE 1DCQA 3SHBA 1PP9D 1SQQJ 4NPEA 2P2UA 1L0ND 2IDAA 3TGUJ 4R2YA 1QL2A 3M99A 4YBTA 3CWBD 2AEJA 3MUDC 4DT0A 1Z2QA 2Y1NA 2OGUA 1ZXGA 1S2EA 1G1JA 2KSJA 5K5GB 2L5GB 2N1TD 1X79B 2FYUG 4UP5A 4ASWA 2LGGA 1LDKC 1BCCD 1S3JA 2YO3A 2NAAA 4MN4C 2KWKA 1JTHA 1WEEA 3H1IG 4H0LD 3GV4A 2IFMA 4GNEA 2FXMA 1RH5B 3CCJP 5DKAA 3ZVYA 1OVRA 2IYOA 3II6A 1BE3E 2WT7A 2D8UA 2B87A 1BE3J 2I8DA 4UB8H 4B7YC 3A7OA 2ZXXA 4HH2A 4U3FG 3H1JE 5I3LA 4U7JA 2KLUA 3H1JJ 2LRIC 1FDOA 1KQGB 3CCSP 3OA7A 1PGQA 3FWNA 5KAIE 1FBMA 4K3AA 2Y0CA 1NKNA 5KLVD 2FFDC 5BU8B 3SOXA 2AXCA 4WY4A 4GOEA 3H1KE 4ZUXU 2O3JA 1NU1K 3PLNA 3TDKA 5DJUB 4GT1A 1MBMA 1WMKA 4AYCA 1N87A 4W7YA 3L75D 3WMM0 3N9PA 2QM7A 3PJSK 1GTWA 1V87A 2P7JA 2VPGA 3JC22 3U5NA 4ZKUA 2OYHA 3L73E 3CD6P 3U1AA 1SFCD 2ECGA 3H7HA 4NPFX 5B5EE 2D2CB 4R4LA 2ECJA 1NTKJ 3AEGC 5AVYB 3OW2O 4OH8B 1J2JB 2RMZA 2RH0A 5TISE 3A5TA 5AW7B 3N9QA 1LJ2A 2XNXA 3M91A 2KREA 4GNGA 4EI2A 3N9OA 3PURA 2A45G 3CC7P 3CCEP 2WZ7A 3V5BA 4N78E 1A02J 1NU1G 5CCGC 2YIUC 2XDJA 2QIZA 3P8CE 1VF5B 2WPVB 3HD7D 3CX5D 2G8YA 1IK7A 3IFMA 4OWFA 1JM7B 5DINA 2K4DA 1FU1A 2MA6A 3EWKA 1SQXD 4OGQB 4YADA 3MHHA 2AXTH 4IOIH 5AVRB 2WSSH 2YO2A 2R44A 3M0AA 1N7SA 2H8PD 1JOCA 2WSFH 2LQ6A 4O62A 3LW5H 1H89A 3IAOA 1VQNP 2KU3A 4Y28J 3WUTA 1IJDB 1KQSO 2EA6A 1LTJA 1K04A 5H9MA 1NYHA 4HYTB 1VD4A 3AE8C 2BEZF 1T2KC 1PP9J 3N9MA 1EDKA 3RL0D 3CWBJ 4DOJA 3R4YA 1S5LE 2KI7B 3H32B 2BAYA 4L76A 5AVQB 3CCLP 4AVXA 3HUSA 4XFJA 1KD1Q 1YJNP 4GOFA 4WZ3B 1M57D 3B5NB 2KNCA 1KB9E 1BCCJ 3Q5RA 1AV1A 3LIDA 3KDEC 2ZJSE 1EZVE 1VQKP 3S4RA 1OX3A 1VQ9P 3AE9C 4KJMA 3AE5C 5D1MB 5BVZA 3EFGA 2OQQA 1L0LK 3O35A 2P57A 3WUVA 1HF9A 2MD8C 4PD4E 3VN0A 1R5LA 1Z6UA 5GTHE 3O47A 1WILA 5B75A 1KILA 1SQPE 1RMDA 1WEWA 1HBWA 2WSEJ 1BORA 1LDJB 1SQPJ 2N1TC 1RE3A 2VJEB 2K9JA 3RK3C 1AQTA 2YXRB 1YQ3C 1RF1C 1RE4C 1SLQA 3H25A 4Z1MH 2XB1A 2OTJP 3T97A 4H0LC 5B77A 3S1KA 2YKPA 3BCCG 3A2AA 5KTBA 1H0TB 4Z0OA 5AVUB 2KWJA 1SQVK 4R4MA 4AUQB 1IFIA 3E1RA 2OWAA 4IC3A 3B4SA 1NU1E 3PTZA 1WRGA 1WEVA 3L70D 1S5LX 2Q5UA 2M3HA 5CCHC 3G6EP 1L0LG 2L43A 3AE4C 3QZVA 3GMAA 2NPSC 3LQIA 3FGAD 2YT5A 2A06G 3QWOC 1ZMEC 4N3YB 1LT9A 3AE7C 1RF1B 2PGDA 1LWUA 5JG6A 4H0LB 5LKTA 2OARA 1K05A 2M3EA 2Q9IA 3L74G 4PTBA 5AITA 3P7KA 3D71A 1AVOA 2QVAA 4O9BA 2VPEA 2JWDA 1YJWP 3WU2E 1SQQD 1KQLA 2HFED 2C0WA 1SQVG 1P84I 3S9OA 5AVSB 1OVVA 1CSBA 2ECVA 4LKAA 1LTTC 3CMEP 4PPEA 3PHLA 1OXZA 4N4FA 4L7XA 2LXBA 4ZNCA 2IZ1A 1SQXJ 2D2CD 5SVYA 1VQOP 1UIIA 1LTBC 5APUA 3BATA 4N3WA 1X4IA 2IPPA 3O70A 2CPSA 1UIXA 1SQBE 3CXHI 3H1LE 1SQBJ 1L4AA 3H1LJ 2K1AA 1PGPA 1HGVA 5KH9A 1BE3D 2KK7A 3HD7C 1VQ7P 2R32A 1SFCB 1G1IA 2GUVA 2P10A 2V7QJ 2QJYC 4DZOA 3QH9A 3H1HG 3V4QA 2DW3A 3H1JD 4JPZB 1FZFA 2E5YA 1RQUA 4WY4D 5KAFH 3AE6C 2H43A 3Q1DA 2CKLB 3U5MA 4UB8E 4B86A 5B76A 3I56P 4X3GA 2CT2A 1BGYG 1FZCA 3RPGC 3M9BA 1CI6A 3GHGC 3MTUE 4OGQD 2F6JA 3H1KD 2KOGA 1FDMA 4BRYA 1NTZE 1S1CX 2CPBA 4FO9A 3BCCE 4H13D 1NTZJ 2NRGA 1TU3F 3AEDC 4C7NA 2VPDA 1HJ0A 3Q3DA 1QL1A 1YITP 4OGCA 1DIPA 2RR4A 3JSVC 2KWOA 1VQPP 1WE9A 3L73D 4RKUJ 1GL2B 4F52B 2O01N 1PPJG 3M0DC 2O01J 1PIXA 2VPBA 2ECIA 2ZETC 2A06E 2ZYDA 5G04B 3ITKA 5KJ7A 3OJAB 3GHGB 2YQLA 1N73B 3HTKC 5CBNA 3NFQA 2FUUA 4JQ0D 2IBZE 1GU4A 2QJKB 4N78D 1CHCA 3L74E 3O6QB 3B5ND 3LIEA 2FSAA 3ZVZB 3P8CD 2CSYA 2Y43A 5GTIH 3ZTGA 3RL0B 1NKZB 2FXPA 3L37A 5TABA 1WEQA 1GDTA 2XU6A 2JMJA 2PFXA 1MUUA 1IFDA 3JCUH 1M1JB 1NO4A 1P84H 2DX8A 5SVXA 3KQIA 3VMAA 3HTKB 4R8PK 3FM8C 3O34A 3FANA 1PL5A 1JY3O 2OTLP 2OYIA 2AXTE 4W7ZA 2ZFCA 2JDIH 4QF2A 3AE3C 1S4XA 2CK3H 4RO0A 1BSNA 1X22A 1LP1B 1KZUB 1IFPA 2WPRA 4FIPA 3CXHH 5H1UA 2WITA 1T1HA 2ZYAA 5KKZC 3G71P 3H1HE 3MP7B 2YHNA 2BEQD 2Y9YA 2KE1A 1G2CA 4ZMDA 1JO5A 2J5UA 2RSDA 1L0NK 2XEUA 4C9ZA 1FAVA 2K88A 5APVA 2KUBA 2MJZA 2DSMA 2KR4A 1WIMA 1KB9D 1ZW0A 3GF3A 2IX7C 1EZVD 1Q2NA 3L35A 5AW1B 2DJAA 5K3QA 4IC2A 2KS1A 4I7BA 3L71G 2HODA 1HTLC 1FP0A 2FUIA 5BU5A 2PNXA 4PD4D 3N9NA 5KKZB 2C9LY 2M13A 2LXCB 1W5CE 2VJFB 2L5UA 2JEEA 2V4HA 1SQPD 4D6TE 2MT5A 1PPJE 3VMXA 4D6TJ 4R7EA 2HPCB 4I6MC 5J3XA 2FFDA 2D2CC 2YKOA 3FL2A 2W6AA 3FX0A 4L74A 1L0NG 3L1XA 3CWBG 2L80A 2PP6A 1YI2P 3KDPB 2B88A 3H1KJ 5KLVK 1DEEG 1M1KQ 2M5AA 2Y9ZA 5LKZA 2WSCH 1NU1D 1VPCA 5SVIA 4F1PA 1AJYA 4V3KC 3BRTB 1PZQA 2Q3IA 1VF5C 2ZAEB 1GD2E 4KHXA 1KV4A 1YYCA 5AW2B 3L73J 1OVUA 2VNFA 4ZDTA 1JY3N 1KYOI 1R5SA 2KKXA 3L72E 2OTKE 2LN0A 2W8ZA 2P1JA 2K37A 4OGQC 3C6WA 4A0CD 2HYNA 1WFKA 3V43A 1LTSC 2LDRA 3IF4A 2WT7B 2B87B 1FZBA 3G9RA 1L2PA 2AEFA 1DD3A 5TJHA 1KFMA 4H13C 5CCGA 3FJUB 2FYNB 3A0HH 3GW6A 1NTMK 1ZOYC 2OYHC 1NOHA 3VMYA 4V3LC 3P8MC 1S9KE 3ASLA 5KLVG 2ITAA 2M0BA 3MGNA 2Q3EA 1JEKA 1RY3A 4MSXA 1PGJA 5APSA 2O1JA 1HUCA 3VK6A 4WY4B 1ZP0C 1OFCX 2FYZA 2Q6QA 3G3ZA 2ZT9D 1ZV8A 2BCCG 5AW3B 4CCGX 3L75G 3Q1MA 1JM0A 1GL2D 1LT1A 4AYCB 1HWTC 2MUMA 3LJUX 1RF0C 4YBMA 2LGLA 1GZLA 2FYUE 5FB0A 3I2DA 2FYUJ 4H13B 1WT6A 2H7HA 1SQBD 4YPCA 3H1LD 3B5NC 2OYHB 3VP9A 3MHVA 1EQ7A 1JY2O 5APTA 3H1IE 1VQ6P 2WPSA 5M1BA 3HCUA 3BASA 1R8EA 3EFFK 3V6IA 4LC1A 4C7RA 3L71E 1NTMG 2B89A 1MZ9A 5H1TA 3CMAP 2GA1A 4WVZA 2XOYA 3M06A 4WZ0A 1D7MA 4U3FE 1N2DC 2YVRA 5B78A 4YAXA
