1JOCA

Eea1 homodimer of c-terminal fyve domain bound to inositol 1,3-diphosphate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
QDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multivalent endosome targeting by homodimeric EEA1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Early Endosomal Autoantigen 1
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jocA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jocA02
3ZPV1 5TDWA 5B79A 3KQIA 2LRIC 2EA6A 5B77A 2KREA 2KR4A 2F6NA 4UP0A 2HDPA 3L11A 2D8SA 3M63A 2YSMA 4WZ3B 3IHPA 2HYED 1WEEA 3EB5A 4V3KC 5AIUA 4IC3A 4AYCA 1HYIA 2Y1NA 1WEQA 2OXQC 2G43A 2YU4A 2YT5A 1WEMA 2ECJA 2F6JA 4PTBA 1ZBDB 2VPEA 4A4CA 2KWOA 2K16A 3QZVA 3U5MA 4GNFA 1MM2A 3L1XA 3FL2A 3SOUA 5FERA 2YYRA 3HCUA 2MA6A 2PUYA 4P5OB 4A49A 5B75A 1HYJA 1WEPA 4GNEA 3ZVYA 3L1ZB 2KWNA 1Z60A 2CSZA 1Z2QA 1VD4A 4AP4A 4LJNA 1VYXA 2YKPA 1N87A 5D1LB 4GNGA 2JRJA 2MUMA 3KNVA 5DINA 4YABA 2L5UA 5JG6A 2ECVA 4MSXA 5D1KB 3U5PA 2ECTA 1X4JA 2YW8A 2E6SA 3U5NA 5H9MA 4YC9A 2K4DA 4YBMA 2L0BA 2MNZA 4Q6FA 3EB6A 4MVTA 1E4UA 2PNXA 2Y43A 2MNYA 3EQ2A 2BAYA 2CKLB 2KYUA 2VJEB 2K1JA 3GV4A 5LCWB 2VPDA 2F42A 2M85A 4FK5A 5D1MB 2VPBA 5FEYA 3M99A 4R7EA 4IC2A 1BORA 3O70A 1T1HA 5KH3A 5G05B 3N9NA 2JMJA 3NG2A 2KWKA 3RPGC 1LDKC 4R8PK 4S3OB 2YUCA 4S3OC 1RMDA 3DPLR 1CHCA 2YURA 4LLBA 2AN6A 4C9ZA 5FB0A 2YHNA 5KH7A 2M3HA 2IDAA 4LKAA 5DKAA 4B7YC 2QIZA 2MA5A 4YAXA 4CCGX 1K2FA 3HCSA 2XB1A 2LDRA 5B78A 3O35A 4FIPA 4TKPB 2C2VS 5H1TA 2KGIA 2CKLA 4UI9B 2YQLA 1V87A 4QF3A 4YADA 4FO9A 3L4FA 2KE1A 1X4IA 1DVPA 5TDRA 3O37A 4WA6A 4ZQLA 2G45A 4GNDA 4L7XA 5LKXA 2H0DA 2FUIA 2YREA 3RPGB 3KV6A 3BRTB 2C2LA 2ZETC 4LK9A 1VFYA 3O33A 2LN0A 1JOCA 3C5KA 4YBSA 3GL6A 2E6RA 3O7AA 3HCTA 3KV5A 4BHWA 1F62A 2FSAA 4NN2A 3LQIA 3T7LA 1XWHA 3ZNIA 3N9LA 1G25A 3ZTGA 4N3WA 5B8DA 3N9PA 5H1UA 3LQJA 2KGGA 2G6QA 2YQMA 4AYCB 4A0CD 2LXHC 5G04B 4QF2A 2ECWA 4R2YA 4WZ0A 2YKOA 3ASLA 3MHHA 1X4UA 2MIQA 1WEWA 2DX8A 2FUUA 4YBTA 3LRQA 2VJFB 2LGGA 4A4BA 5LKTA 2VP7A 5C13A 2QICA 2KU3A 2KFTA 1FP0A 1LDJB 2JMDA 2LGVA 4CA1A 2L43A 2LXPC 2VPGA 5LKUA 2I50A 2VNFA 1WILA 5G0FA 2MT5A 1WEUA 2LGLA 1WE9A 4B86C 3T6RA 3PHDA 3VK6A 2NAAA 2RSDA 5LKZA 1WENA 5EYAF 2MD7B 3O36A 4GB0A 2KWJA 3ZPVE 3DQVR 4F52B 3ZVZB 2K17A 4FJCA 2EODA 4I7BA 3SOXA 4WZ2A 2KIZA 4L58A 2MD8C 3SOWA 2LQ6A 1FBVA 1WEOA 1JM7B 2QJ0A 2L75A 4V3LC 3MHSA 1MM3A 4YATA 1IYMA 2H0DB 3V43A 1WFKA 3CL3D 1WGMA 3PUQA 2YSJA 5KH9A 4O64A 3LQHA 2Y1MA 4ZDTA 5TBNA 5J3XA 4ZUXU 2L80A 5TABA 5FB1A 2XEUA 2UZGA 5AITA 2EGPA 5TRBA 3BRVB 2M6MA 2ECNA 3N9OA 4I7DA 3U5OA 2JMIA 2LGKA 2RI7A 2CT2A 4UP5A 2YHOA 2ECGA 4BBQA 4X3GA 1JM7A 4W4UA 4XI1A 2VJEA 3HTKC 5B76A 4N4FA 3PURA 3SHBA 3N9MA 1WESA 3I2DA 4LADB 3N9QA 3RTRB 2CSYA 2ECIA 2VJFA 5C11A 3C6WA 2LV9A 1WEVA 4PPEA 1WIMA 2M1RA 4AUQB 3ZYQA 4I7CA 5H1VA 3M62A 3O34A 2W6BA 1U6GB 4AVXA 1Z6UA 5I3LA 2YKQA
chains in the Genus database with same CATH superfamily
1EC5A 5B66E 1QVGO 3H1HE 4IFFA 1IFNA 2KR4A 3RK2C 2HDPA 1J1DC 2D8SA 1JMMA 4H44B 1OX3A 2E5TA 2XOCA 3LIDA 1GL2B 1J1EB 2ZT9C 1A02J 3H1LJ 2JDIH 2HYED 3H1LE 1HGZA 1KORA 2V7QJ 3EB5A 2AXTH 4IC3A 1HYIA 1U7JA 1NO4A 1EZVE 5KKZC 2K3RA 2G43A 2YU4A 3LDYA 2YT5A 2KNCA 1WEMA 1EQ7A 1W2BO 2K16A 5AW0B 3U5MA 4GNFA 5CCGD 1N86A 2B87A 2ZT9D 3VMXA 3VOPA 3LW5J 2BCCJ 1M1JA 1DD3A 3AEEC 1N8RQ 1Q7YQ 1X79B 3MDBC 1RH5B 1VQPP 3B5ND 1Z60A 4Z0OA 1NKNA 2G3AA 2ZVNB 4AP4A 3AEBC 3VP9A 1FZGA 2YKPA 1NAFA 3L74J 1M8OB 4GNGA 2WT7A 2OYIA 2AEJA 1K73Q 2P2UA 1H0TB 2KKXA 2K88A 4LLHA 3F5HA 2C9LY 2WSCJ 5H9MA 4YC9A 3H32A 3WMM0 5AW3B 2NPSB 2K4DA 1YTZT 2FYZA 1BCCD 2L0BA 3E1IA 1KYOE 3KZIE 2UWJE 1SQXJ 4MVTA 1NKZB 2Y43A 2MNYA 3CCSP 2XZRA 3RK3C 1Q81Q 3CCMP 1SLQA 1VQ6P 3MZWB 3N7NA 2M85A 4FK5A 2ITAA 1L0NG 2E76B 4U3FJ 5APTA 2VPBA 3VP8A 3M99A 5FEYA 1LTJC 5AW6B 4TT3H 1KILD 3AEGC 1FZCA 3O70A 1EDIA 5KH3A 2RN0A 3H1JJ 3N9NA 1YHQP 2IBZD 3PHLA 4W7YA 2JMJA 1HF9A 1SFCD 4S3OB 3GMAA 3DPLR 2AN6A 1NTZE 3CMAP 3AEAC 2OTKE 2E43A 2KLUA 5KH7A 1FBMA 1USDA 2Q6QA 3MTUE 1OW7A 2J58A 4CCGX 2A45G 2AEMA 4L75A 3H1JD 3O35A 1QGKB 3TNUA 1SQQK 4OVNF 4TKPB 3V6IA 2YXRB 1SQBG 2CKLA 4UI9B 3C1LA 4PJ0H 1V87A 2HR3A 1OZHA 2M5AA 4Y99C 1SQPD 1HH0A 1GD2E 4FO9A 2HPCB 1DVPA 4WA6A 4ASVA 4N78E 2H0DA 5CCHD 2N1TA 3L36A 2HODB 3G3ZA 3KV6A 2IZ0A 3P8CD 4ASWA 3CCJP 2Q7CA 1PL5A 3T97B 1N7LA 5B66H 1NJIQ 1PGOA 5CCHA 2ZETC 3HRNA 1KB9D 4YBSA 3GL6A 3HCTA 1S9KD 3JUEA 2FYUJ 4R4MA 1U57A 3KV5A 2ZFCA 3M9BA 3GG2A 1ZOYC 2P57A 4BHWA 1DEBA 2YMYA 2FSAA 4NN2A 3T7LA 4AUWA 1UIXA 3FANA 1BGYE 3N9LA 5AVRB 2FXPA 1PFIA 4N3WA 3N9PA 3H1JG 1L4AB 2R44A 3GF7A 1SP4A 4GOFA 2E75C 4AYCB 2KYVA 2LXHC 2FYUD 1MUUA 4XFJA 1W2EA 1RE3C 2GM4A 1OVUA 1FZAA 3KDPB 3V2RA 3MHHA 1X4UA 4O62A 2POHA 2DX8A 5KLVD 2QG4A 4A4BA 3RBZA 3FM8C 4DCKA 1ZR2A 3G4SP 1LWUC 2QICA 1S5LE 1LDJB 3K5BA 1VQNP 4CA1A 5LKUA 2I50A 5AW8B 4N6JA 3TDKA 1N73A 2VNFA 3H1HG 1WILA 3RK3E 2Q5UA 1NTKJ 3VMZA 1WE9A 1LNQA 3M9QA 1CSBA 1RF0A 3PHDA 2OYHB 2DSMA 2EXUA 2IYOA 1VQOP 4JYBA 4PD4I 1SQQJ 5EYAF 3O36A 2QE7H 3BCCD 3ZPVE 3N4XA 3MD0A 1SQXK 3HTKA 4ZKPA 1LP1A 3FXEA 2KB7P 1H89A 1Q86Q 5AW5B 3IAOA 1K9MQ 5KAIH 4OGQD 3PJSK 1YQ3C 1KYOH 3KZIH 2OTJP 3I56P 3MHSA 4PD4D 1MM3A 4YATA 4H13B 1M1JC 5AW1B 2Q1KA 4L74A 3L74E 1K05A 3F89A 2JP3A 1YITP 4ZUXU 3Q3DA 2L80A 1ZLLA 1CZQA 2E74D 4D6TE 1FOSF 1SQBD 4H0LD 1NVOA 3VMYA 5GTIE 5APWA 1T3UA 5TRBA 2WZ7A 1SQPG 2O01J 3NXSA 3HD7D 1GU5A 2V4HA 4R4LA 4WB4A 4UP5A 1JCCA 1LP1B 2YHOA 1X22A 2ECGA 3JC22 2WSEH 1N73C 2OGUA 3HD7A 4W4UA 4OH8B 2VJEA 4GIFA 5M1BA 1MV8A 1LT9A 4DT0A 5E79H 5AVTB 2SPZA 1LJ2A 3PURA 1GL2C 3SHBA 1S4XA 3I5CA 