chains in the Genus database with same CATH topology
2I1JA 5AW9B 1G2CB 1ZR2A 5AVSB 1DX7A 1E4UA 2I50A 1ZBDB 1CSBA 1HH0A 2YQMA 3M63A 2ECVA 4LKAA 4YBSA 2W6BA 1LTTC 4GNDA 4PPEA 3NG2A 3BRVB 5D1LB 1OXZA 2MIQA 4N4FA 1J1EB 1WEMA 4L7XA 1G25A 1JM7A 1NHLA 2BASA 4XA4A 4UI9B 3E1IA 2F42A 1GU5A 3KYQA 2YREA 1JTHB 2LXHC 4O64A 5TRBA 4WY4C 3VP8A 2E6SA 5AW0B 3MHSA 2O01H 3TK1A 1F62A 1ZR4A 3T6RA 1LTBC 5APUA 1MM2A 2OXQC 3BATA 2FYUK 2WPQA 1IFNA 4N3WA 1LTAC 2GM4A 1T2KD 1X4IA 2IPPA 4IFFA 2CPSA 1MV8A 2KYUA 3O70A 3RK2D 2HODB 1URQB 2N1TA 4BHWA 2D8SA 1L4AA 5FEYA 1N7SB 2KGGA 3O8ZA 3V2NA 3PUQA 1HGVA 4W4UA 1N86A 5KH9A 1E5WA 2VJFA 1RF1A 1RE4A 3HD7C 2R32A 1SFCB 2KFTA 5AVTB 1G1IA 2GUVA 3M9QA 2JRJA 2KB7P 5TDWA 4DZOA 2HPCA 1ZN5A 1SVFA 4AUWA 3U59A 3V4QA 2YMYA 3HE4B 2FFDB 5APWA 5CJ0A 1YTZT 1FOSE 2JMIA 2QJ0A 4L58A 1T8ZA 1ZLLA 2H0DB 2YUCA 4GNFA 1LTJB 2ZXEB 1FZFA 2RI7A 3HRNA 4WY4D 5AW8B 2H43A 3KV6A 3SHBA 2CKLB 2YU4A 3U5MA 2ECWA 4B86A 5B76A 4X3GA 1XTCC 2P2UA 2IDAA 2CT2A 1FZCA 4R2YA 4LLHA 3TYYA 1QL2A 3H32A 1RF0A 3M9BA 1CI6A 4I1LA 5CCHA 3M99A 4YBTA 5FB1A 3GHGC 3MTUE 1Z2QA 2F6JA 1Z56A 2Y1NA 3TNUA 2NPSA 5CMZA 2KOGA 1G1JA 4W80A 2M1RA 1FDMA 3HUSB 1H88A 2MD7B 2KSJA 2GUSA 2L5GB 3B5NA 1NH4A 2CPBA 2FKWB 2N1TD 1X79B 4FO9A 2UZGA 4UP5A 1L4AD 5AIUA 5C11A 1SQXK 4I7CA 1AQ5A 2KGIA 4C7NA 2LGGA 3OAKA 1LDKC 2VPDA 4A4BA 1QL1A 2YO3A 4JYCA 2NAAA 2KWKA 1JTHA 2MNYA 1WEEA 3DPLR 4LLBA 3ZYQA 1JY2N 3HCSA 2KWOA 2C0XA 1WE9A 1GL2B 4F52B 3GV4A 1HYIA 2IFMA 1SQBK 3EQ2A 4GNEA 3M0DC 2FXMA 4YABA 5LCWB 5CHXA 5DKAA 3ZVYA 2VPBA 3II6A 2ECIA 2ZETC 2XV5A 5G04B 2W27A 2WT7A 1CW5A 3HCTA 3V4WA 2HDPA 3T7LA 2XKMA 2JJLA 5KJ7A 3OJAB 5AW5B 3L36A 3A7OA 3GHGB 2YQLA 4B7YC 4HH2A 2VJEA 1N7SC 2HLOA 1N73B 3I5CA 3U1CA 3HTKC 3MD0A 5I3LA 1NAFA 3NFQA 1U6GB 2FUUA 2LRIC 4GIFA 1LT9C 2C2VS 3UIAA 2ECNA 1X4UA 1SFCC 3OA7A 1GU4A 1FBMA 1CHCA 4N78D 3C9IA 1GW3A 3B5ND 4LJNA 3ZPVE 3LIEA 1SQQK 4WA6A 1JCDA 1NKNA 2FSAA 3ZVZB 4MVTA 3P8CD 2FFDC 5BU8B 4YC9A 3SOXA 2E43A 2CSYA 4JF7A 4WY4A 1IFMA 2Y43A 4P5OB 4LGDE 1LTJC 4Q6FA 2POHA 3ZTGA 4ZUXU 1NU1K 2J58A 3RL0B 5D1KB 5AW6B 1WESA 1NKZB 3HE5A 5AVZB 4GT1A 4XE5B 3ZNIA 3L37A 2J59M 4AYCA 4W7YA 1N87A 1GDTA 2XU6A 1WEQA 5TABA 1NTZK 1XWHA 2JMJA 1VDFA 3WMM0 1MUUA 3A3YB 1URQD 1IFDA 3N9PA 2QM7A 5APXA 1M1JB 1NO4A 3HD7A 1GTWA 1V87A 2DX8A 2P7JA 3O33A 2VPGA 3HUSC 3KQIA 3U5NA 5KJ7D 3HTKB 4R8PK 4WBAA 1T3JA 4ZKUA 2OYHA 3U1AA 4RESB 1SFCD 1LT9B 2ECGA 3O34A 4GKGA 2QM8A 1LWUB 4LK9A 2ECJA 3CL3D 1JY3O 2K17A 2YW8A 1SP4A 3V2QA 2OYIA 5AW4B 5AVYB 2R3CA 5FERA 2HYED 4W7ZA 1JNMA 2ZFCA 3M9HA 2KWNA 4QF2A 1GL2C 4OH8B 1J2JB 3C5KA 4S3OC 2KIZA 3NXSA 2Z5IA 1GW4A 3R2PA 3A5TA 3P32A 3U5OA 1KZUB 5AW7B 3N9QA 2XNXA 3M91A 3L1ZB 2KREA 4GNGA 1JY3P 1GK4A 3N9OA 2R5DA 2WPRA 4FIPA 5H1UA 2WITA 1T1HA 2A45G 3PURA 2YHOA 2WZ7A 3CLQA 3V5BA 2KYVA 1KILC 3H6PA 1OWAA 4N78E 1A02J 1FZEA 2YHNA 2G45A 5CCGC 2KE1A 5KH3A 1G2CA 2XDJA 1RE3C 1N73C 2QIZA 3P8CE 2YYRA 1JO5A 2RSDA 1L0NK 2P67A 3PP5A 2AN6A 2F6NA 2XEUA 3CI9A 4C9ZA 1FAVA 2G43A 1WEUA 2YNYA 3HD7D 5APVA 2MJZA 2G6QA 1DEBA 5LKXA 1YTZI 4C46A 2MA5A 1IK9A 3IFMA 1GK6A 2Z5HA 2KR4A 5CJ4A 1JM7B 3PHDA 2N9BA 5DINA 1WIMA 2K4DA 4UP0A 1FU1A 2MA6A 2CSZA 2Z4EA 2IX7C 2M8RA 4M3LA 4B86C 3L35A 4YADA 3MHHA 1VYXA 1W2EA 5AW1B 3B8EB 3RL0C 4IC2A 1WEPA 3KPEA 4S3OB 4I7BA 2A45I 5AVRB 2HODA 2YURA 2WWWA 5APQA 1URQA 1H8AA 1HTLC 1LTIC 2N1TB 2YO2A 1FP0A 2R5BA 3M0AA 2FUIA 1L4AB 3KNVA 1N7SA 5BU5A 4EOTA 2PNXA 5H1VA 2H8PD 3N9NA 1M7LA 1JOCA 4I2LC 2C9LY 2M3BA 1KILB 1M1JC 2WSFH 1NTKK 3RK3B 5CCGD 2LQ6A 2VJFB 5EYAF 3LW5H 1H89A 3V2RA 2L5UA 1SFCA 2JEEA 2KU3A 4FK5A 1AFOA 2M85A 3NTNA 2MT5A 3VMXA 1JUNA 2LGVA 4R7EA 2HPCB 1IJDB 1IC2A 4I6MC 5J3XA 2FFDA 3HE4A 2EA6A 1LWUC 2VRSA 2YKOA 5AVWB 2H0DA 2M6MA 1LTJA 3FL2A 3LQHA 2W6AA 4Y99C 2ECTA 5H9MA 3N4XA 1J1DC 4HYTB 1VD4A 3U5PA 1S9KD 4A49A 1T2KC 4QF3A 2CKLA 2KLVA 2LXPC 2WTYA 3N9MA 4CA1A 3L1XA 3RK2C 2L80A 2PP6A 3RL0D 4JYBA 3KDPB 3EB6A 4DOJA 1FZCB 5B79A 5AVVB 2BAYA 3H32B 4A4CA 1X8YA 5KLVK 2L0BA 2XZRA 2NPSB 5AVQB 3TNUB 5LKZA 1VFYA 4AVXA 1HYJA 2WSCH 1LTGC 3HUSA 5AVXB 1VPCA 4WZ3B 3B5NB 3VOPA 1N7LA 1IO4A 2O1KA 1Z60A 3N9LA 1N7SD 2L75A 3LIDA 1FOSF 3GL6A 4V3KC 1HVVA 3BRTB 3RPGC 5TBNA 4C7NB 5LKUA 4N6JA 3M62A 3SOWA 2Q3IA 3IHPA 1GD2E 4KHXA 3VTPC 2VP7A 3LQJA 1CZQA 1YYCA 5AW2B 2VNFA 4ZDTA 5D1MB 3DQVR 5BVZA 3EFGA 4XI1A 1GL2A 1JY3N 1L0LK 3O35A 2EODA 2LN0A 4Y99B 1A02F 5C13A 5APYA 4ZKPA 1MM3A 3O36A 4AQRD 3SOUA 2LGKA 1J1DB 2MD8C 4BBQA 4IFDK 2P1JA 3VN0A 2QICA 3C6WA 5KH7A 3RK2B 1Z6UA 4A0CD 2HYNA 1WFKA 3V43A 1LTSC 2LDRA 4FJCA 2WT7B 1WILA 4GB0A 1FZBA 2IFNA 5B75A 1KILA 3SWFA 1RMDA 3MUDA 1LGHB 3GHGA 1HBWA 1WEWA 1BORA 1LDJB 2N1TC 4NN2A 1KFMA 5CCGA 1JCCA 1L4AC 1RE3A 2VJEB 1N73A 2PAJA 1NTMK 3O7AA 3BVHA 1HGZA 4YATA 2OYHC 2LKMA 3RK3C 1NWQA 4EIJA 2HG5D 1NOHA 1T3UA 3VMYA 4V3LC 3MIWA 3P8MC 1RF1C 1RE4C 1X9VA 1SLQA 1S9KE 3ASLA 2XB1A 3KQGA 2OYIC 3T97A 3MGNA 2E6RA 1IFJA 5B77A 1WGMA 1FBVA 5G05B 2YKPA 1RY3A 4MSXA 2Y1MA 5APSA 2O1JA 1HUCA 3A2AA 5KTBA 3VK6A 2I1KA 4WY4B 3TSIA 5B8DA 2FYZA 5AVUB 5G0FA 2KWJA 2MNZA 1SQVK 3G3ZA 1FZAA 4AUQB 1IFIA 4IFMA 3ZPV1 1KFNA 1ZV8A 5AW3B 2YSMA 4IC3A 3M0DA 4CCGX 2Q7CA 3HE5B 1GL2D 1XTGB 1WRGA 1X4JA 1JMMA 1WEVA 4AYCB 1HWTC 2C9NY 2MUMA 4WB4A 5TDRA 1FZCC 1MFZA 1HJBA 3EB5A 1RF0C 2Q5UA 5CCHC 2M3HA 4YBMA 2LGLA 2L43A 1GZLA 1M1JA 1WENA 3KV5A 5FB0A 3QZVA 2NPSC 1FJPA 3I2DA 3LQIA 3HD7B 2E42A 2YT5A 1WT6A 2H7HA 3SWYA 4LADB 2K16A 1KILD 3HTKA 3RK3D 2WSEH 3O37A 2C2LA 1DH3A 3B5NC 4N3YB 2OYHB 3N7NA 1LT9A 3VP9A 2K1JA 1RF1B 1EQ7A 1JY2O 1J1EC 5APTA 2EGPA 4WZ2A 1LWUA 2JMDA 2WPSA 3HCUA 3LRQA 4AP4A 3BASA 3IR9A 2LV9A 2OYIB 5JG6A 4LC1A 4C7RA 2KP8A 1FZGA 5LKTA 3L4FA 1WEOA 1FJKA 1MZ9A 5H1TA 2OARA 3VYIA 2PUYA 1DVPA 2YSJA 3V2PA 1SQPK 4TKPB 2Q9IA 3M06A 4I7DA 4WZ0A 3RTRB 3RPGB 4PTBA 5AITA 1JY2P 1URQC 3P7KA 3L11A 2A45H 4O9BA 2VPEA 1N2DC 2YKQA 5CCHD 5B78A 1KQLA 2HFED 3VMZA 4YAXA 2C0WA 5KJ7C 1IYMA 1CI6B 3NMDA 2NPSD 4ZQLA 1K2FA 1PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E4U A;  2I50 A;  1ZBD B;  2YQM A;  3M63 A;  2ECV A;  4LKA A;  4YBS A;  2W6B A;  4GND A;  4PPE A;  3NG2 A;  3BRV B;  5D1L B;  2MIQ A;  4N4F A;  1WEM A;  4L7X A;  1G25 A;  1JM7 A;  4UI9 B;  2F42 A;  2YRE A;  2LXH C;  4O64 A;  5TRB A;  1K2F A;  2E6S A;  3MHS A;  1F62 A;  3T6R A;  1MM2 A;  2OXQ C;  4N3W A;  1X4I A;  2KYU A;  3O70 A;  4BHW A;  2D8S A;  5FEY A;  2KGG A;  3PUQ A;  4W4U A;  5KH9 A;  2VJF A;  2KFT A;  2JRJ A;  5TDW A;  2QJ0 A;  2JMI A;  4L58 A;  2YUC A;  2H0D B;  4GNF A;  2RI7 A;  3KV6 A;  3SHB A;  2CKL B;  2YU4 A;  3U5M A;  2ECW A;  5B76 A;  4X3G A;  2IDA A;  2CT2 A;  4R2Y A;  3RPG C;  3M99 A;  4YBT A;  5FB1 A;  1Z2Q A;  2F6J A;  2Y1N A;  2M1R A;  2MD7 B;  4FO9 A;  2UZG A;  4UP5 A;  5AIU A;  5C11 A;  4I7C A;  2KGI A;  2LGG A;  1LDK C;  2VPD A;  4A4B A;  2NAA A;  2KWK A;  2MNY A;  3DPL R;  1WEE A;  4LLB A;  3ZYQ A;  3HCS A;  2KWO A;  1WE9 A;  4F52 B;  3GV4 A;  1HYI A;  3EQ2 A;  4GNE A;  4YAB A;  5LCW B;  5DKA A;  3ZVY A;  2VPB A;  2ECI A;  2ZET C;  5G04 B;  3HCT A;  2HDP A;  3T7L A;  4B7Y C;  2YQL A;  2VJE A;  3HTK C;  5I3L A;  1U6G B;  2FUU A;  2LRI C;  2C2V S;  2ECN A;  1X4U A;  1CHC A;  4LJN A;  3ZPV E;  4WA6 A;  2FSA A;  3ZVZ B;  4MVT A;  4YC9 A;  3SOX A;  2CSY A;  4P5O B;  2Y43 A;  4Q6F A;  3ZTG A;  4ZUX U;  5D1K B;  1WES A;  3ZNI A;  1N87 A;  5TAB A;  1WEQ A;  4AYC A;  1XWH A;  2JMJ A;  3N9P A;  1V87 A;  2DX8 A;  3O33 A;  2VPG A;  3KQI A;  3U5N A;  4R8P K;  2ECG A;  3O34 A;  4LK9 A;  2ECJ A;  3CL3 D;  2K17 A;  2YW8 A;  5FER A;  2HYE D;  2KWN A;  4QF2 A;  3C5K A;  4S3O C;  2KIZ A;  3U5O A;  3N9Q A;  3L1Z B;  2KRE A;  4GNG A;  3N9O A;  4FIP A;  5H1U A;  3PUR A;  1T1H A;  2YHO A;  2YHN A;  2G45 A;  2KE1 A;  5KH3 A;  2QIZ A;  2YYR A;  2RSD A;  2F6N A;  2XEU A;  4C9Z A;  2G43 A;  1WEU A;  2G6Q A;  5LKX A;  2MA5 A;  2KR4 A;  1JM7 B;  3PHD A;  5DIN A;  1WIM A;  2K4D A;  4UP0 A;  2MA6 A;  2CSZ A;  4B86 C;  4YAD A;  3MHH A;  1VYX A;  4IC2 A;  1WEP A;  4S3O B;  4I7B A;  2YUR A;  1FP0 A;  2FUI A;  3KNV A;  2PNX A;  5H1V A;  3N9N A;  1JOC A;  2LQ6 A;  2VJF B;  5EYA F;  2L5U A;  2KU3 A;  4FK5 A;  2M85 A;  2MT5 A;  2LGV A;  4R7E A;  5J3X A;  2EA6 A;  2YKO A;  2H0D A;  2M6M A;  3LQH A;  3FL2 A;  2ECT A;  5H9M A;  1VD4 A;  3U5P A;  4A49 A;  4QF3 A;  2CKL A;  2LXP C;  3N9M A;  4CA1 A;  3L1X A;  2L80 A;  3EB6 A;  5B79 A;  2BAY A;  4A4C A;  2L0B A;  5LKZ A;  1VFY A;  4AVX A;  1HYJ A;  4WZ3 B;  1Z60 A;  3N9L A;  4V3K C;  2L75 A;  3GL6 A;  5TBN A;  5LKU A;  3BRT B;  3M62 A;  3SOW A;  3IHP A;  2VP7 A;  3LQJ A;  2VNF A;  4ZDT A;  5D1M B;  3DQV R;  4XI1 A;  3O35 A;  2EOD A;  2LN0 A;  5C13 A;  3O36 A;  1MM3 A;  3SOU A;  2LGK A;  2MD8 C;  4BBQ A;  2QIC A;  3C6W A;  5KH7 A;  1Z6U A;  4A0C D;  1WFK A;  3V43 A;  2LDR A;  4FJC A;  1WIL A;  4GB0 A;  5B75 A;  1RMD A;  1WEW A;  1BOR A;  1LDJ B;  4NN2 A;  2VJE B;  3O7A A;  4YAT A;  4V3L C;  3ASL A;  2XB1 A;  2E6R A;  5B77 A;  1WGM A;  1FBV A;  5G05 B;  2YKP A;  4MSX A;  2Y1M A;  5B8D A;  3VK6 A;  5G0F A;  2KWJ A;  2MNZ A;  4AUQ B;  3ZPV 1;  2YSM A;  4IC3 A;  4CCG X;  1X4J A;  1WEV A;  4AYC B;  2MUM A;  5TDR A;  3EB5 A;  2M3H A;  4YBM A;  2LGL A;  2L43 A;  1WEN A;  3KV5 A;  5FB0 A;  3QZV A;  3LQI A;  3I2D A;  2YT5 A;  4LAD B;  2K16 A;  3O37 A;  2C2L A;  2K1J A;  2EGP A;  4WZ2 A;  2JMD A;  3HCU A;  3LRQ A;  4AP4 A;  2LV9 A;  5JG6 A;  5LKT A;  3L4F A;  1WEO A;  5H1T A;  2PUY A;  1DVP A;  2YSJ A;  4TKP B;  4I7D A;  4WZ0 A;  3RTR B;  3RPG B;  4PTB A;  5AIT A;  3L11 A;  2VPE A;  2YKQ A;  5B78 A;  1IYM A;  2AN6 A;  4ZQL A;  4YAX A; 
#chains in the Genus database with same CATH topology