4LADB 1KILC 3RTRB 2CSYA 3G71P 1P84D 2YNYA 2YMKA 1SQPE 2CONA 4AUQB 1PPJE 1L0NK 2QIWA 2ZYAA 3ZYQA 1NOHA 4I7CA 3M62A 3L73E 3CC4P 2O01H 2W6BA 3A0HE 3AE9C 3L75D 3KXDA 3WUVA 4JQ0D 5B79A 2N1TC 3FX0A 5KJ7A 2EA6A 1YI2P 1VF5C 3M0AA 2KREA 2E75B 2F6NA 4IL6E 5CBNA 1QL1A 2C0XA 3H1IJ 4WZ3B 4GODA 2ZYGA 2KP8A 5AVUB 1SFCB 1Q82Q 2IZ1A 4V3KC 2HYNA 2Y1NA 2L5GB 4NPFX 1VF5D 1R5SA 4WY4B 5KJ7D 3HUSA 1KILE 3E1RA 4L76A 4PTBA 1MFTA 5CCHC 4YXDC 1ZBDB 2VPEA 5B5EE 2W6JH 1AFOA 1FS0E 4KHXA 2CRWA 3GHGC 3L70G 2WITA 2QJYC 3RL0C 3W68A 1HTLC 3A0BH 2Z4EA 4TLFA 3FL2A 3HCUA 2KOGA 2N9BA 1ZR4A 4B86A 1LT9C 2NRGA 3RGUA 1BCCE 3L1ZB 4GT1A 2KWNA 1L0NE 3A3YB 3MHVA 1Z2QA 5APVA 3SWFA 1VYXA 2IDBA 2WVRA 1BDCA 2WSCH 5D1LB 1VQMP 4BXLA 3WUTA 3USSA 3KNVA 1WRGA 3BVHA 4YABA 1M56D 1VPCA 1YBKA 3EWKA 5D1KB 2ZJSE 1VQLP 4UB8H 1KN7A 2OARA 2E6SA 2D8UA 1X8YA 4OWFA 1KILA 5K3QA 2DW3A 1HUCA 5H2FH 2MNZA 5KAFE 2PFXA 2XDJA 1SQPJ 2CKLB 3C8VA 2VJEB 1AV1A 3HTKB 4HJGH 4WBAA 5LCWB 2VPDA 1QEXA 4OGQB 2JEEA 4IC2A 2WPQA 1NWQA 1YYCA 2N1TD 2WPRA 3R4YA 4O9BA 1L2PA 2GA1A 3WU2E 5C39A 2IBZI 1RMDA 4LLBA 3CXHI 5APUA 2ZAEB 4H13D 2YHNA 4Z1MH 2M3HA 2Z5IA 5DKAA 4B7YC 1RF0C 4YAXA 5BU8B 3V2NA 2FKWB 2XB1A 2FFDB 2FYUK 1EZVG 1AVOA 3A2AA 1PGQA 1A02F 3CCEP 1LTTC 2KGIA 3L73D 2JKVA 1PPJD 1SQXD 2C0WA 4QF3A 3SSUA 1IFMA 2QVAA 2IBZG 1EXJA 2KE1A 1P84E 3U1AA 2Q3EA 1LTBC 1FJKA 3M9HA 3AE4C 4U3FD 2WT7B 3RPGB 5GTHE 3FJUB 3AECC 1JTHA 3L70E 2YO2A 3P7KA 4UB6E 1KB9I 2C2LA 1LT1A 1OW6A 2XOZA 4LK9A 2P7JA 1VFYA 3O33A 1DIPA 3HE5B 3C5KA 3O7AA 1OW8A 2OQQA 2JWAA 1T8ZA 3A0HH 1GDTA 1GL2A 1JEKA 3AEDC 2ZXEB 2H8PD 3LQIA 3ZNIA 2A06G 4JYCA 1ZRTE 4HKZH 1NYHA 1JM0A 5KJ7C 1RY3A 3ZTGA 2N1TB 3LQJA 1KZUB 2KGGA 2NPSA 1FDMA 2JR8A 1BE3G 1D7MA 5DJTB 4A0CD 2W8ZA 2I1KA 2E75D 2CPSA 2KK7A 2ZYDA 4QF2A 2ECWA 4R2YA 4PD4E 4PV1B 5AVXB 5AVSB 4WZ0A 1YJNP 3FAOA 1SQVD 1FOSE 1Y8AA 1VL2A 5CBOA 1HGVA 1NTZK 2JO1A 3TNUB 2VP7A 3LIEA 2WSFJ 2KFTA 2JM3A 2LGVA 1NU1K 2EGMA 3BCCE 1QX8A 2VPGA 3E2DA 3CLQA 1L0LE 1M1JB 3O47A 2MT5A 3HUSC 4B86C 2XOYA 3VK6A 3IF4A 3L71J 1KQSO 2H89C 2W27A 5AW7B 1ZMEC 3CXHD 2MD7B 3D6ZA 4GB0A 1SQBK 5AVQB 2KWJA 4F52B 2XP0A 3T9KA 1ZP0C 1U7MA 4FJCA 2EODA 2LAUA 3AE5C 2B0OE 4Y28J 3HE4A 1URQD 1RF1B 2D2CD 3SOXA 3L74G 2R5DA 3PTZA 4L58A 2RMZA 1L0ND 1FBVA 2N9YB 1T6AA 2QJ0A 2K9JA 3V5BA 3OJAB 4JBZA 2QRXA 3L37A 2FFDA 2FYUE 4OGCA 3WUUA 3CCQP 1WMKA 1PP9E 1WFKA 3CL3D 1WGMA 1AQTA 4MN4C 1RE4C 3PUQA 3RK2D 2Y1MA 5TBNA 1AA0A 4I7ZB 1L0NJ 2P10A 1BGYD 4YTPC 1LTIC 2XEUA 3L73G 1JMBA 1RQVA 1EZVI 2E74C 3V4QA 1NTMK 2EGPA 3WU2H 3BRVB 5H2FE 3DWDA 4DOJA 4HB1A 2WQYC 4I7DA 3U5OA 3II6A 2CT2A 1LWUB 2O1JA 4BBQA 1KTMA 1DX7A 4I7ZC 1VQKP 4UB8E 4I6MC 1PGJA 3N9MA 1M90Q 4OGEA 1JO5A 3N9QA 2VJFA 3ITKA 2L91A 2JJLA 3Q5SA 3V2PA 2LV9A 3O6QB 4H9DA 4PPEA 1Q2NA 3VYIA 4H44D 1FU1A 2PAJA 1G2CB 4YPCA 3L70J 1Z6UA 2YKQA 3ZPV1 4GKGA 1PZQA 3KQIA 2E42A 3W67A 5GTIH 2YSMA 1OIPA 1NTZD 3IHPA 2K37A 2BASA 1J1EC 1SFCC 2ZT9B 1YTZI 1WEEA 3CC7P 1BDDA 5DJUB 1P84H 4KJMA 1USEA 3SWYA 4AYCA 3CX5H 2IBZE 2IX7C 2RR4A 1EDKA 5L8RJ 2F6JA 3JSVC 5AW4B 4W7ZA 3B5NB 2KWOA 4UB6H 1HBWA 1JTHB 2A45I 1KQFB 1MM2A 3LVRE 1JUNA 3L74D 2I1JA 3L1XA 1PP9D 1AJYA 5FERA 2YYRA 5KLVK 2M13A 2KZJA 1HYJA 3CI9A 3SUBA 4EIJA 1CW5A 3T97A 4LJNA 1JNMA 4H13C 4NPEA 3CCRP 2CPBA 1N87A 1PP9J 1YJWP 2JRJA 1UIIA 2MUMA 1OVVA 4IL6X 2L5UA 2FXOA 3BASA 2FFWA 2ECVA 3MIWA 3BCCG 4YXWH 4MSXA 2FYNB 3U5PA 2QEXP 1X4JA 5APYA 4XA4A 3U5NA 1IJDB 3V2QA 2FD4A 1G1IA 4K3AA 4YBMA 1GMJA 1ZN5A 2ZVOB 3L73J 2OTLP 1GL2D 3EB6A 2BCCG 1L0LD 2PNXA 3VN0A 3H25A 4C7RA 5BU5A 3EQ2A 2BAYA 1GW3A 5APQA 1JY2O 1CI6A 3GV4A 5CCGA 2F42A 3CCLP 1T2KC 1QLED 3AE7C 4U3FG 4R7EA 4Y99B 3L72G 1L4AD 3Q1MA 1LTSC 2QJKC 5KLVE 1T1HA 2FY8A 5KKZB 3CC2P 3H1KG 2PRRA 1PV3A 3NG2A 3CWBD 5TISE 1NTKK 4U7JA 2KWKA 3RPGC 2K9JB 1FC2C 3UIAA 1LDKC 4R8PK 1Y47A 3CD6P 2M3EA 1KC8Q 5FB0A 3HD7C 2A45H 1NHLA 1XTCC 2IFMA 3R2PA 4LKAA 2QIZA 3HE4B 4WY4C 3RK2B 2GUVA 3CWBG 3CWBJ 1JB0J 1FZFA 2YIUC 2RKLA 2P58A 2C2VS 1OFCX 5H1TA 2QJPB 1G1JA 1VQ8P 5APXA 2BCCE 2AEFA 3Q5RA 4YADA 3D6YA 4XE5B 1LGHB 1X4IA 3S1KA 2Q3IA 3O37A 1KB9E 2NPSD 1PP9G 5LKXA 1NH4A 1NU1E 2GUSA 3C9IA 2IYPA 3CPWO 2K9YA 3Q5PA 5KAIE 3BRTB 4C46A 3P8CE 1AVYA 4JPZB 2IPPA 4U3FE 1IO4A 4N78D 2H88C 2A06E 4K35A 2G8YA 2NPSC 2LN0A 1Q90D 1JOCA 5CJ0A 2E6RA 1Z56A 2Y9YA 1Y9BA 1SQXE 3M0DC 3AE2C 1JY2P 1QVFO 1F62A 4ZNCA 1XWHA 3B5NA 2R32A 3L71D 5KLIC 1IK9A 1G25A 1JY3O 2KUBA 5B8DA 5H1UA 1KILB 2G6QA 1URQA 4PJ0E 5G04B 1FJPA 1S5LX 2LKMA 1NTME 3LW5H 1FDIA 3TGUJ 1LTAC 3JCUE 1KV4A 4C7NA 3ASLA 5KLVG 2MIQA 3H1IG 1H8AA 1PPJG 3H1KE 2FUUA 2KLVA 1YJ9P 3MP7B 2QM7A 2WTYA 1FDOA 1W5CE 5LKTA 5AVWB 3TGUE 1FP0A 2JMDA 3QWOC 1SQQD 2V7QH 2KS1A 1FZEA 2ZXXA 4D6TG 1IFJA 3MUDA 1GZLA 3HD7B 3BCCJ 1R8EA 2W83C 4RKUJ 1L0LK 1T3JA 3U59A 1VQ9P 2FYUG 5G0FA 3CX5E 3HUSB 3H1LG 1KYOD 4WY4A 1N7SB 4ZMDA 4RO0A 4AQRD 2R5BA 2M0BA 3CX5D 3FXDA 1WENA 4H44C 4EI2A 1NTMG 3M7KA 1TU3F 3L72J 1MBMA 2K17A 3M0DA 1NTKD 2H43A 2WPVB 4WZ2A 1FZCB 3S9OA 1RHZB 4I2LC 2KIZA 1FZBA 2MD8C 1VQ7P 3AEFC 1WEOA 1SQBJ 3CCUP 1BCCG 2L75A 2LR2A 3SFEC 4V3LC 1CI6B 3V4WA 5SVIA 1QL2A 2K1AA 1IYMA 1OVRA 1HJ0A 1L0LG 2L7PA 4W80A 1E5WA 3OAKA 2LXCB 5KH9A 3PP5A 3LQHA 3L71G 3A5TA 5J3XA 3H32B 5CCGC 5TABA 2YIUB 5CMZA 3DDTA 2E5YA 5AVYB 5AITA 3PH0A 1HVVA 3H1HJ 4KT0J 4WY4D 2KS1B 5TISH 2M6MA 3PLWA 1EZVD 2QJKB 2ECNA 3N9OA 1SQXG 3H7HA 2LGKA 2RI7A 3H1LD 1KQGB 3NFQA 4X3GA 3KYQA 1N2DC 4XI1A 1VQ4P 1KB9H 3HTKC 2BEQD 2KIKA 1JY3P 2Y0CA 3B4SA 1S1CX 4Z0RA 3O8ZA 4M3LA 1WESA 3H1HD 3S4RA 5B5EH 3I2DA 3RL0g 1NU1D 1L4AC 1M57D 1MKMA 3L75E 2NZ2A 3IN6A 1HJBA 1S5LH 3IR9A 1WEVA 1BE3J 3I55P 3H1ID 2BCCD 1NTMJ 3MUDC 4C7NB 4QMAA 1SFCA 2BEZF 2WSFH 5H1VA 3O34A 3GHGB 5K5GB 1U6GB 4AVXA 1LTJB 3OA7A 1ZV8A 5TDWA 1RF1C 2LRIC 5SVIB 5B77A 3SWKA 4UP0A 1S72P 3L11A 1S3JA 3M63A 3GF3A 1BE3D 3GLMA 4D6TJ 1BGYG 4I1LA 3CXHH 3E7KA 5AIUA 3JCUH 2O3JA 3L75J 4H0LB 3CWBE 1WEQA 2KNCB 5APSA 2OXQC 5E79E 5GTHH 4LC1A 1IFIA 2ECJA 3H6PA 1KFNA 1SQBE 3M91A 4A4CA 3B5NC 3QZVA 4D6TD 5KTBA 1JCDA 1BSHA 2FXMA 1YIJP 2KKYA 5CJ4A 3SOUA 2MA6A 2PUYA 4P5OB 1VF5B 4A49A 5B75A 1WEPA 4GNEA 1ZW0A 5BVZA 2KI7B 3ZVYA 2CSZA 1VD4A 1IC2A 3VTPC 1LWUA 4WWIA 2D2CC 3HE5A 3TGUG 4EOTA 5DINA 3L35A 5JG6A 1X0TA 2WMMA 3EFGA 4JF7A 2ECTA 2QSIA 1K04A 4BRYB 2YW8A 4EDFA 1L4AA 3CX5I 4H0LC 1GW4A 1URQC 3M06A 4Q6FA 2HG5D 2HLOA 1J2JB 5TJHA 2J5UA 3RK3D 1OMIA 1E4UA 2OYIC 1LT9B 3FWNA 1KMIZ 4N3YB 2KYUA 3GHGA 2VRSA 3A0BE 2K1JA 4BWNA 4IOIH 1S2EA 2QJPC 4QQ4A 2XNXA 5D1MB 3G9RA 2KSJA 1IFPA 1BORA 1IZNB 5G05B 3U1CA 2O1KA 2HPCA 4CPGA 2CSVA 2OYHC 4IL6H 2OYIB 1N7SA 3P8MC 1R5LA 2HODA 2YUCA 4S3OC 1CHCA 2YURA 4C9ZA 2M8RA 2B89A 1BSNA 1BE3E 4A7PA 3L72E 2QJYB 3RL0B 3G6EP 2IDAA 1OXZA 3VMAA 3FWLA 2MA5A 1K2FA 3LJUX 2M5AB 3HCSA 3MGNA 3BATA 2LDRA 5B78A 4FIPA 1AQ5A 1BCCJ 3AE1C 2M3BA 3GW6A 2JUNA 2C9NY 2YO3A 2RH0A 2E76C 2YQLA 4LGDE 3FGAD 4DZOA 4L73A 1L0LJ 4NPDA 3SFDC 4F1PA 1NAYA 1S9KE 1VDFA 1K8AQ 4RESB 3L4FA 2AXCA 4HYTB 5TDRA 3PLNA 4ZQLA 2G45A 4GNDA 2J59M 1SVFA 3AE6C 4L7XA 2FUIA 4EYYQ 2YREA 1DCQA 5AW9B 1LTGC 2Z5HA 1KQLA 3AE3C 5KLIB 5AVVB 3RBXA 1P84I 2QA4P 5EFWB 2WWWA 2D2CB 2Q9IA 2DJAA 3KDEC 5AVZB 1GTWA 3NMDA 2IFNA 1NU1G 1YQ4C 2P67A 2H7HA 2HFED 2FYNC 4DJGA 3KQGA 2B9BA 3D71A 3ABVC 1SQPK 4OGQC 2XV5A 3H1JE 1RF1A 3AE8C 4IFMA 1N7SC 2CRRA 2YQMA 3L72D 2XNDH 2WPSA 3B8EB 2E76D 3CCVP 3P32A 4PV1C 2AXTE 2YKOA 3OW2O 3IFMA 2P1JA 1WEWA 2MKVA 4HH2A 4YBTA 1SQVG 3LRQA 2VJFB 2LGGA 4GOEA 1FZCC 5C13A 1EDJA 2FFDC 2FBWC 2E61A 2KU3A 5KAFH 1NTKE 2KSEA 2B87B 3CMEP 2L43A 4PV1D 2LXPC 2MJZA 1RE3A 3CXHE 1XTGB 1N7SD 1SQVJ 1KYOI 1E79H 3LVQE 2R3CA 1WEUA 2LGLA 3O6QA 1URQB 4IFDK 2LXBA 1NGMB 1LTJA 5CHXA 3T6RA 4RJTA 2NAAA 2RSDA 3TYYA 5LKZA 3H1KJ 1J1DB 1MFZA 3A7OA 2WSEJ 1PIXA 1WT6A 1EXIA 2WSSH 2Y0DA 4WVZA 2MKEA 1SQQE 1KD1Q 3DQVR 3ZVZB 3KPEA 2KZIA 4I7BA 3TGUD 1FAVA 1GK6A 2Y0EA 3KHUA 1NTZG 4GDOA 1PGPA 3TSIA 2KXPB 1RQUA 2I8DA 3SOWA 1VQ5P 2LQ6A 1NU1J 5KLVJ 3H1KD 1G2CA 1JM7B 4ZKUA 1SQVE 2QM8A 1IFDA 2Y9ZA 2PGDA 1GU4A 1FE6A 1M7LA 1T2KD 3TF5A 1M1KQ 5SVYA 1NTMD 2H0DB 3EFFK 2OWAA 3PRJA 1GK4A 1SS1A 1OWAA 2YVRA 3V43A 1KFMA 2R3SA 2YSJA 4O64A 1HWTC 1EDLA 5AW2B 4ZDTA 1X9VA 1JY2N 1DEEG 5FB1A 4BRYA 3L71E 1ZRTD 3Q2YA 2UZGA 2CK3H 2E74B 1NTKG 1ZXGA 1IK7A 5SVXA 3QH9A 2JMIA 2W90A 1H88A 3L75G 3RL0D 2O01N 2OYOA 3FEHA 1JM7A 3TK1A 2A06D 5B76A 1BGYJ 1JY3N 1MZ9A 4N4FA 3ZDMA 1SQQG 2B88A 3Q1DA 3L70D 1DH3A 1H0TA 2W6AA 2XU6A 1DD4A 2JWDA 2OYHA 2PP6A 1SQVK 2XKMA 2ECIA 5C11A 3C6WA 1WIMA 1N73B 2M1RA 3RK3B 3D70A 1NTZJ 3H1IE 2YXQB 4PD4H 3NTNA 1RE4A 5I3LA 2IQJA 3B71A
chains in the Genus database with same CATH topology
3ZPV1 4GKGA 5TDWA 5B79A 3KQIA 1RF1C 2N1TC 2LRIC 2E42A 5KJ7A 2EA6A 5B77A 3M0AA 4IFFA 1IFNA 2KREA 2KR4A 2F6NA 4UP0A 3RK2C 2HDPA 3L11A 1J1DC 1QL1A 2D8SA 1JMMA 3M63A 2C0XA 4I1LA 2YSMA 4WZ3B 3LIDA 3IHPA 1GL2B 1J1EB 1A02J 2BASA 1J1EC 1SFCC 2KP8A 1YTZI 5AVUB 2HYED 1SFCB 1WEEA 1HGZA 3EB5A 4V3KC 5AIUA 3SWYA 4AYCA 2HYNA 4IC3A 1HYIA 2Y1NA 1WEQA 1NO4A 2IX7C 2L5GB 5APSA 2OXQC 2G43A 4WY4B 2YU4A 5KJ7D 2YT5A 3HUSA 4LC1A 1IFIA 1WEMA 2ECJA 5CCHC 1EQ7A 3H6PA 5AW4B 1ZBDB 1KFNA 2F6JA 2VPEA 4PTBA 3M91A 4W7ZA 3B5NC 4A4CA 3B5NB 2KWOA 2K16A 1AFOA 1HBWA 3QZVA 5AW0B 4KHXA 1JTHB 2A45I 5KTBA 1JCDA 3U5MA 4GNFA 2FXMA 5CCGD 3GHGC 1N86A 1MM2A 1JUNA 5CJ4A 2WITA 3RL0C 1HTLC 3VMXA 2I1JA 3L1XA 2Z4EA 3VOPA 3FL2A 3SOUA 5FERA 2YYRA 1M1JA 3HCUA 5KLVK 2MA6A 2PUYA 2KOGA 2N9BA 4P5OB 4A49A 5B75A 1HYJA 1X79B 1WEPA 4GNEA 1ZR4A 4B86A 3CI9A 1LT9C 5BVZA 4EIJA 3ZVYA 3L1ZB 3B5ND 4GT1A 1CW5A 2KWNA 3A3YB 1Z60A 2CSZA 1Z2QA 3T97A 1NKNA 5APVA 3SWFA 1VD4A 4AP4A 4LJNA 1VYXA 1JNMA 1IC2A 3VTPC 3VP9A 2WSCH 1LWUA 1FZGA 2CPBA 2YKPA 1NAFA 1N87A 5D1LB 4GNGA 2WT7A 2OYIA 2JRJA 3HE5A 2MUMA 3KNVA 2P2UA 1WRGA 4EOTA 3BVHA 3L35A 5DINA 4YABA 2L5UA 5JG6A 3BASA 1VPCA 4JF7A 2ECVA 3EFGA 3MIWA 4MSXA 5D1KB 4LLHA 3U5PA 2ECTA 2C9LY 1X4JA 5APYA 2YW8A 4XA4A 2OARA 2E6SA 3U5NA 1IJDB 3V2QA 3H32A 4YC9A 5H9MA 1G1IA 1X8YA 3WMM0 5AW3B 2NPSB 2K4DA 1YTZT 1KILA 1L4AA 2FYZA 4YBMA 2L0BA 1ZN5A 1GW4A 1URQC 3E1IA 1HUCA 2MNZA 1GL2D 3M06A 2HG5D 4Q6FA 2HLOA 1J2JB 3EB6A 3RK3D 2XDJA 4MVTA 1E4UA 1NKZB 2PNXA 2MNYA 2Y43A 3VN0A 1LT9B 2OYIC 4C7RA 3EQ2A 5BU5A 2BAYA 1GW3A 5APQA 1JY2O 2CKLB 2XZRA 4N3YB 2KYUA 1CI6A 2VJEB 3GHGA 2VRSA 2K1JA 3GV4A 3RK3C 3HTKB 4WBAA 5LCWB 1SLQA 5CCGA 2VPDA 3N7NA 2F42A 2M85A 4FK5A 2XNXA 5D1MB 1T2KC 5APTA 2VPBA 3VP8A 3M99A 5FEYA 2JEEA 1LTJC 4R7EA 4Y99B 2KSJA 5AW6B 1L4AD 1KILD 4IC2A 1FZCA 1LTSC 2WPQA 1BORA 1NWQA 3O70A 1T1HA 5KH3A 1YYCA 2N1TD 3U1CA 3N9NA 2O1KA 2WPRA 4O9BA 4W7YA 2HPCA 5G05B 2JMJA 2OYHC 3NG2A 2OYIB 1NTKK 1N7SA 2KWKA 3P8MC 3RPGC 3UIAA 1SFCD 1LDKC 4R8PK 4S3OB 2HODA 2YUCA 4S3OC 1RMDA 3DPLR 1CHCA 2YURA 4LLBA 2AN6A 4C9ZA 5APUA 2M8RA 5FB0A 3HD7C 2A45H 2E43A 1NHLA 1XTCC 2IFMA 3R2PA 2YHNA 5KH7A 3RL0B 1FBMA 2M3HA 3MTUE 2IDAA 1OXZA 2Z5IA 4LKAA 5DKAA 4B7YC 1RF0C 2J58A 2MA5A 2QIZA 4YAXA 5BU8B 4CCGX 1K2FA 3V2NA 2A45G 3HCSA 2FKWB 3HE4B 3BATA 3MGNA 4WY4C 2FFDB 2LDRA 2FYUK 2XB1A 5B78A 3O35A 4FIPA 3RK2B 2GUVA 3A2AA 3TNUA 1SQQK 1FZFA 1A02F 1AQ5A 4TKPB 1LTTC 2C2VS 2M3BA 5H1TA 2KGIA 1G1JA 2CKLA 2C9NY 2YO3A 4UI9B 5APXA 2YQLA 4LGDE 4DZOA 2C0WA 1V87A 4QF3A 1IFMA 4Y99C 1S9KE 4YADA 