 3CCR P;  3CPW O;  3E7K A;  4JBZ A;  1HH0 A;  3M63 A;  2W6B A;  5KAF E;  4GND A;  3NG2 A;  5C39 A;  3CC2 P;  1NTZ D;  1G25 A;  2E61 A;  3BCC D;  2BAS A;  4XA4 A;  3KYQ A;  2YRE A;  3MHS A;  4H9D A;  1F62 A;  4YXD C;  2KYU A;  1KIL E;  3RK3 E;  3RK2 D;  2N1T A;  5E79 H;  4BHW A;  1N7S B;  3PUQ A;  3F5H A;  2FFW A;  4W4U A;  2ZYG A;  2A06 D;  1RF1 A;  1RE4 A;  2KSE A;  2KB7 P;  1KOR A;  3RGU A;  4AUW A;  1Y47 A;  3U59 A;  4RJT A;  1K8A Q;  2L91 A;  3K5B A;  5APW A;  1LTJ B;  2ZXE B;  1JB0 J;  1KYO H;  2IBZ D;  3HRN A;  5AW8 B;  3KV6 A;  3L74 D;  1XTC C;  4LLH A;  2RN0 A;  5CCH A;  4I1L A;  4EYY Q;  2QRX A;  3TNU A;  2NPS A;  1NU1 J;  1X0T A;  4W80 A;  2CRW A;  2M1R A;  3HUS B;  2MD7 B;  2KZJ A;  1NH4 A;  2FKW B;  4L73 A;  5AIU A;  5C11 A;  2KNC B;  2ZVO B;  5GTI E;  2BCC E;  2KXP B;  2MNY A;  4LLB A;  4H44 D;  3ZYQ A;  1JY2 N;  2MKV A;  1HYI A;  3AEA C;  4OVN F;  5CHX A;  2Y0D A;  3JCU E;  1VQ5 P;  1P84 E;  2XV5 A;  2W27 A;  1U7J A;  3V4W A;  2HDP A;  3T7L A;  2JJL A;  4IL6 H;  1YBK A;  4EDF A;  2EXU A;  2HLO A;  2K9J B;  3I5C A;  3U1C A;  1NAF A;  1NTM E;  1LT9 C;  2K3R A;  3UIA A;  2C2V S;  2ECN A;  1X4U A;  1YQ4 C;  1SFC C;  3H1H D;  3T97 B;  3ZPV E;  1SQQ K;  2W6J H;  1JCD A;  4MVT A;  4YC9 A;  3CXH E;  2POH A;  5AW6 B;  3L70 G;  3PH0 A;  1T6A A;  3HE5 A;  3SWK A;  1XWH A;  1VDF A;  1PV3 A;  2CRR A;  4YXW H;  3HD7 A;  2CON A;  3O33 A;  2E74 D;  4WBA A;  1T3J A;  2H89 C;  2QEX P;  1LT9 B;  4GKG A;  2QM8 A;  1LWU B;  3B71 A;  3CL3 D;  2K17 A;  5AW4 B;  2JWA A;  5FER A;  2HYE D;  1JNM A;  4D6T D;  2KWN A;  1PPJ D;  1GL2 C;  1M8O B;  3CC4 P;  4S3O C;  2KIZ A;  3NXS A;  2FBW C;  3R2P A;  3P32 A;  3U5O A;  3DDT A;  3A0B H;  1SQQ G;  3L1Z B;  3TGU G;  1BSH A;  4NPD A;  3H6P A;  1OWA A;  2G45 A;  3FAO A;  1N73 C;  4KT0 J;  2YYR A;  1FS0 E;  2P67 A;  2F6N A;  1Y9B A;  3CCV P;  1WEU A;  2JUN A;  2FY8 A;  1DEB A;  1YTZ I;  2QJK C;  3BCC J;  4C46 A;  1GK6 A;  2W90 A;  5CJ4 A;  3PHD A;  2N9B A;  4PV1 D;  2ZT9 B;  2CSZ A;  2Z4E A;  2M8R A;  4M3L A;  4B86 C;  3C1L A;  3B8E B;  3RL0 C;  1WEP A;  1L0L E;  3KPE A;  4S3O B;  2WSC J;  2YUR A;  1JMB A;  1L0L J;  2WWW A;  5APQ A;  1URQ A;  3L72 D;  1SS1 A;  2R5B A;  3KNV A;  1E79 H;  1L4A B;  1BE3 G;  4EOT A;  5H1V A;  2EGM A;  1M7L A;  3FXD A;  1M1J C;  5CCG D;  1NTK K;  5EYA F;  3V2R A;  1OW7 A;  2M85 A;  3FWL A;  3H1J G;  2LGV A;  1IC2 A;  3HE4 A;  2FD4 A;  5AVW B;  2H0D A;  2M6M A;  3LQH A;  3F89 A;  3L74 J;  1J1D C;  3U5P A;  1S9K D;  3ABV C;  4A49 A;  1AA0 A;  4QF3 A;  2KLV A;  2WTY A;  3RBX A;  3RK2 C;  3A0H E;  1FZC B;  5B79 A;  1VQL P;  1SQV E;  4A4C A;  1SQV J;  2XZR A;  2MKE A;  1VFY A;  1USD A;  3CCM P;  5AVX B;  4BRY B;  1OIP A;  1U7M A;  1BDD A;  2XND H;  3VOP A;  1IO4 A;  2O1K A;  1Z60 A;  1N7S D;  2L75 A;  5TBN A;  1HVV A;  4C7N B;  4N6J A;  3M62 A;  3SOW A;  1KMI Z;  2FYU D;  3IHP A;  5DJT B;  3L73 G;  3VTP C;  3LQJ A;  1CZQ A;  2KIK A;  1NTK G;  1ZRT E;  2QIW A;  4XI1 A;  5APY A;  3O36 A;  3SOU A;  2QSI A;  4HKZ H;  3H1I D;  2LGK A;  1J1D B;  1IZN B;  3AEB C;  2QIC A;  5KH7 A;  3RK2 B;  2XOZ A;  3PLW A;  3L71 D;  4FJC A;  4GB0 A;  2W83 C;  3SWF A;  3MUD A;  1LGH B;  4I7Z C;  1JCC A;  2WSF J;  1M90 Q;  3LW5 J;  3BVH A;  1HGZ A;  4YAT A;  3D6Z A;  1DD4 A;  4EIJ A;  2HG5 D;  1T3U A;  4U3F D;  3MIW A;  3H1H J;  4H44 C;  1X9V A;  3CX5 H;  2KZI A;  3KQG A;  2OYI C;  4HJG H;  1IFJ A;  1WGM A;  1FBV A;  2ZVN B;  2Y1M A;  4PJ0 H;  2I1K A;  3TGU E;  1BGY E;  4IFM A;  3ZPV 1;  1BGY J;  2YSM A;  2Q7C A;  2C9N Y;  4WB4 A;  4UB6 H;  1KQF B;  2E75 B;  1WEN A;  2JP3 A;  1M56 D;  4I7Z B;  1FJP A;  5H2F H;  1KIL D;  3RK3 D;  5CBO A;  3N7N A;  2E5T A;  2K1J A;  4WZ2 A;  1J1E C;  2V7Q H;  1YIJ P;  4H44 B;  3IR9 A;  2LV9 A;  2OYI B;  3G4S P;  3M7K A;  1WEO A;  4DJG A;  2PUY A;  1DVP A;  5E79 E;  1SQP K;  1GMJ A;  4I7D A;  3C8V A;  1PP9 G;  3L11 A;  2WQY C;  2YKQ A;  5CCH D;  2B9B A;  1QX8 A;  2XOC A;  3SSU A;  1RHZ B;  2E74 C;  1IYM A;  3NMD A;  2NPS D;  2AN6 A;  1PFI A;  2FYN C;  1G2C B;  1ZR2 A;  2IZ0 A;  1DX7 A;  1E4U A;  2I50 A;  1KYO E;  3AEE C;  1BCC G;  3BRV B;  1J1E B;  1JM7 A;  2IDB A;  1EZV G;  2LAU A;  3E1I A;  3FEH A;  1JTH B;  4O64 A;  4WY4 C;  2E6S A;  2BCC D;  2O01 H;  3TK1 A;  3T6R A;  1MM2 A;  1IFN A;  1LTA C;  2GM4 A;  2KS1 B;  3L72 J;  3Q2Y A;  2HOD B;  5B66 H;  3W68 A;  2QE7 H;  2E76 D;  1MFT A;  1KTM A;  3V2N A;  2E74 B;  1SQP G;  1N86 A;  1P84 D;  4OGE A;  1NTK E;  5AVT B;  1PGO A;  5TDW A;  1ZN5 A;  1SVF A;  4PV1 C;  2N9Y B;  4K35 A;  2FFD B;  1FOS E;  5CJ0 A;  1T8Z A;  4GNF A;  1NTM D;  3IN6 A;  2RI7 A;  2YU4 A;  2ECW A;  4IL6 E;  4L75 A;  3TYY A;  3H32 A;  1RF0 A;  5FB1 A;  3MDB C;  1MKM A;  1Z56 A;  3CXH D;  3KZI H;  4HB1 A;  5CMZ A;  3CCQ P;  2M5A B;  1H88 A;  2GUS A;  3B5N A;  5SVI B;  2UZG A;  1BDC A;  1L4A D;  1EXI A;  1SQX K;  3Q5S A;  1AQ5 A;  2KGI A;  4I7C A;  3OAK A;  4A4B A;  4JYC A;  2Y0E A;  3DPL R;  4PV1 B;  3HCS A;  2C0X A;  2LR2 A;  3H1I J;  1SQB K;  3EQ2 A;  4YAB A;  5LCW B;  3L71 J;  3E2D A;  2G3A A;  1EDJ A;  3GLM A;  1CW5 A;  3HCT A;  4QQ4 A;  2XKM A;  1VQ4 P;  5AW5 B;  3RL0 g;  3L36 A;  2YIU B;  2VJE A;  1N7S C;  3MD0 A;  4U3F J;  1U6G B;  4GIF A;  1QGK B;  2QJP C;  2JO1 A;  3D70 A;  2CSV A;  3C9I A;  1VL2 A;  4WWI A;  1GW3 A;  4LJN A;  4BWN A;  1PP9 E;  