1VDFA 4XE5B 1HH0A 4RESB 1LGHB 3L4FA 2HPCB 1GD2E 2KE1A 4FO9A 1X4IA 4HYTB 1DVPA 5TDRA 2Q3IA 3U1AA 3O37A 4WA6A 4ZQLA 2G45A 4GNDA 2NPSD 3M9HA 1LTBC 1FJKA 1SVFA 2J59M 4L7XA 5LKXA 1NH4A 4N78E 2H0DA 2FUIA 5CCHD 2N1TA 2GUSA 3L36A 3C9IA 2WT7B 2YREA 3RPGB 2HODB 3G3ZA 5AW9B 3KV6A 1LTGC 3P8CD 2Z5HA 1JTHA 2Q7CA 3BRTB 1N7LA 1KQLA 4C46A 2YO2A 3P7KA 3P8CE 2IPPA 2C2LA 5CCHA 2ZETC 1IO4A 5AVVB 4N78D 4LK9A 2P7JA 2NPSC 3HRNA 1VFYA 3O33A 2WWWA 2LN0A 1JOCA 3HE5B 2Q9IA 3C5KA 4YBSA 5CJ0A 3GL6A 2E6RA 3O7AA 5AVZB 1Z56A 3NMDA 1S9KD 1GTWA 3HCTA 2IFNA 3M0DC 1T8ZA 3KV5A 2P67A 2ZFCA 2H7HA 2HFED 1GDTA 1JY2P 1GL2A 3M9BA 2ZXEB 2H8PD 4BHWA 1F62A 1DEBA 2YMYA 2FSAA 4NN2A 3KQGA 3LQIA 3T7LA 4AUWA 1XWHA 3B5NA 3ZNIA 1SQPK 2R32A 4JYCA 2XV5A 3N9LA 1IK9A 5AVRB 1G25A 1RF1A 5KJ7C 1JY3O 1RY3A 1PFIA 3ZTGA 4N3WA 5B8DA 3N9PA 5H1UA 4IFMA 1N7SC 2N1TB 1KILB 1KZUB 1L4AB 2NPSA 2KGGA 1FDMA 2G6QA 2YQMA 3LQJA 1URQA 1SP4A 2WPSA 4AYCB 3B8EB 4A0CD 2I1KA 2KYVA 2LXHC 2CPSA 1MUUA 5G04B 1FJPA 2LKMA 3LW5H 4QF2A 1W2EA 1RE3C 2ECWA 3P32A 4R2YA 1LTAC 2GM4A 1FZAA 5AVSB 5AVXB 4WZ0A 2YKOA 3KDPB 4C7NA 3IFMA 3ASLA 3V2RA 3MHHA 1X4UA 2MIQA 1H8AA 1FOSE 2P1JA 2POHA 1WEWA 2DX8A 2KLVA 2FUUA 1HGVA 4HH2A 4YBTA 3LRQA 2VJFB 2QM7A 1NTZK 2WTYA 2LGGA 3TNUB 4A4BA 5LKTA 2VP7A 5AVWB 1ZR2A 1FZCC 5C13A 1LWUC 2FFDC 2QICA 3LIEA 2KU3A 2KFTA 1FP0A 1LDJB 2JMDA 2LGVA 1NU1K 4CA1A 2L43A 1FZEA 2LXPC 2VPGA 5LKUA 2MJZA 2I50A 5AW8B 1RE3A 1IFJA 3MUDA 1GZLA 1XTGB 3HD7B 4N6JA 1N7SD 1N73A 2VNFA 3CLQA 1L0LK 1T3JA 3U59A 1WILA 5G0FA 2Q5UA 3HUSB 1M1JB 2R3CA 3VMZA 3HUSC 1WEUA 2LGLA 1WE9A 2MT5A 4WY4A 1N7SB 4B86C 1URQB 3M9QA 4IFDK 1CSBA 4AQRD 1RF0A 1LTJA 5CHXA 3T6RA 2R5BA 2OYHB 3PHDA 3VK6A 2NAAA 2RSDA 2W27A 5AW7B 3TYYA 5LKZA 1J1DB 1MFZA 3A7OA 4JYBA 1WENA 5EYAF 2MD7B 3O36A 4GB0A 1WT6A 1SQBK 5AVQB 2KWJA 3ZPVE 3N4XA 3DQVR 3MD0A 3ZVZB 3HTKA 1SQXK 4F52B 2K17A 3KPEA 4FJCA 2EODA 3M0DA 4I7BA 2H43A 3HE4A 4ZKPA 1URQD 1RF1B 1FAVA 1GK6A 4WZ2A 3SOXA 1FZCB 2KB7P 4I2LC 1H89A 2KIZA 2R5DA 3TSIA 1FZBA 4L58A 5AW5B 2MD8C 3SOWA 2LQ6A 1FBVA 1WEOA 1G2CA 1JM7B 4ZKUA 2QM8A 2QJ0A 1IFDA 2L75A 4V3LC 1CI6B 1GU4A 3V4WA 3MHSA 1M7LA 3V5BA 3OJAB 1T2KD 1MM3A 4YATA 1QL2A 1M1JC 1IYMA 2H0DB 3L37A 2FFDA 5AW1B 1GK4A 4W80A 1E5WA 1OWAA 3V43A 3OAKA 1KFMA 1WFKA 3CL3D 1WGMA 3PUQA 2YSJA 1RE4C 5KH9A 4O64A 3PP5A 1HWTC 3LQHA 3RK2D 5AW2B 2Y1MA 4ZDTA 3A5TA 5TBNA 5J3XA 1X9VA 4ZUXU 2L80A 1ZLLA 3H32B 1CZQA 5CCGC 5TABA 1JY2N 5CMZA 5FB1A 1FOSF 1LTIC 2XEUA 2UZGA 5AVYB 3VMYA 3V4QA 5AITA 1HVVA 1NTMK 5APWA 1T3UA 2EGPA 4WY4D 5TRBA 2WZ7A 3BRVB 2M6MA 2ECNA 4DOJA 3N9OA 3NXSA 3HD7D 4I7DA 3U5OA 1GU5A 4WB4A 2JMIA 1H88A 3RL0D 2LGKA 3II6A 2RI7A 2CT2A 4UP5A 1LWUB 2O1JA 1JCCA 3NFQA 2YHOA 2ECGA 4BBQA 2WSEH 4X3GA 1N73C 3KYQA 1N2DC 3TK1A 1JM7A 3HD7A 4W4UA 4XI1A 1DX7A 4OH8B 2VJEA 3HTKC 5B76A 1JY3N 1MZ9A 4GIFA 4N4FA 1MV8A 1LT9A 1JY3P 5AVTB 3PURA 1DH3A 1GL2C 3O8ZA 2W6AA 2XU6A 3SHBA 4I6MC 3N9MA 4M3LA 1WESA 3I5CA 1JO5A 3I2DA 2OYHA 4LADB 1KILC 1L4AC 2PP6A 3N9QA 1SQVK 3RTRB 2CSYA 2XKMA 2ECIA 2VJFA 1HJBA 5C11A 3C6WA 2JJLA 2YNYA 3V2PA 2LV9A 3IR9A 1WEVA 4PPEA 1WIMA 1N73B 2M1RA 3VYIA 4C7NB 4AUQB 1L0NK 3RK3B 1SFCA 3ZYQA 1FU1A 1NOHA 2PAJA 4I7CA 1G2CB 2WSFH 3NTNA 3M62A 5H1VA 3O34A 3GHGB 2O01H 2W6BA 1U6GB 4AVXA 1Z6UA 1RE4A 5I3LA 1LTJB 2YKQA 3OA7A 1ZV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPV 1;  5TDW A;  5B79 A;  3KQI A;  2LRI C;  2EA6 A;  5B77 A;  2KRE A;  2KR4 A;  2F6N A;  4UP0 A;  2HDP A;  3L11 A;  2D8S A;  3M63 A;  2YSM A;  4WZ3 B;  3IHP A;  2HYE D;  1WEE A;  3EB5 A;  4V3K C;  5AIU A;  4IC3 A;  4AYC A;  1HYI A;  2Y1N A;  1WEQ A;  2OXQ C;  2G43 A;  2YU4 A;  2YT5 A;  1WEM A;  2ECJ A;  2F6J A;  4PTB A;  1ZBD B;  2VPE A;  4A4C A;  2KWO A;  2K16 A;  3QZV A;  3U5M A;  4GNF A;  1MM2 A;  3L1X A;  3FL2 A;  3SOU A;  5FER A;  2YYR A;  3HCU A;  2MA6 A;  2PUY A;  4P5O B;  4A49 A;  5B75 A;  1HYJ A;  1WEP A;  4GNE A;  3ZVY A;  3L1Z B;  2KWN A;  1Z60 A;  2CSZ A;  1Z2Q A;  1VD4 A;  4AP4 A;  4LJN A;  1VYX A;  2YKP A;  1N87 A;  5D1L B;  4GNG A;  2JRJ A;  2MUM A;  3KNV A;  5DIN A;  4YAB A;  2L5U A;  5JG6 A;  2ECV A;  4MSX A;  5D1K B;  3U5P A;  2ECT A;  1X4J A;  2YW8 A;  2E6S A;  3U5N A;  5H9M A;  4YC9 A;  2K4D A;  4YBM A;  2L0B A;  2MNZ A;  4Q6F A;  3EB6 A;  4MVT A;  1E4U A;  2PNX A;  2Y43 A;  2MNY A;  3EQ2 A;  2BAY A;  2CKL B;  2KYU A;  2VJE B;  2K1J A;  3GV4 A;  5LCW B;  2VPD A;  2F42 A;  2M85 A;  4FK5 A;  5D1M B;  2VPB A;  5FEY A;  3M99 A;  4R7E A;  4IC2 A;  1BOR A;  3O70 A;  1T1H A;  5KH3 A;  5G05 B;  3N9N A;  2JMJ A;  3NG2 A;  2KWK A;  3RPG C;  1LDK C;  4R8P K;  4S3O B;  2YUC A;  4S3O C;  1RMD A;  3DPL R;  1CHC A;  2YUR A;  4LLB A;  2AN6 A;  4C9Z A;  5FB0 A;  2YHN A;  5KH7 A;  2M3H A;  2IDA A;  4LKA A;  5DKA A;  4B7Y C;  2QIZ A;  2MA5 A;  4YAX A;  4CCG X;  1K2F A;  3HCS A;  2XB1 A;  2LDR A;  5B78 A;  3O35 A;  4FIP A;  4TKP B;  2C2V S;  5H1T A;  2KGI A;  2CKL A;  4UI9 B;  2YQL A;  1V87 A;  4QF3 A;  4YAD A;  4FO9 A;  3L4F A;  2KE1 A;  1X4I A;  1DVP A;  5TDR A;  3O37 A;  4WA6 A;  4ZQL A;  2G45 A;  4GND A;  4L7X A;  5LKX A;  2H0D A;  2FUI A;  2YRE A;  3RPG B;  3KV6 A;  3BRT B;  2C2L A;  2ZET C;  4LK9 A;  1VFY A;  3O33 A;  2LN0 A;  1JOC A;  3C5K A;  4YBS A;  3GL6 A;  2E6R A;  3O7A A;  3HCT A;  3KV5 A;  4BHW A;  1F62 A;  2FSA A;  4NN2 A;  3LQI A;  3T7L A;  1XWH A;  3ZNI A;  3N9L A;  1G25 A;  3ZTG A;  4N3W A;  5B8D A;  3N9P A;  5H1U A;  3LQJ A;  2KGG A;  2G6Q A;  2YQM A;  4AYC B;  4A0C D;  2LXH C;  5G04 B;  4QF2 A;  2ECW A;  4R2Y A;  4WZ0 A;  2YKO A;  3ASL A;  3MHH A;  1X4U A;  2MIQ A;  1WEW A;  2DX8 A;  2FUU A;  4YBT A;  3LRQ A;  2VJF B;  2LGG A;  4A4B A;  5LKT A;  2VP7 A;  5C13 A;  2QIC A;  2KU3 A;  2KFT A;  1FP0 A;  1LDJ B;  2JMD A;  2LGV A;  4CA1 A;  2L43 A;  2LXP C;  2VPG A;  5LKU A;  2I50 A;  2VNF A;  1WIL A;  5G0F A;  2MT5 A;  1WEU A;  2LGL A;  1WE9 A;  4B86 C;  3T6R A;  3PHD A;  3VK6 A;  2NAA A;  2RSD A;  5LKZ A;  1WEN A;  5EYA F;  2MD7 B;  3O36 A;  4GB0 A;  2KWJ A;  3ZPV E;  3DQV R;  4F52 B;  3ZVZ B;  2K17 A;  4FJC A;  2EOD A;  4I7B A;  3SOX A;  4WZ2 A;  2KIZ A;  4L58 A;  2MD8 C;  3SOW A;  2LQ6 A;  1FBV A;  1WEO A;  1JM7 B;  2QJ0 A;  2L75 A;  4V3L C;  3MHS A;  1MM3 A;  4YAT A;  1IYM A;  2H0D B;  3V43 A;  1WFK A;  3CL3 D;  1WGM A;  3PUQ A;  2YSJ A;  5KH9 A;  4O64 A;  3LQH A;  2Y1M A;  4ZDT A;  5TBN A;  5J3X A;  4ZUX U;  2L80 A;  5TAB A;  5FB1 A;  2XEU A;  2UZG A;  5AIT A;  2EGP A;  5TRB A;  3BRV B;  2M6M A;  2ECN A;  3N9O A;  4I7D A;  3U5O A;  2JMI A;  2LGK A;  2RI7 A;  2CT2 A;  4UP5 A;  2YHO A;  2ECG A;  4BBQ A;  4X3G A;  1JM7 A;  4W4U A;  4XI1 A;  2VJE A;  3HTK C;  5B76 A;  4N4F A;  3PUR A;  3SHB A;  3N9M A;  1WES A;  3I2D A;  4LAD B;  3N9Q A;  3RTR B;  2CSY A;  2ECI A;  2VJF A;  5C11 A;  3C6W A;  2LV9 A;  1WEV A;  4PPE A;  1WIM A;  2M1R A;  4AUQ B;  3ZYQ A;  4I7C A;  5H1V A;  3M62 A;  3O34 A;  2W6B A;  1U6G B;  4AVX A;  1Z6U A;  5I3L A;  2YKQ A; 
#chains in the Genus database with same CATH topology
 1EC5 A;  5B66 E;  1QVG O;  3H1H E;  4IFF A;  1IFN A;  2KR4 A;  3RK2 C;  2HDP A;  1J1D C;  2D8S A;  1JMM A;  4H44 B;  1OX3 A;  2E5T A;  2XOC A;  3LID A;  1GL2 B;  1J1E B;  2ZT9 C;  1A02 J;  3H1L J;  2JDI H;  2HYE D;  3H1L E;  1HGZ A;  1KOR A;  2V7Q J;  3EB5 A;  2AXT H;  4IC3 A;  1HYI A;  1U7J A;  1NO4 A;  1EZV E;  5KKZ C;  2K3R A;  2G43 A;  2YU4 A;  3LDY A;  2YT5 A;  2KNC A;  1WEM A;  1EQ7 A;  1W2B O;  2K16 A;  5AW0 B;  3U5M A;  4GNF A;  5CCG D;  1N86 A;  2B87 A;  2ZT9 D;  3VMX A;  3VOP A;  3LW5 J;  2BCC J;  1M1J A;  1DD3 A;  3AEE C;  1N8R Q;  1Q7Y Q;  1X79 B;  3MDB C;  1RH5 B;  1VQP P;  3B5N D;  1Z60 A;  4Z0O A;  1NKN A;  2G3A A;  2ZVN B;  4AP4 A;  3AEB C;  3VP9 A;  1FZG A;  2YKP A;  1NAF A;  3L74 J;  1M8O B;  4GNG A;  2WT7 A;  2OYI A;  2AEJ A;  1K73 Q;  2P2U A;  1H0T B;  2KKX A;  2K88 A;  4LLH A;  3F5H A;  2C9L Y;  2WSC J;  5H9M A;  4YC9 A;  3H32 A;  3WMM 0;  5AW3 B;  2NPS B;  2K4D A;  1YTZ T;  2FYZ A;  1BCC D;  2L0B A;  3E1I A;  1KYO E;  3KZI E;  2UWJ E;  1SQX J;  4MVT A;  1NKZ B;  2Y43 A;  2MNY A;  3CCS P;  2XZR A;  3RK3 C;  1Q81 Q;  3CCM P;  1SLQ A;  1VQ6 P;  3MZW B;  3N7N A;  2M85 A;  4FK5 A;  2ITA A;  1L0N G;  2E76 B;  4U3F J;  5APT A;  2VPB A;  3VP8 A;  3M99 A;  5FEY A;  1LTJ C;  5AW6 B;  4TT3 H;  1KIL D;  3AEG C;  1FZC A;  3O70 A;  1EDI A;  5KH3 A;  2RN0 A;  3H1J J;  3N9N A;  1YHQ P;  2IBZ D;  3PHL A;  4W7Y A;  2JMJ A;  1HF9 A;  1SFC D;  4S3O B;  3GMA A;  3DPL R;  2AN6 A;  1NTZ E;  3CMA P;  3AEA C;  2OTK E;  2E43 A;  2KLU A;  5KH7 A;  1FBM A;  1USD A;  2Q6Q A;  3MTU E;  1OW7 A;  2J58 A;  4CCG X;  2A45 G;  2AEM A;  4L75 A;  3H1J D;  3O35 A;  1QGK B;  3TNU A;  1SQQ K;  4OVN F;  4TKP B;  3V6I A;  2YXR B;  1SQB G;  2CKL A;  4UI9 B;  3C1L A;  4PJ0 H;  1V87 A;  2HR3 A;  1OZH A;  2M5A A;  4Y99 C;  1SQP D;  1HH0 A;  1GD2 E;  4FO9 A;  2HPC B;  1DVP A;  4WA6 A;  4ASV A;  4N78 E;  2H0D A;  5CCH D;  2N1T A;  3L36 A;  2HOD B;  3G3Z A;  3KV6 A;  2IZ0 A;  3P8C D;  4ASW A;  3CCJ P;  2Q7C A;  1PL5 A;  3T97 B;  1N7L A;  5B66 H;  1NJI Q;  1PGO A;  5CCH A;  2ZET C;  3HRN A;  1KB9 D;  4YBS A;  3GL6 A;  3HCT A;  1S9K D;  3JUE A;  2FYU J;  4R4M A;  1U57 A;  3KV5 A;  2ZFC A;  3M9B A;  3GG2 A;  1ZOY C;  2P57 A;  4BHW A;  1DEB A;  2YMY A;  2FSA A;  4NN2 A;  3T7L A;  4AUW A;  1UIX A;  3FAN A;  1BGY E;  3N9L A;  5AVR B;  2FXP A;  1PFI A;  4N3W A;  3N9P A;  3H1J G;  1L4A B;  2R44 A;  3GF7 A;  1SP4 A;  4GOF A;  2E75 C;  4AYC B;  2KYV A;  2LXH C;  2FYU D;  1MUU A;  4XFJ A;  1W2E A;  1RE3 C;  2GM4 A;  1OVU A;  1FZA A;  3KDP B;  3V2R A;  3MHH A;  1X4U A;  4O62 A;  2POH A;  2DX8 A;  5KLV D;  2QG4 A;  4A4B A;  3RBZ A;  3FM8 C;  4DCK A;  1ZR2 A;  3G4S P;  1LWU C;  2QIC A;  1S5L E;  1LDJ B;  3K5B A;  1VQN P;  4CA1 A;  5LKU A;  2I50 A;  5AW8 B;  4N6J A;  3TDK A;  1N73 A;  2VNF A;  3H1H G;  1WIL A;  3RK3 E;  2Q5U A;  1NTK J;  3VMZ A;  1WE9 A;  1LNQ A;  3M9Q A;  1CSB A;  1RF0 A;  3PHD A;  2OYH B;  2DSM A;  2EXU A;  2IYO A;  1VQO P;  4JYB A;  4PD4 I;  1SQQ J;  5EYA F;  3O36 A;  2QE7 H;  3BCC D;  3ZPV E;  3N4X A;  3MD0 A;  1SQX K;  3HTK A;  4ZKP A;  1LP1 A;  3FXE A;  2KB7 P;  1H89 A;  1Q86 Q;  5AW5 B;  3IAO A;  1K9M Q;  5KAI H;  4OGQ D;  3PJS K;  1YQ3 C;  1KYO H;  3KZI H;  2OTJ P;  3I56 P;  3MHS A;  4PD4 D;  1MM3 A;  4YAT A;  4H13 B;  1M1J C;  5AW1 B;  2Q1K A;  4L74 A;  3L74 E;  1K05 A;  3F89 A;  2JP3 A;  1YIT P;  4ZUX U;  3Q3D A;  2L80 A;  1ZLL A;  1CZQ A;  2E74 D;  4D6T E;  1FOS F;  1SQB D;  4H0L D;  1NVO A;  3VMY A;  5GTI E;  5APW A;  1T3U A;  5TRB A;  2WZ7 A;  1SQP G;  2O01 J;  3NXS A;  3HD7 D;  1GU5 A;  2V4H A;  4R4L A;  4WB4 A;  4UP5 A;  1JCC A;  1LP1 B;  2YHO A;  1X22 A;  2ECG A;  3JC2 2;  2WSE H;  1N73 C;  2OGU A;  3HD7 A;  4W4U A;  4OH8 B;  2VJE A;  4GIF A;  5M1B A;  1MV8 A;  1LT9 A;  4DT0 A;  5E79 H;  5AVT B;  2SPZ A;  1LJ2 A;  3PUR A;  1GL2 C;  3SHB A;  1S4X A;  3I5C A;  4LAD B;  1KIL C;  3RTR B;  2CSY A;  3G71 P;  1P84 D;  2YNY A;  2YMK A;  1SQP E;  2CON A;  4AUQ B;  1PPJ E;  1L0N K;  2QIW A;  2ZYA A;  3ZYQ A;  1NOH A;  4I7C