4WA6 A;  3LVR E;  5EFW B;  1L0N E;  2E43 A;  4P5O B;  4JF7 A;  3CWB E;  1IFM A;  3A0B E;  1L0N J;  4LGD E;  1H0T A;  1LTJ C;  3GG2 A;  4Q6F A;  1SQX G;  2FXO A;  2J58 A;  3USS A;  5D1K B;  4IL6 X;  1WES A;  5AVZ B;  4XE5 B;  3ZNI A;  2J59 M;  2KKY A;  3SFD C;  1NTZ K;  3A3Y B;  1URQ D;  1FE6 A;  1OMI A;  1BCC E;  5APX A;  1SQB G;  3H1L G;  1Y8A A;  1L0L D;  1VQ8 P;  3HUS C;  5KJ7 D;  1EXJ A;  4RES B;  2QJP B;  4LK9 A;  2IQJ A;  2YW8 A;  1SP4 A;  3V2Q A;  1Q86 Q;  1KB9 I;  2R3C A;  1EDI A;  4BXL A;  3M9H A;  5KAI H;  1EZV I;  3DWD A;  3C5K A;  2WMM A;  2Z5I A;  1GW4 A;  3KHU A;  1JY3 P;  1GK4 A;  1KC8 Q;  2R5D A;  2JR8 A;  2YHO A;  3CLQ A;  2KYV A;  4PD4 I;  1KIL C;  1FZE A;  2H88 C;  2QG4 A;  5KH3 A;  1RE3 C;  5KLV E;  1SQV D;  5KLV J;  1EDL A;  2E75 D;  3PP5 A;  3CI9 A;  2IYP A;  3D6Y A;  1NTZ G;  2G43 A;  2YNY A;  2G6Q A;  2P58 A;  5LKX A;  3T9K A;  2MA5 A;  1IK9 A;  2Z5H A;  2L7P A;  4UP0 A;  3L75 E;  2SPZ A;  2BCC J;  3AEF C;  3L75 J;  3WUU A;  5B5E H;  1VYX A;  1W2E A;  1ZRT D;  2A45 I;  1H8A A;  2R3S A;  1LTI C;  2N1T B;  1KN7 A;  5TIS H;  2PRR A;  4I2L C;  4Z0R A;  2M3B A;  1KIL B;  3RK3 B;  1LNQ A;  2HR3 A;  1NJI Q;  4A7P A;  3AEC C;  1FC2 C;  1SFC A;  2B0O E;  3W67 A;  4FK5 A;  1AFO A;  3NTN A;  1JUN A;  1OW6 A;  1NTM J;  2IBZ G;  1LWU C;  2VRS A;  2JM3 A;  2RKL A;  3JUE A;  4Y99 C;  2ECT A;  3N4X A;  3KXD A;  2NZ2 A;  2CKL A;  3CCU P;  2LXP C;  4CA1 A;  4JYB A;  3EB6 A;  3GF7 A;  1FDI A;  1USE A;  1Q81 Q;  5AVV B;  2E76 C;  3TGU D;  1K73 Q;  1X8Y A;  2L0B A;  1BGY D;  3TNU B;  2NPS B;  4TLF A;  1HYJ A;  1LTG C;  3CX5 E;  1Q82 Q;  3FXE A;  1N7L A;  3N9L A;  1FOS F;  3GL6 A;  5LKU A;  4PJ0 E;  1SQX E;  5KLI C;  2VP7 A;  1NGM B;  5L8R J;  3CX5 I;  3ZDM A;  1NVO A;  3DQV R;  1GL2 A;  2EOD A;  4Y99 B;  1A02 F;  5C13 A;  4ZKP A;  1MM3 A;  2ZT9 C;  4AQR D;  4UB6 E;  2YXQ B;  4BBQ A;  4IFD K;  3SUB A;  5H2F E;  2IFN A;  3GHG A;  2E76 B;  4NN2 A;  1L4A C;  3AE2 C;  1N73 A;  2PAJ A;  3O7A A;  1S5L H;  2K9Y A;  4GDO A;  2LKM A;  1NWQ A;  4ASV A;  1VF5 D;  3O6Q A;  1EC5 A;  2E6R A;  5KLI B;  5G05 B;  1KB9 H;  4DCK A;  5B8D A;  3TSI A;  5G0F A;  1KYO D;  1VQM P;  2MNZ A;  1FZA A;  3TF5 A;  1S72 P;  1KFN A;  1K9M Q;  3M0D A;  3I55 P;  3HE5 B;  1XTG B;  1X4J A;  1JMM A;  5TDR A;  1FZC C;  1AVY A;  1MFZ A;  1HJB A;  3EB5 A;  1QLE D;  4PD4 H;  1M1J A;  3KV5 A;  3HD7 B;  2E42 A;  1RQV A;  1N8R Q;  5GTH H;  3SWY A;  4LAD B;  2K16 A;  1U57 A;  3HTK A;  3O37 A;  2WSE H;  2C2L A;  1DH3 A;  2UWJ E;  2XP0 A;  2QJY B;  2WVR A;  2EGP A;  2JMD A;  3LRQ A;  4AP4 A;  4D6T G;  3Q5P A;  4TT3 H;  1OZH A;  2KP8 A;  1NTK D;  1FZG A;  3L4F A;  1FJK A;  3PRJ A;  3VYI A;  5B66 E;  2YSJ A;  3V2P A;  4GOD A;  4TKP B;  1W2B O;  1YJ9 P;  3AE1 C;  3RTR B;  3RPG B;  1Q7Y Q;  1JY2 P;  1LP1 A;  1URQ C;  2Q1K A;  2A45 H;  3SFE C;  2OYO A;  3LDY A;  3H1K G;  3VMZ A;  5KJ7 C;  1CI6 B;  4ZQL A;  1K2F A;  2I1J A;  1NAY A;  5AW9 B;  1Q90 D;  1ZBD B;  2YQM A;  4YBS A;  5D1L B;  2MIQ A;  1WEM A;  1QVG O;  1NHL A;  4YTP C;  2IBZ I;  4UI9 B;  3L70 E;  2F42 A;  1GU5 A;  2LXH C;  5TRB A;  3L70 J;  3VP8 A;  5AW0 B;  3KZI E;  1ZR4 A;  2OXQ C;  3L72 G;  2FYU K;  2WPQ A;  3MZW B;  1T2K D;  1QEX A;  4IFF A;  1MV8 A;  2JKV A;  1URQ B;  2D8S A;  5FEY A;  1QVF O;  2KGG A;  3LVQ E;  3O8Z A;  2E75 C;  1E5W A;  2VJF A;  2KFT A;  3WU2 H;  2AEM A;  3M9Q A;  2JRJ A;  4CPG A;  1OW8 A;  4QMA A;  2HPC A;  2YMY A;  3HE4 B;  1YHQ P;  2QJ0 A;  1YTZ T;  2YMK A;  2JMI A;  4L58 A;  2YUC A;  1ZLL A;  3RBZ A;  2H0D B;  2QA4 P;  1SQQ E;  1DCQ A;  3SHB A;  1PP9 D;  1SQQ J;  4NPE A;  2P2U A;  1L0N D;  2IDA A;  3TGU J;  4R2Y A;  1QL2 A;  3M99 A;  4YBT A;  3CWB D;  2AEJ A;  3MUD C;  4DT0 A;  1Z2Q A;  2Y1N A;  2OGU A;  1ZXG A;  1S2E A;  1G1J A;  2KSJ A;  5K5G B;  2L5G B;  2N1T D;  1X79 B;  2FYU G;  4UP5 A;  4ASW A;  2LGG A;  1LDK C;  1BCC D;  1S3J A;  2YO3 A;  2NAA A;  4MN4 C;  2KWK A;  1JTH A;  1WEE A;  3H1I G;  4H0L D;  3GV4 A;  2IFM A;  4GNE A;  2FXM A;  1RH5 B;  3CCJ P;  5DKA A;  3ZVY A;  1OVR A;  2IYO A;  3II6 A;  1BE3 E;  2WT7 A;  2D8U A;  2B87 A;  1BE3 J;  2I8D A;  4UB8 H;  4B7Y C;  3A7O A;  2ZXX A;  4HH2 A;  4U3F G;  3H1J E;  5I3L A;  4U7J A;  2KLU A;  3H1J J;  2LRI C;  1FDO A;  1KQG B;  3CCS P;  3OA7 A;  1PGQ A;  3FWN A;  5KAI E;  1FBM A;  4K3A A;  2Y0C A;  1NKN A;  5KLV D;  2FFD C;  5BU8 B;  3SOX A;  2AXC A;  4WY4 A;  4GOE A;  3H1K E;  4ZUX U;  2O3J A;  1NU1 K;  3PLN A;  3TDK A;  5DJU B;  4GT1 A;  1MBM A;  1WMK A;  4AYC A;  1N87 A;  4W7Y A;  3L75 D;  3WMM 0;  3N9P A;  2QM7 A;  3PJS K;  1GTW A;  1V87 A;  2P7J A;  2VPG A;  3JC2 2;  3U5N A;  4ZKU A;  2OYH A;  3L73 E;  3CD6 P;  3U1A A;  1SFC D;  2ECG A;  3H7H A;  4NPF X;  5B5E E;  2D2C B;  4R4L A;  2ECJ A;  1NTK J;  3AEG C;  5AVY B;  3OW2 O;  4OH8 B;  1J2J B;  2RMZ A;  2RH0 A;  5TIS E;  3A5T A;  5AW7 B;  3N9Q A;  1LJ2 A;  2XNX A;  3M91 A;  2KRE A;  4GNG A;  4EI2 A;  3N9O A;  3PUR A;  2A45 G;  3CC7 P;  3CCE P;  2WZ7 A;  3V5B A;  4N78 E;  1A02 J;  1NU1 G;  5CCG C;  2YIU C;  2XDJ A;  2QIZ A;  3P8C E;  1VF5 B;  2WPV B;  3HD7 D;  3CX5 D;  2G8Y A;  1IK7 A;  3IFM A;  4OWF A;  1JM7 B;  5DIN A;  2K4D A;  1FU1 A;  2MA6 A;  3EWK A;  1SQX D;  4OGQ B;  4YAD A;  3MHH A;  2AXT H;  4IOI H;  5AVR B;  2WSS H;  2YO2 A;  2R44 A;  3M0A A;  1N7S A;  2H8P D;  1JOC A;  2WSF H;  2LQ6 A;  4O62 A;  3LW5 H;  1H89 A;  3IAO A;  1VQN P;  2KU3 A;  4Y28 J;  3WUT A;  1IJD B;  1KQS O;  2EA6 A;  1LTJ A;  1K04 A;  5H9M A;  1NYH A;  4HYT B;  1VD4 A;  3AE8 C;  2BEZ F;  1T2K C;  1PP9 J;  3N9M A;  1EDK A;  3RL0 D;  3CWB J;  4DOJ A;  3R4Y A;  1S5L E;  2KI7 B;  3H32 B;  2BAY A;  4L76 A;  5AVQ B;  3CCL P;  4AVX A;  3HUS A;  4XFJ A;  1KD1 Q;  1YJN P;  4GOF A;  4WZ3 B;  1M57 D;  3B5N B;  2KNC A;  1KB9 E;  1BCC J;  3Q5R A;  1AV1 A;  3LID A;  3KDE C;  2ZJS E;  1EZV E;  1VQK P;  3S4R A;  1OX3 A;  1VQ9 P;  3AE9 C;  4KJM A;  3AE5 C;  5D1M B;  5BVZ A;  3EFG A;  2OQQ A;  1L0L K;  3O35 A;  2P57 A;  3WUV A;  1HF9 A;  2MD8 C;  4PD4 E;  3VN0 A;  1R5L A;  1Z6U A;  5GTH E;  3O47 A;  1WIL A;  5B75 A;  1KIL A;  1SQP E;  1RMD A;  1WEW A;  1HBW A;  2WSE J;  1BOR A;  1LDJ B;  1SQP J;  2N1T C;  1RE3 A;  2VJE B;  2K9J A;  3RK3 C;  1AQT A;  2YXR B;  1YQ3 C;  1RF1 C;  1RE4 C;  1SLQ A;  3H25 A;  4Z1M H;  2XB1 A;  2OTJ P;  3T97 A;  4H0L C;  5B77 A;  3S1K A;  2YKP A;  3BCC G;  3A2A A;  5KTB A;  1H0T B;  4Z0O A;  5AVU B;  2KWJ A;  1SQV K;  4R4M A;  4AUQ B;  1IFI A;  3E1R A;  2OWA A;  4IC3 A;  3B4S A;  1NU1 E;  3PTZ A;  1WRG A;  1WEV A;  3L70 D;  1S5L X;  2Q5U A;  2M3H A;  5CCH C;  3G6E P;  1L0L G;  2L43 A;  3AE4 C;  3QZV A;  3GMA A;  2NPS C;  3LQI A;  3FGA D;  2YT5 A;  2A06 G;  3QWO C;  1ZME C;  4N3Y B;  1LT9 A;  3AE7 C;  1RF1 B;  2PGD A;  1LWU A;  5JG6 A;  4H0L B;  5LKT A;  2OAR A;  1K05 A;  2M3E A;  2Q9I A;  3L74 G;  4PTB A;  5AIT A;  3P7K A;  3D71 A;  1AVO A;  2QVA A;  4O9B A;  2VPE A;  2JWD A;  1YJW P;  3WU2 E;  1SQQ D;  1KQL A;  2HFE D;  2C0W A;  1SQV G;  1P84 I;  3S9O A;  5AVS B;  1OVV A;  1CSB A;  2ECV A;  4LKA A;  1LTT C;  3CME P;  4PPE A;  3PHL A;  1OXZ A;  4N4F A;  4L7X A;  2LXB A;  4ZNC A;  2IZ1 A;  1SQX J;  2D2C D;  5SVY A;  1VQO P;  1UII A;  1LTB C;  5APU A;  3BAT A;  4N3W A;  1X4I A;  2IPP A;  3O70 A;  2CPS A;  1UIX A;  1SQB E;  3CXH I;  3H1L E;  1SQB J;  1L4A A;  3H1L J;  2K1A A;  1PGP A;  1HGV A;  5KH9 A;  1BE3 D;  2KK7 A;  3HD7 C;  1VQ7 P;  2R32 A;  1SFC B;  1G1I A;  2GUV A;  2P10 A;  2V7Q J;  2QJY C;  4DZO A;  3QH9 A;  3H1H G;  3V4Q A;  2DW3 A;  3H1J D;  4JPZ B;  1FZF A;  2E5Y A;  1RQU A;  4WY4 D;  5KAF H;  3AE6 C;  2H43 A;  3Q1D A;  2CKL B;  3U5M A;  4UB8 E;  4B86 A;  5B76 A;  3I56 P;  4X3G A;  2CT2 A;  1BGY G;  1FZC A;  3RPG C;  3M9B A;  1CI6 A;  3GHG C;  3MTU E;  4OGQ D;  2F6J A;  3H1K D;  2KOG A;  1FDM A;  4BRY A;  1NTZ E;  1S1C X;  2CPB A;  4FO9 A;  3BCC E;  4H13 D;  1NTZ J;  2NRG A;  1TU3 F;  3AED C;  4C7N A;  2VPD A;  1HJ0 A;  3Q3D A;  1QL1 A;  1YIT P;  4OGC A;  1DIP A;  2RR4 A;  3JSV C;  2KWO A;  1VQP P;  1WE9 A;  3L73 D;  4RKU J;  1GL2 B;  4F52 B;  2O01 N;  1PPJ G;  3M0D C;  2O01 J;  1PIX A;  2VPB A;  2ECI A;  2ZET C;  2A06 E;  2ZYD A;  5G04 B;  3ITK A;  5KJ7 A;  3OJA B;  3GHG B;  2YQL A;  1N73 B;  3HTK C;  5CBN A;  3NFQ A;  2FUU A;  4JQ0 D;  2IBZ E;  1GU4 A;  2QJK B;  4N78 D;  1CHC A;  3L74 E;  3O6Q B;  3B5N D;  3LIE A;  2FSA A;  3ZVZ B;  3P8C D;  2CSY A;  2Y43 A;  5GTI H;  3ZTG A;  3RL0 B;  1NKZ B;  2FXP A;  3L37 A;  5TAB A;  1WEQ A;  1GDT A;  2XU6 A;  2JMJ A;  2PFX A;  1MUU A;  1IFD A;  3JCU H;  1M1J B;  1NO4 A;  1P84 H;  2DX8 A;  5SVX A;  3KQI A;  3VMA A;  3HTK B;  4R8P K;  3FM8 C;  3O34 A;  3FAN A;  1PL5 A;  1JY3 O;  2OTL P;  2OYI A;  2AXT E;  4W7Z A;  2ZFC A;  2JDI H;  4QF2 A;  3AE3 C;  1S4X A;  2CK3 H;  4RO0 A;  1BSN A;  1X22 A;  1LP1 B;  1KZU B;  1IFP A;  2WPR A;  4FIP A;  3CXH H;  5H1U A;  2WIT A;  1T1H A;  2ZYA A;  5KKZ C;  3G71 P;  3H1H E;  3MP7 B;  2YHN A;  2BEQ D;  2Y9Y A;  2KE1 A;  1G2C A;  4ZMD A;  1JO5 A;  2J5U A;  2RSD A;  1L0N K;  2XEU A;  4C9Z A;  1FAV A;  2K88 A;  5APV A;  2KUB A;  2MJZ A;  2DSM A;  2KR4 A;  1WIM A;  1KB9 D;  1ZW0 A;  3GF3 A;  2IX7 C;  1EZV D;  1Q2N A;  3L35 A;  5AW1 B;  2DJA A;  5K3Q A;  4IC2 A;  2KS1 A;  4I7B A;  3L71 G;  2HOD A;  1HTL C;  1FP0 A;  2FUI A;  5BU5 A;  2PNX A;  4PD4 D;  3N9N A;  5KKZ B;  2C9L Y;  2M13 A;  2LXC B;  1W5C E;  2VJF B;  2L5U A;  2JEE A;  2V4H A;  1SQP D;  4D6T E;  2MT5 A;  1PPJ E;  3VMX A;  4D6T J;  4R7E A;  2HPC B;  4I6M C;  5J3X A;  2FFD A;  2D2C C;  2YKO A;  3FL2 A;  2W6A A;  3FX0 A;  4L74 A;  1L0N G;  3L1X A;  3CWB G;  2L80 A;  2PP6 A;  1YI2 P;  3KDP B;  2B88 A;  3H1K J;  5KLV K;  1DEE G;  1M1K Q;  2M5A A;  2Y9Z A;  5LKZ A;  2WSC H;  1NU1 D;  1VPC A;  5SVI A;  4F1P A;  1AJY A;  4V3K C;  3BRT B;  1PZQ A;  2Q3I A;  1VF5 C;  2ZAE B;  1GD2 E;  4KHX A;  1KV4 A;  1YYC A;  5AW2 B;  3L73 J;  1OVU A;  2VNF A;  4ZDT A;  1JY3 N;  1KYO I;  