A;  3M62 A;  3L73 E;  3CC4 P;  2O01 H;  2W6B A;  3A0H E;  3AE9 C;  3L75 D;  3KXD A;  3WUV A;  4JQ0 D;  5B79 A;  2N1T C;  3FX0 A;  5KJ7 A;  2EA6 A;  1YI2 P;  1VF5 C;  3M0A A;  2KRE A;  2E75 B;  2F6N A;  4IL6 E;  5CBN A;  1QL1 A;  2C0X A;  3H1I J;  4WZ3 B;  4GOD A;  2ZYG A;  2KP8 A;  5AVU B;  1SFC B;  1Q82 Q;  2IZ1 A;  4V3K C;  2HYN A;  2Y1N A;  2L5G B;  4NPF X;  1VF5 D;  1R5S A;  4WY4 B;  5KJ7 D;  3HUS A;  1KIL E;  3E1R A;  4L76 A;  4PTB A;  1MFT A;  5CCH C;  4YXD C;  1ZBD B;  2VPE A;  5B5E E;  2W6J H;  1AFO A;  1FS0 E;  4KHX A;  2CRW A;  3GHG C;  3L70 G;  2WIT A;  2QJY C;  3RL0 C;  3W68 A;  1HTL C;  3A0B H;  2Z4E A;  4TLF A;  3FL2 A;  3HCU A;  2KOG A;  2N9B A;  1ZR4 A;  4B86 A;  1LT9 C;  2NRG A;  3RGU A;  1BCC E;  3L1Z B;  4GT1 A;  2KWN A;  1L0N E;  3A3Y B;  3MHV A;  1Z2Q A;  5APV A;  3SWF A;  1VYX A;  2IDB A;  2WVR A;  1BDC A;  2WSC H;  5D1L B;  1VQM P;  4BXL A;  3WUT A;  3USS A;  3KNV A;  1WRG A;  3BVH A;  4YAB A;  1M56 D;  1VPC A;  1YBK A;  3EWK A;  5D1K B;  2ZJS E;  1VQL P;  4UB8 H;  1KN7 A;  2OAR A;  2E6S A;  2D8U A;  1X8Y A;  4OWF A;  1KIL A;  5K3Q A;  2DW3 A;  1HUC A;  5H2F H;  2MNZ A;  5KAF E;  2PFX A;  2XDJ A;  1SQP J;  2CKL B;  3C8V A;  2VJE B;  1AV1 A;  3HTK B;  4HJG H;  4WBA A;  5LCW B;  2VPD A;  1QEX A;  4OGQ B;  2JEE A;  4IC2 A;  2WPQ A;  1NWQ A;  1YYC A;  2N1T D;  2WPR A;  3R4Y A;  4O9B A;  1L2P A;  2GA1 A;  3WU2 E;  5C39 A;  2IBZ I;  1RMD A;  4LLB A;  3CXH I;  5APU A;  2ZAE B;  4H13 D;  2YHN A;  4Z1M H;  2M3H A;  2Z5I A;  5DKA A;  4B7Y C;  1RF0 C;  4YAX A;  5BU8 B;  3V2N A;  2FKW B;  2XB1 A;  2FFD B;  2FYU K;  1EZV G;  1AVO A;  3A2A A;  1PGQ A;  1A02 F;  3CCE P;  1LTT C;  2KGI A;  3L73 D;  2JKV A;  1PPJ D;  1SQX D;  2C0W A;  4QF3 A;  3SSU A;  1IFM A;  2QVA A;  2IBZ G;  1EXJ A;  2KE1 A;  1P84 E;  3U1A A;  2Q3E A;  1LTB C;  1FJK A;  3M9H A;  3AE4 C;  4U3F D;  2WT7 B;  3RPG B;  5GTH E;  3FJU B;  3AEC C;  1JTH A;  3L70 E;  2YO2 A;  3P7K A;  4UB6 E;  1KB9 I;  2C2L A;  1LT1 A;  1OW6 A;  2XOZ A;  4LK9 A;  2P7J A;  1VFY A;  3O33 A;  1DIP A;  3HE5 B;  3C5K A;  3O7A A;  1OW8 A;  2OQQ A;  2JWA A;  1T8Z A;  3A0H H;  1GDT A;  1GL2 A;  1JEK A;  3AED C;  2ZXE B;  2H8P D;  3LQI A;  3ZNI A;  2A06 G;  4JYC A;  1ZRT E;  4HKZ H;  1NYH A;  1JM0 A;  5KJ7 C;  1RY3 A;  3ZTG A;  2N1T B;  3LQJ A;  1KZU B;  2KGG A;  2NPS A;  1FDM A;  2JR8 A;  1BE3 G;  1D7M A;  5DJT B;  4A0C D;  2W8Z A;  2I1K A;  2E75 D;  2CPS A;  2KK7 A;  2ZYD A;  4QF2 A;  2ECW A;  4R2Y A;  4PD4 E;  4PV1 B;  5AVX B;  5AVS B;  4WZ0 A;  1YJN P;  3FAO A;  1SQV D;  1FOS E;  1Y8A A;  1VL2 A;  5CBO A;  1HGV A;  1NTZ K;  2JO1 A;  3TNU B;  2VP7 A;  3LIE A;  2WSF J;  2KFT A;  2JM3 A;  2LGV A;  1NU1 K;  2EGM A;  3BCC E;  1QX8 A;  2VPG A;  3E2D A;  3CLQ A;  1L0L E;  1M1J B;  3O47 A;  2MT5 A;  3HUS C;  4B86 C;  2XOY A;  3VK6 A;  3IF4 A;  3L71 J;  1KQS O;  2H89 C;  2W27 A;  5AW7 B;  1ZME C;  3CXH D;  2MD7 B;  3D6Z A;  4GB0 A;  1SQB K;  5AVQ B;  2KWJ A;  4F52 B;  2XP0 A;  3T9K A;  1ZP0 C;  1U7M A;  4FJC A;  2EOD A;  2LAU A;  3AE5 C;  2B0O E;  4Y28 J;  3HE4 A;  1URQ D;  1RF1 B;  2D2C D;  3SOX A;  3L74 G;  2R5D A;  3PTZ A;  4L58 A;  2RMZ A;  1L0N D;  1FBV A;  2N9Y B;  1T6A A;  2QJ0 A;  2K9J A;  3V5B A;  3OJA B;  4JBZ A;  2QRX A;  3L37 A;  2FFD A;  2FYU E;  4OGC A;  3WUU A;  3CCQ P;  1WMK A;  1PP9 E;  1WFK A;  3CL3 D;  1WGM A;  1AQT A;  4MN4 C;  1RE4 C;  3PUQ A;  3RK2 D;  2Y1M A;  5TBN A;  1AA0 A;  4I7Z B;  1L0N J;  2P10 A;  1BGY D;  4YTP C;  1LTI C;  2XEU A;  3L73 G;  1JMB A;  1RQV A;  1EZV I;  2E74 C;  3V4Q A;  1NTM K;  2EGP A;  3WU2 H;  3BRV B;  5H2F E;  3DWD A;  4DOJ A;  4HB1 A;  2WQY C;  4I7D A;  3U5O A;  3II6 A;  2CT2 A;  1LWU B;  2O1J A;  4BBQ A;  1KTM A;  1DX7 A;  4I7Z C;  1VQK P;  4UB8 E;  4I6M C;  1PGJ A;  3N9M A;  1M90 Q;  4OGE A;  1JO5 A;  3N9Q A;  2VJF A;  3ITK A;  2L91 A;  2JJL A;  3Q5S A;  3V2P A;  2LV9 A;  3O6Q B;  4H9D A;  4PPE A;  1Q2N A;  3VYI A;  4H44 D;  1FU1 A;  2PAJ A;  1G2C B;  4YPC A;  3L70 J;  1Z6U A;  2YKQ A;  3ZPV 1;  4GKG A;  1PZQ A;  3KQI A;  2E42 A;  3W67 A;  5GTI H;  2YSM A;  1OIP A;  1NTZ D;  3IHP A;  2K37 A;  2BAS A;  1J1E C;  1SFC C;  2ZT9 B;  1YTZ I;  1WEE A;  3CC7 P;  1BDD A;  5DJU B;  1P84 H;  4KJM A;  1USE A;  3SWY A;  4AYC A;  3CX5 H;  2IBZ E;  2IX7 C;  2RR4 A;  1EDK A;  5L8R J;  2F6J A;  3JSV C;  5AW4 B;  4W7Z A;  3B5N B;  2KWO A;  4UB6 H;  1HBW A;  1JTH B;  2A45 I;  1KQF B;  1MM2 A;  3LVR E;  1JUN A;  3L74 D;  2I1J A;  3L1X A;  1PP9 D;  1AJY A;  5FER A;  2YYR A;  5KLV K;  2M13 A;  2KZJ A;  1HYJ A;  3CI9 A;  3SUB A;  4EIJ A;  1CW5 A;  3T97 A;  4LJN A;  1JNM A;  4H13 C;  4NPE A;  3CCR P;  2CPB A;  1N87 A;  1PP9 J;  1YJW P;  2JRJ A;  1UII A;  2MUM A;  1OVV A;  4IL6 X;  2L5U A;  2FXO A;  3BAS A;  2FFW A;  2ECV A;  3MIW A;  3BCC G;  4YXW H;  4MSX A;  2FYN B;  3U5P A;  2QEX P;  1X4J A;  5APY A;  4XA4 A;  3U5N A;  1IJD B;  3V2Q A;  2FD4 A;  1G1I A;  4K3A A;  4YBM A;  1GMJ A;  1ZN5 A;  2ZVO B;  3L73 J;  2OTL P;  1GL2 D;  3EB6 A;  2BCC G;  1L0L D;  2PNX A;  3VN0 A;  3H25 A;  4C7R A;  5BU5 A;  3EQ2 A;  2BAY A;  1GW3 A;  5APQ A;  1JY2 O;  1CI6 A;  3GV4 A;  5CCG A;  2F42 A;  3CCL P;  1T2K C;  1QLE D;  3AE7 C;  4U3F G;  4R7E A;  4Y99 B;  3L72 G;  1L4A D;  3Q1M A;  1LTS C;  2QJK C;  5KLV E;  1T1H A;  2FY8 A;  5KKZ B;  3CC2 P;  3H1K G;  2PRR A;  1PV3 A;  3NG2 A;  3CWB D;  5TIS E;  1NTK K;  4U7J A;  2KWK A;  3RPG C;  2K9J B;  1FC2 C;  3UIA A;  1LDK C;  4R8P K;  1Y47 A;  3CD6 P;  2M3E A;  