1R5S A;  2KKX A;  3L72 E;  2OTK E;  2LN0 A;  2W8Z A;  2P1J A;  2K37 A;  4OGQ C;  3C6W A;  4A0C D;  2HYN A;  1WFK A;  3V43 A;  1LTS C;  2LDR A;  3IF4 A;  2WT7 B;  2B87 B;  1FZB A;  3G9R A;  1L2P A;  2AEF A;  1DD3 A;  5TJH A;  1KFM A;  4H13 C;  5CCG A;  3FJU B;  2FYN B;  3A0H H;  3GW6 A;  1NTM K;  1ZOY C;  2OYH C;  1NOH A;  3VMY A;  4V3L C;  3P8M C;  1S9K E;  3ASL A;  5KLV G;  2ITA A;  2M0B A;  3MGN A;  2Q3E A;  1JEK A;  1RY3 A;  4MSX A;  1PGJ A;  5APS A;  2O1J A;  1HUC A;  3VK6 A;  4WY4 B;  1ZP0 C;  1OFC X;  2FYZ A;  2Q6Q A;  3G3Z A;  2ZT9 D;  1ZV8 A;  2BCC G;  5AW3 B;  4CCG X;  3L75 G;  3Q1M A;  1JM0 A;  1GL2 D;  1LT1 A;  4AYC B;  1HWT C;  2MUM A;  3LJU X;  1RF0 C;  4YBM A;  2LGL A;  1GZL A;  2FYU E;  5FB0 A;  3I2D A;  2FYU J;  4H13 B;  1WT6 A;  2H7H A;  1SQB D;  4YPC A;  3H1L D;  3B5N C;  2OYH B;  3VP9 A;  3MHV A;  1EQ7 A;  1JY2 O;  5APT A;  3H1I E;  1VQ6 P;  2WPS A;  5M1B A;  3HCU A;  3BAS A;  1R8E A;  3EFF K;  3V6I A;  4LC1 A;  4C7R A;  3L71 E;  1NTM G;  2B89 A;  1MZ9 A;  5H1T A;  3CMA P;  2GA1 A;  4WVZ A;  2XOY A;  3M06 A;  4WZ0 A;  1D7M A;  4U3F E;  1N2D C;  2YVR A;  5B78 A;  4YAX A; 
#chains in the Genus database with same CATH homology
 2I1J A;  5AW9 B;  1G2C B;  1ZR2 A;  5AVS B;  1DX7 A;  1E4U A;  2I50 A;  1ZBD B;  1CSB A;  1HH0 A;  2YQM A;  3M63 A;  2ECV A;  4LKA A;  4YBS A;  2W6B A;  1LTT C;  4GND A;  4PPE A;  3NG2 A;  3BRV B;  5D1L B;  1OXZ A;  2MIQ A;  4N4F A;  1J1E B;  1WEM A;  4L7X A;  1G25 A;  1JM7 A;  1NHL A;  2BAS A;  4XA4 A;  4UI9 B;  3E1I A;  2F42 A;  1GU5 A;  3KYQ A;  2YRE A;  1JTH B;  2LXH C;  4O64 A;  5TRB A;  4WY4 C;  3VP8 A;  2E6S A;  5AW0 B;  3MHS A;  2O01 H;  3TK1 A;  1F62 A;  1ZR4 A;  3T6R A;  1LTB C;  5APU A;  1MM2 A;  2OXQ C;  3BAT A;  2FYU K;  2WPQ A;  1IFN A;  4N3W A;  1LTA C;  2GM4 A;  1T2K D;  1X4I A;  2IPP A;  4IFF A;  2CPS A;  1MV8 A;  2KYU A;  3O70 A;  3RK2 D;  2HOD B;  1URQ B;  2N1T A;  4BHW A;  2D8S A;  1L4A A;  5FEY A;  1N7S B;  2KGG A;  3O8Z A;  3V2N A;  3PUQ A;  1HGV A;  4W4U A;  1N86 A;  5KH9 A;  1E5W A;  2VJF A;  1RF1 A;  1RE4 A;  3HD7 C;  2R32 A;  1SFC B;  2KFT A;  5AVT B;  1G1I A;  2GUV A;  3M9Q A;  2JRJ A;  2KB7 P;  5TDW A;  4DZO A;  2HPC A;  1ZN5 A;  1SVF A;  4AUW A;  3U59 A;  3V4Q A;  2YMY A;  3HE4 B;  2FFD B;  5APW A;  5CJ0 A;  1YTZ T;  1FOS E;  2JMI A;  2QJ0 A;  4L58 A;  1T8Z A;  1ZLL A;  2H0D B;  2YUC A;  4GNF A;  1LTJ B;  2ZXE B;  1FZF A;  2RI7 A;  3HRN A;  4WY4 D;  5AW8 B;  2H43 A;  3KV6 A;  3SHB A;  2CKL B;  2YU4 A;  3U5M A;  2ECW A;  4B86 A;  5B76 A;  4X3G A;  1XTC C;  2P2U A;  2IDA A;  2CT2 A;  1FZC A;  4R2Y A;  4LLH A;  3TYY A;  1QL2 A;  3H32 A;  1RF0 A;  3M9B A;  1CI6 A;  4I1L A;  5CCH A;  3M99 A;  4YBT A;  5FB1 A;  3GHG C;  3MTU E;  1Z2Q A;  2F6J A;  1Z56 A;  2Y1N A;  3TNU A;  2NPS A;  5CMZ A;  2KOG A;  1G1J A;  4W80 A;  2M1R A;  1FDM A;  3HUS B;  1H88 A;  2MD7 B;  2KSJ A;  2GUS A;  2L5G B;  3B5N A;  1NH4 A;  2CPB A;  2FKW B;  2N1T D;  1X79 B;  4FO9 A;  2UZG A;  4UP5 A;  1L4A D;  5AIU A;  5C11 A;  1SQX K;  4I7C A;  1AQ5 A;  2KGI A;  4C7N A;  2LGG A;  3OAK A;  1LDK C;  2VPD A;  4A4B A;  1QL1 A;  2YO3 A;  4JYC A;  2NAA A;  2KWK A;  1JTH A;  2MNY A;  1WEE A;  3DPL R;  4LLB A;  3ZYQ A;  1JY2 N;  3HCS A;  2KWO A;  2C0X A;  1WE9 A;  1GL2 B;  4F52 B;  3GV4 A;  1HYI A;  2IFM A;  1SQB K;  3EQ2 A;  4GNE A;  3M0D C;  2FXM A;  4YAB A;  5LCW B;  5CHX A;  5DKA A;  3ZVY A;  2VPB A;  3II6 A;  2ECI A;  2ZET C;  2XV5 A;  5G04 B;  2W27 A;  2WT7 A;  1CW5 A;  3HCT A;  3V4W A;  2HDP A;  3T7L A;  2XKM A;  2JJL A;  5KJ7 A;  3OJA B;  5AW5 B;  3L36 A;  3A7O A;  3GHG B;  2YQL A;  4B7Y C;  4HH2 A;  2VJE A;  1N7S C;  2HLO A;  1N73 B;  3I5C A;  3U1C A;  3HTK C;  3MD0 A;  5I3L A;  1NAF A;  3NFQ A;  1U6G B;  2FUU A;  2LRI C;  4GIF A;  1LT9 C;  2C2V S;  3UIA A;  2ECN A;  1X4U A;  1SFC C;  3OA7 A;  1GU4 A;  1FBM A;  1CHC A;  4N78 D;  3C9I A;  1GW3 A;  3B5N D;  4LJN A;  3ZPV E;  3LIE A;  1SQQ K;  4WA6 A;  1JCD A;  1NKN A;  2FSA A;  3ZVZ B;  4MVT A;  3P8C D;  2FFD C;  5BU8 B;  4YC9 A;  3SOX A;  2E43 A;  2CSY A;  4JF7 A;  4WY4 A;  1IFM A;  2Y43 A;  4P5O B;  4LGD E;  1LTJ C;  4Q6F A;  2POH A;  3ZTG A;  4ZUX U;  1NU1 K;  2J58 A;  3RL0 B;  5D1K B;  5AW6 B;  1WES A;  1NKZ B;  3HE5 A;  5AVZ B;  4GT1 A;  4XE5 B;  3ZNI A;  3L37 A;  2J59 M;  4AYC A;  4W7Y A;  1N87 A;  1GDT A;  2XU6 A;  1WEQ A;  5TAB A;  1NTZ K;  1XWH A;  2JMJ A;  1VDF A;  3WMM 0;  1MUU A;  3A3Y B;  1URQ D;  1IFD A;  3N9P A;  2QM7 A;  5APX A;  1M1J B;  1NO4 A;  3HD7 A;  1GTW A;  1V87 A;  2DX8 A;  2P7J A;  3O33 A;  2VPG A;  3HUS C;  3KQI A;  3U5N A;  5KJ7 D;  3HTK B;  4R8P K;  4WBA A;  1T3J A;  4ZKU A;  2OYH A;  3U1A A;  4RES B;  1SFC D;  1LT9 B;  2ECG A;  3O34 A;  4GKG A;  2QM8 A;  1LWU B;  4LK9 A;  2ECJ A;  3CL3 D;  1JY3 O;  2K17 A;  2YW8 A;  1SP4 A;  3V2Q A;  2OYI A;  5AW4 B;  5AVY B;  2R3C A;  5FER A;  2HYE D;  4W7Z A;  1JNM A;  2ZFC A;  3M9H A;  2KWN A;  4QF2 A;  1GL2 C;  4OH8 B;  1J2J B;  3C5K A;  4S3O C;  2KIZ A;  3NXS A;  2Z5I A;  1GW4 A;  3R2P A;  3A5T A;  3P32 A;  3U5O A;  1KZU B;  5AW7 B;  3N9Q A;  2XNX A;  3M91 A;  3L1Z B;  2KRE A;  4GNG A;  1JY3 P;  1GK4 A;  3N9O A;  2R5D A;  2WPR A;  4FIP A;  5H1U A;  2WIT A;  1T1H A;  2A45 G;  3PUR A;  2YHO A;  2WZ7 A;  3CLQ A;  3V5B A;  2KYV A;  1KIL C;  3H6P A;  1OWA A;  4N78 E;  1A02 J;  1FZE A;  2YHN A;  2G45 A;  5CCG C;  2KE1 A;  5KH3 A;  1G2C A;  2XDJ A;  1RE3 C;  1N73 C;  2QIZ A;  3P8C E;  2YYR A;  1JO5 A;  2RSD A;  1L0N K;  2P67 A;  3PP5 A;  2AN6 A;  2F6N A;  2XEU A;  3CI9 A;  4C9Z A;  1FAV A;  2G43 A;  1WEU A;  2YNY A;  3HD7 D;  5APV A;  2MJZ A;  2G6Q A;  1DEB A;  5LKX A;  1YTZ I;  4C46 A;  2MA5 A;  1IK9 A;  3IFM A;  1GK6 A;  2Z5H A;  2KR4 A;  5CJ4 A;  1JM7 B;  3PHD A;  2N9B A;  5DIN A;  1WIM A;  2K4D A;  4UP0 A;  1FU1 A;  2MA6 A;  2CSZ A;  2Z4E A;  2IX7 C;  2M8R A;  4M3L A;  4B86 C;  3L35 A;  4YAD A;  3MHH A;  1VYX A;  1W2E A;  5AW1 B;  3B8E B;  3RL0 C;  4IC2 A;  1WEP A;  3KPE A;  4S3O B;  4I7B A;  2A45 I;  5AVR B;  2HOD A;  2YUR A;  2WWW A;  5APQ A;  1URQ A;  1H8A A;  1HTL C;  1LTI C;  2N1T B;  2YO2 A;  1FP0 A;  2R5B A;  3M0A A;  2FUI A;  1L4A B;  3KNV A;  1N7S A;  5BU5 A;  4EOT A;  2PNX A;  5H1V A;  2H8P D;  3N9N A;  1M7L A;  1JOC A;  4I2L C;  2C9L Y;  2M3B A;  1KIL B;  1M1J C;  2WSF H;  1NTK K;  3RK3 B;  5CCG D;  2LQ6 A;  2VJF B;  5EYA F;  3LW5 H;  1H89 A;  3V2R A;  2L5U A;  1SFC A;  2JEE A;  2KU3 A;  4FK5 A;  1AFO A;  2M85 A;  3NTN A;  2MT5 A;  3VMX A;  1JUN A;  2LGV A;  4R7E A;  2HPC B;  1IJD B;  1IC2 A;  4I6M C;  5J3X A;  2FFD A;  3HE4 A;  2EA6 A;  1LWU C;  2VRS A;  2YKO A;  5AVW B;  2H0D A;  2M6M A;  1LTJ A;  3FL2 A;  3LQH A;  2W6A A;  4Y99 C;  2ECT A;  5H9M A;  3N4X A;  1J1D C;  4HYT B;  1VD4 A;  3U5P A;  1S9K D;  4A49 A;  1T2K C;  4QF3 A;  2CKL A;  2KLV A;  2LXP C;  2WTY A;  3N9M A;  4CA1 A;  3L1X A;  3RK2 C;  2L80 A;  2PP6 A;  3RL0 D;  4JYB A;  3KDP B;  3EB6 A;  4DOJ A;  1FZC B;  5B79 A;  5AVV B;  2BAY A;  3H32 B;  4A4C A;  1X8Y A;  5KLV K;  2L0B A;  2XZR A;  2NPS B;  5AVQ B;  3TNU B;  5LKZ A;  1VFY A;  4AVX A;  1HYJ A;  2WSC H;  1LTG C;  3HUS A;  5AVX B;  1VPC A;  4WZ3 B;  3B5N B;  3VOP A;  1N7L A;  1IO4 A;  2O1K A;  1Z60 A;  3N9L A;  1N7S D;  2L75 A;  3LID A;  1FOS F;  3GL6 A;  4V3K C;  1HVV A;  3BRT B;  3RPG C;  5TBN A;  4C7N B;  5LKU A;  4N6J A;  3M62 A;  3SOW A;  2Q3I A;  3IHP A;  1GD2 E;  4KHX A;  3VTP C;  2VP7 A;  3LQJ A;  1CZQ A;  1YYC A;  5AW2 B;  2VNF A;  4ZDT A;  5D1M B;  3DQV R;  5BVZ A;  3EFG A;  4XI1 A;  1GL2 A;  1JY3 N;  1L0L K;  3O35 A;  2EOD A;  2LN0 A;  4Y99 B;  1A02 F;  5C13 A;  5APY A;  4ZKP A;  1MM3 A;  3O36 A;  4AQR D;  3SOU A;  2LGK A;  1J1D B;  2MD8 C;  4BBQ A;  4IFD K;  2P1J A;  3VN0 A;  2QIC A;  3C6W A;  5KH7 A;  3RK2 B;  1Z6U A;  4A0C D;  2HYN A;  1WFK A;  3V43 A;  1LTS C;  2LDR A;  4FJC A;  2WT7 B;  1WIL A;  4GB0 A;  1FZB A;  2IFN A;  5B75 A;  1KIL A;  3SWF A;  1RMD A;  3MUD A;  1LGH B;  3GHG A;  1HBW A;  1WEW A;  1BOR A;  1LDJ B;  2N1T C;  4NN2 A;  1KFM A;  5CCG A;  1JCC A;  1L4A C;  1RE3 A;  2VJE B;  1N73 A;  2PAJ A;  1NTM K;  3O7A A;  3BVH A;  1HGZ A;  4YAT A;  2OYH C;  2LKM A;  3RK3 C;  1NWQ A;  4EIJ A;  2HG5 D;  1NOH A;  1T3U A;  3VMY A;  4V3L C;  3MIW A;  3P8M C;  1RF1 C;  1RE4 C;  1X9V A;  1SLQ A;  1S9K E;  3ASL A;  2XB1 A;  3KQG A;  2OYI C;  3T97 A;  3MGN A;  2E6R A;  1IFJ A;  5B77 A;  1WGM A;  1FBV A;  5G05 B;  2YKP A;  1RY3 A;  4MSX A;  2Y1M A;  5APS A;  2O1J A;  1HUC A;  3A2A A;  5KTB A;  3VK6 A;  2I1K A;  4WY4 B;  3TSI A;  5B8D A;  2FYZ A;  5AVU B;  5G0F A;  2KWJ A;  2MNZ A;  1SQV K;  3G3Z A;  1FZA A;  4AUQ B;  1IFI A;  4IFM A;  3ZPV 1;  1KFN A;  1ZV8 A;  5AW3 B;  2YSM A;  4IC3 A;  3M0D A;  4CCG X;  2Q7C A;  3HE5 B;  1GL2 D;  1XTG B;  1WRG A;  1X4J A;  1JMM A;  1WEV A;  4AYC B;  1HWT C;  2C9N Y;  2MUM A;  4WB4 A;  5TDR A;  1FZC C;  1MFZ A;  1HJB A;  3EB5 A;  1RF0 C;  2Q5U A;  5CCH C;  2M3H A;  4YBM A;  2LGL A;  2L43 A;  1GZL A;  1M1J A;  1WEN A;  3KV5 A;  5FB0 A;  3QZV A;  2NPS C;  1FJP A;  3I2D A;  3LQI A;  3HD7 B;  2E42 A;  2YT5 A;  1WT6 A;  2H7H A;  3SWY A;  4LAD B;  2K16 A;  1KIL D;  3HTK A;  3RK3 D;  2WSE H;  3O37 A;  2C2L A;  1DH3 A;  3B5N C;  4N3Y B;  2OYH B;  3N7N A;  1LT9 A;  3VP9 A;  2K1J A;  1RF1 B;  1EQ7 A;  1JY2 O;  1J1E C;  5APT A;  2EGP A;  4WZ2 A;  1LWU A;  2JMD A;  2WPS A;  3HCU A;  3LRQ A;  4AP4 A;  3BAS A;  3IR9 A;  2LV9 A;  2OYI B;  5JG6 A;  4LC1 A;  4C7R A;  2KP8 A;  1FZG A;  5LKT A;  3L4F A;  1WEO A;  1FJK A;  1MZ9 A;  5H1T A;  2OAR A;  3VYI A;  2PUY A;  1DVP A;  2YSJ A;  3V2P A;  1SQP K;  4TKP B;  2Q9I A;  3M06 A;  4I7D A;  4WZ0 A;  3RTR B;  3RPG B;  4PTB A;  5AIT A;  1JY2 P;  1URQ C;  3P7K A;  3L11 A;  2A45 H;  4O9B A;  2VPE A;  1N2D C;  2YKQ A;  5CCH D;  5B78 A;  1KQL A;  2HFE D;  3VMZ A;  4YAX A;  2C0W A;  5KJ7 C;  1IYM A;  1CI6 B;  3NMD A;  2NPS D;  4ZQL A;  1K2F A;  1PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...