1KC8 Q;  5FB0 A;  3HD7 C;  2A45 H;  1NHL A;  1XTC C;  2IFM A;  3R2P A;  4LKA A;  2QIZ A;  3HE4 B;  4WY4 C;  3RK2 B;  2GUV A;  3CWB G;  3CWB J;  1JB0 J;  1FZF A;  2YIU C;  2RKL A;  2P58 A;  2C2V S;  1OFC X;  5H1T A;  2QJP B;  1G1J A;  1VQ8 P;  5APX A;  2BCC E;  2AEF A;  3Q5R A;  4YAD A;  3D6Y A;  4XE5 B;  1LGH B;  1X4I A;  3S1K A;  2Q3I A;  3O37 A;  1KB9 E;  2NPS D;  1PP9 G;  5LKX A;  1NH4 A;  1NU1 E;  2GUS A;  3C9I A;  2IYP A;  3CPW O;  2K9Y A;  3Q5P A;  5KAI E;  3BRT B;  4C46 A;  3P8C E;  1AVY A;  4JPZ B;  2IPP A;  4U3F E;  1IO4 A;  4N78 D;  2H88 C;  2A06 E;  4K35 A;  2G8Y A;  2NPS C;  2LN0 A;  1Q90 D;  1JOC A;  5CJ0 A;  2E6R A;  1Z56 A;  2Y9Y A;  1Y9B A;  1SQX E;  3M0D C;  3AE2 C;  1JY2 P;  1QVF O;  1F62 A;  4ZNC A;  1XWH A;  3B5N A;  2R32 A;  3L71 D;  5KLI C;  1IK9 A;  1G25 A;  1JY3 O;  2KUB A;  5B8D A;  5H1U A;  1KIL B;  2G6Q A;  1URQ A;  4PJ0 E;  5G04 B;  1FJP A;  1S5L X;  2LKM A;  1NTM E;  3LW5 H;  1FDI A;  3TGU J;  1LTA C;  3JCU E;  1KV4 A;  4C7N A;  3ASL A;  5KLV G;  2MIQ A;  3H1I G;  1H8A A;  1PPJ G;  3H1K E;  2FUU A;  2KLV A;  1YJ9 P;  3MP7 B;  2QM7 A;  2WTY A;  1FDO A;  1W5C E;  5LKT A;  5AVW B;  3TGU E;  1FP0 A;  2JMD A;  3QWO C;  1SQQ D;  2V7Q H;  2KS1 A;  1FZE A;  2ZXX A;  4D6T G;  1IFJ A;  3MUD A;  1GZL A;  3HD7 B;  3BCC J;  1R8E A;  2W83 C;  4RKU J;  1L0L K;  1T3J A;  3U59 A;  1VQ9 P;  2FYU G;  5G0F A;  3CX5 E;  3HUS B;  3H1L G;  1KYO D;  4WY4 A;  1N7S B;  4ZMD A;  4RO0 A;  4AQR D;  2R5B A;  2M0B A;  3CX5 D;  3FXD A;  1WEN A;  4H44 C;  4EI2 A;  1NTM G;  3M7K A;  1TU3 F;  3L72 J;  1MBM A;  2K17 A;  3M0D A;  1NTK D;  2H43 A;  2WPV B;  4WZ2 A;  1FZC B;  3S9O A;  1RHZ B;  4I2L C;  2KIZ A;  1FZB A;  2MD8 C;  1VQ7 P;  3AEF C;  1WEO A;  1SQB J;  3CCU P;  1BCC G;  2L75 A;  2LR2 A;  3SFE C;  4V3L C;  1CI6 B;  3V4W A;  5SVI A;  1QL2 A;  2K1A A;  1IYM A;  1OVR A;  1HJ0 A;  1L0L G;  2L7P A;  4W80 A;  1E5W A;  3OAK A;  2LXC B;  5KH9 A;  3PP5 A;  3LQH A;  3L71 G;  3A5T A;  5J3X A;  3H32 B;  5CCG C;  5TAB A;  2YIU B;  5CMZ A;  3DDT A;  2E5Y A;  5AVY B;  5AIT A;  3PH0 A;  1HVV A;  3H1H J;  4KT0 J;  4WY4 D;  2KS1 B;  5TIS H;  2M6M A;  3PLW A;  1EZV D;  2QJK B;  2ECN A;  3N9O A;  1SQX G;  3H7H A;  2LGK A;  2RI7 A;  3H1L D;  1KQG B;  3NFQ A;  4X3G A;  3KYQ A;  1N2D C;  4XI1 A;  1VQ4 P;  1KB9 H;  3HTK C;  2BEQ D;  2KIK A;  1JY3 P;  2Y0C A;  3B4S A;  1S1C X;  4Z0R A;  3O8Z A;  4M3L A;  1WES A;  3H1H D;  3S4R A;  5B5E H;  3I2D A;  3RL0 g;  1NU1 D;  1L4A C;  1M57 D;  1MKM A;  3L75 E;  2NZ2 A;  3IN6 A;  1HJB A;  1S5L H;  3IR9 A;  1WEV A;  1BE3 J;  3I55 P;  3H1I D;  2BCC D;  1NTM J;  3MUD C;  4C7N B;  4QMA A;  1SFC A;  2BEZ F;  2WSF H;  5H1V A;  3O34 A;  3GHG B;  5K5G B;  1U6G B;  4AVX A;  1LTJ B;  3OA7 A;  1ZV8 A;  5TDW A;  1RF1 C;  2LRI C;  5SVI B;  5B77 A;  3SWK A;  4UP0 A;  1S72 P;  3L11 A;  1S3J A;  3M63 A;  3GF3 A;  1BE3 D;  3GLM A;  4D6T J;  1BGY G;  4I1L A;  3CXH H;  3E7K A;  5AIU A;  3JCU H;  2O3J A;  3L75 J;  4H0L B;  3CWB E;  1WEQ A;  2KNC B;  5APS A;  2OXQ C;  5E79 E;  5GTH H;  4LC1 A;  1IFI A;  2ECJ A;  3H6P A;  1KFN A;  1SQB E;  3M91 A;  4A4C A;  3B5N C;  3QZV A;  4D6T D;  5KTB A;  1JCD A;  1BSH A;  2FXM A;  1YIJ P;  2KKY A;  5CJ4 A;  3SOU A;  2MA6 A;  2PUY A;  4P5O B;  1VF5 B;  4A49 A;  5B75 A;  1WEP A;  4GNE A;  1ZW0 A;  5BVZ A;  2KI7 B;  3ZVY A;  2CSZ A;  1VD4 A;  1IC2 A;  3VTP C;  1LWU A;  4WWI A;  2D2C C;  3HE5 A;  3TGU G;  4EOT A;  5DIN A;  3L35 A;  5JG6 A;  1X0T A;  2WMM A;  3EFG A;  4JF7 A;  2ECT A;  2QSI A;  1K04 A;  4BRY B;  2YW8 A;  4EDF A;  1L4A A;  3CX5 I;  4H0L C;  1GW4 A;  1URQ C;  3M06 A;  4Q6F A;  2HG5 D;  2HLO A;  1J2J B;  5TJH A;  2J5U A;  3RK3 D;  1OMI A;  1E4U A;  2OYI C;  1LT9 B;  3FWN A;  1KMI Z;  4N3Y B;  2KYU A;  3GHG A;  2VRS A;  3A0B E;  2K1J A;  4BWN A;  4IOI H;  1S2E A;  2QJP C;  4QQ4 A;  2XNX A;  5D1M B;  3G9R A;  2KSJ A;  1IFP A;  1BOR A;  1IZN B;  5G05 B;  3U1C A;  2O1K A;  2HPC A;  4CPG A;  2CSV A;  2OYH C;  4IL6 H;  2OYI B;  1N7S A;  3P8M C;  1R5L A;  2HOD A;  2YUC A;  4S3O C;  1CHC A;  2YUR A;  4C9Z A;  2M8R A;  2B89 A;  1BSN A;  1BE3 E;  4A7P A;  3L72 E;  2QJY B;  3RL0 B;  3G6E P;  2IDA A;  1OXZ A;  3VMA A;  3FWL A;  2MA5 A;  1K2F A;  3LJU X;  2M5A B;  3HCS A;  3MGN A;  3BAT A;  2LDR A;  5B78 A;  4FIP A;  1AQ5 A;  1BCC J;  3AE1 C;  2M3B A;  3GW6 A;  2JUN A;  2C9N Y;  2YO3 A;  2RH0 A;  2E76 C;  2YQL A;  4LGD E;  3FGA D;  4DZO A;  4L73 A;  1L0L J;  4NPD A;  3SFD C;  4F1P A;  1NAY A;  1S9K E;  1VDF A;  1K8A Q;  4RES B;  3L4F A;  2AXC A;  4HYT B;  5TDR A;  3PLN A;  4ZQL A;  2G45 A;  4GND A;  2J59 M;  1SVF A;  3AE6 C;  4L7X A;  2FUI A;  4EYY Q;  2YRE A;  1DCQ A;  5AW9 B;  1LTG C;  2Z5H A;  1KQL A;  3AE3 C;  5KLI B;  5AVV B;  3RBX A;  1P84 I;  2QA4 P;  5EFW B;  2WWW A;  2D2C B;  2Q9I A;  2DJA A;  3KDE C;  5AVZ B;  1GTW A;  3NMD A;  2IFN A;  1NU1 G;  1YQ4 C;  2P67 A;  2H7H A;  2HFE D;  2FYN C;  4DJG A;  3KQG A;  2B9B A;  3D71 A;  3ABV C;  1SQP K;  4OGQ C;  2XV5 A;  3H1J E;  1RF1 A;  3AE8 C;  4IFM A;  1N7S C;  2CRR A;  2YQM A;  3L72 D;  2XND H;  2WPS A;  3B8E B;  2E76 D;  3CCV P;  3P32 A;  4PV1 C;  2AXT E;  2YKO A;  3OW2 O;  3IFM A;  2P1J A;  1WEW A;  2MKV A;  4HH2 A;  4YBT A;  1SQV G;  3LRQ A;  2VJF B;  2LGG A;  4GOE A;  1FZC C;  5C13 A;  1EDJ A;  2FFD C;  2FBW C;  2E61 A;  2KU3 A;  5KAF H;  1NTK E;  2KSE A;  2B87 B;  3CME P;  2L43 A;  4PV1 D;  2LXP C;  2MJZ A;  1RE3 A;  3CXH E;  1XTG B;  1N7S D;  1SQV J;  1KYO I;  1E79 H;  3LVQ E;  2R3C A;  1WEU A;  2LGL A;  3O6Q A;  1URQ B;  4IFD K;  2LXB A;  1NGM B;  1LTJ A;  5CHX A;  3T6R A;  4RJT A;  2NAA A;  2RSD A;  3TYY A;  5LKZ A;  3H1K J;  1J1D B;  1MFZ A;  3A7O A;  2WSE J;  1PIX A;  1WT6 A;  1EXI A;  2WSS H;  2Y0D A;  4WVZ A;  2MKE A;  1SQQ E;  1KD1 Q;  3DQV R;  3ZVZ B;  3KPE A;  2KZI A;  4I7B A;  3TGU D;  1FAV A;  1GK6 A;  2Y0E A;  3KHU A;  1NTZ G;  4GDO A;  1PGP A;  3TSI A;  2KXP B;  1RQU A;  2I8D A;  3SOW A;  1VQ5 P;  2LQ6 A;  1NU1 J;  5KLV J;  3H1K D;  1G2C A;  1JM7 B;  4ZKU A;  1SQV E;  2QM8 A;  1IFD A;  2Y9Z A;  2PGD A;  1GU4 A;  1FE6 A;  1M7L A;  1T2K D;  3TF5 A;  1M1K Q;  5SVY A;  1NTM D;  2H0D B;  3EFF K;  2OWA A;  3PRJ A;  1GK4 A;  1SS1 A;  1OWA A;  2YVR A;  3V43 A;  1KFM A;  2R3S A;  2YSJ A;  4O64 A;  1HWT C;  1EDL A;  5AW2 B;  4ZDT A;  1X9V A;  1JY2 N;  1DEE G;  5FB1 A;  4BRY A;  3L71 E;  1ZRT D;  3Q2Y A;  2UZG A;  2CK3 H;  2E74 B;  1NTK G;  1ZXG A;  1IK7 A;  5SVX A;  3QH9 A;  2JMI A;  2W90 A;  1H88 A;  3L75 G;  3RL0 D;  2O01 N;  2OYO A;  3FEH A;  1JM7 A;  3TK1 A;  2A06 D;  5B76 A;  1BGY J;  1JY3 N;  1MZ9 A;  4N4F A;  3ZDM A;  1SQQ G;  2B88 A;  3Q1D A;  3L70 D;  1DH3 A;  1H0T A;  2W6A A;  2XU6 A;  1DD4 A;  2JWD A;  2OYH A;  2PP6 A;  1SQV K;  2XKM A;  2ECI A;  5C11 A;  3C6W A;  1WIM A;  1N73 B;  2M1R A;  3RK3 B;  3D70 A;  1NTZ J;  3H1I E;  2YXQ B;  4PD4 H;  3NTN A;  1RE4 A;  5I3L A;  2IQJ A;  3B71 A; 
#chains in the Genus database with same CATH homology
 3ZPV 1;  4GKG A;  5TDW A;  5B79 A;  3KQI A;  1RF1 C;  2N1T C;  2LRI C;  2E42 A;  5KJ7 A;  2EA6 A;  5B77 A;  3M0A A;  4IFF A;  1IFN A;  2KRE A;  2KR4 A;  2F6N A;  4UP0 A;  3RK2 C;  2HDP A;  3L11 A;  1J1D C;  1QL1 A;  2D8S A;  1JMM A;  3M63 A;  2C0X A;  4I1L A;  2YSM A;  4WZ3 B;  3LID A;  3IHP A;  1GL2 B;  1J1E B;  1A02 J;  2BAS A;  1J1E C;  1SFC C;  2KP8 A;  1YTZ I;  5AVU B;  2HYE D;  1SFC B;  1WEE A;  1HGZ A;  3EB5 A;  4V3K C;  5AIU A;  3SWY A;  4AYC A;  2HYN A;  4IC3 A;  1HYI A;  2Y1N A;  1WEQ A;  1NO4 A;  2IX7 C;  2L5G B;  5APS A;  2OXQ C;  2G43 A;  4WY4 B;  2YU4 A;  5KJ7 D;  2YT5 A;  3HUS A;  4LC1 A;  1IFI A;  1WEM A;  2ECJ A;  5CCH C;  1EQ7 A;  3H6P A;  5AW4 B;  1ZBD B;  1KFN A;  2F6J A;  2VPE A;  4PTB A;  3M91 A;  4W7Z A;  3B5N C;  4A4C A;  3B5N B;  2KWO A;  2K16 A;  1AFO A;  1HBW A;  3QZV A;  5AW0 B;  4KHX A;  1JTH B;  2A45 I;  5KTB A;  1JCD A;  3U5M A;  4GNF A;  2FXM A;  5CCG D;  3GHG C;  1N86 A;  1MM2 A;  1JUN A;  5CJ4 A;  2WIT A;  3RL0 C;  1HTL C;  3VMX A;  2I1J A;  3L1X A;  2Z4E A;  3VOP A;  3FL2 A;  3SOU A;  5FER A;  2YYR A;  1M1J A;  3HCU A;  5KLV K;  2MA6 A;  2PUY A;  2KOG A;  2N9B A;  4P5O B;  4A49 A;  5B75 A;  1HYJ A;  1X79 B;  1WEP A;  4GNE A;  1ZR4 A;  4B86 A;  3CI9 A;  1LT9 C;  5BVZ A;  4EIJ A;  3ZVY A;  3L1Z B;  3B5N D;  4GT1 A;  1CW5 A;  2KWN A;  3A3Y B;  1Z60 A;  2CSZ A;  1Z2Q A;  3T97 A;  1NKN A;  5APV A;  3SWF A;  1VD4 A;  4AP4 A;  4LJN A;  1VYX A;  1JNM A;  1IC2 A;  3VTP C;  3VP9 A;  2WSC H;  1LWU A;  1FZG A;  2CPB A;  2YKP A;  1NAF A;  1N87 A;  5D1L B;  4GNG A;  2WT7 A;  2OYI A;  2JRJ A;  3HE5 A;  2MUM A;  3KNV A;  2P2U A;  1WRG A;  4EOT A;  3BVH A;  3L35 A;  5DIN A;  4YAB A;  2L5U A;  5JG6 A;  3BAS A;  1VPC A;  4JF7 A;  2ECV A;  3EFG A;  3MIW A;  4MSX A;  5D1K B;  4LLH A;  3U5P A;  2ECT A;  2C9L Y;  1X4J A;  5APY A;  2YW8 A;  4XA4 A;  2OAR A;  2E6S A;  3U5N A;  1IJD B;  3V2Q A;  3H32 A;  4YC9 A;  5H9M A;  1G1I A;  1X8Y A;  3WMM 0;  5AW3 B;  2NPS B;  2K4D A;  1YTZ T;  1KIL A;  1L4A A;  2FYZ A;  4YBM A;  2L0B A;  1ZN5 A;  1GW4 A;  1URQ C;  3E1I A;  1HUC A;  2MNZ A;  1GL2 D;  3M06 A;  2HG5 D;  4Q6F A;  2HLO A;  1J2J B;  3EB6 A;  3RK3 D;  2XDJ A;  4MVT A;  1E4U A;  1NKZ B;  2PNX A;  2MNY A;  2Y43 A;  3VN0 A;  1LT9 B;  2OYI C;  4C7R A;  3EQ2 A;  5BU5 A;  2BAY A;  1GW3 A;  5APQ A;  1JY2 O;  2CKL B;  2XZR A;  4N3Y B;  2KYU A;  1CI6 A;  2VJE B;  3GHG A;  2VRS A;  2K1J A;  3GV4 A;  3RK3 C;  3HTK B;  4WBA A;  5LCW B;  1SLQ A;  5CCG A;  2VPD A;  3N7N A;  2F42 A;  2M85 A;  4FK5 A;  2XNX A;  5D1M B;  1T2K C;  5APT A;  2VPB A;  3VP8 A;  3M99 A;  5FEY A;  2JEE A;  1LTJ C;  4R7E A;  4Y99 B;  2KSJ A;  5AW6 B;  1L4A D;  1KIL D;  4IC2 A;  1FZC A;  1LTS C;  2WPQ A;  1BOR A;  1NWQ A;  3O70 A;  1T1H A;  5KH3 A;  1YYC A;  2N1T D;  3U1C A;  3N9N A;  2O1K A;  2WPR A;  4O9B A;  4W7Y A;  2HPC A;  5G05 B;  2JMJ A;  2OYH C;  3NG2 A;  2OYI B;  1NTK K;  1N7S A;  2KWK A;  3P8M C;  3RPG C;  3UIA A;  1SFC D;  1LDK C;  4R8P K;  4S3O B;  2HOD A;  2YUC A;  4S3O C;  1RMD A;  3DPL R;  1CHC A;  2YUR A;  4LLB A;  2AN6 A;  4C9Z A;  5APU A;  2M8R A;  5FB0 A;  3HD7 C;  2A45 H;  2E43 A;  1NHL A;  1XTC C;  2IFM A;  3R2P A;  2YHN A;  5KH7 A;  3RL0 B;  1FBM A;  2M3H A;  3MTU E;  2IDA A;  1OXZ A;  2Z5I A;  4LKA A;  5DKA A;  4B7Y C;  1RF0 C;  2J58 A;  2MA5 A;  2QIZ A;  4YAX A;  5BU8 B;  4CCG X;  1K2F A;  3V2N A;  2A45 G;  3HCS A;  2FKW B;  3HE4 B;  3BAT A;  3MGN A;  4WY4 C;  2FFD B;  2LDR A;  2FYU K;  2XB1 A;  5B78 A;  3O35 A;  4FIP A;  3RK2 B;  2GUV A;  3A2A A;  3TNU A;  1SQQ K;  1FZF A;  1A02 F;  1AQ5 A;  4TKP B;  1LTT C;  2C2V S;  2M3B A;  5H1T A;  2KGI A;  1G1J A;  2CKL A;  2C9N Y;  2YO3 A;  4UI9 B;  5APX A;  2YQL A;  4LGD E;  4DZO A;  2C0W A;  1V87 A;  4QF3 A;  1IFM A;  4Y99 C;  1S9K E;  4YAD A;  1VDF A;  4XE5 B;  1HH0 A;  4RES B;  1LGH B;  3L4F A;  2HPC B;  1GD2 E;  2KE1 A;  4FO9 A;  1X4I A;  4HYT B;  1DVP A;  5TDR A;  2Q3I A;  3U1A A;  3O37 A;  4WA6 A;  4ZQL A;  2G45 A;  4GND A;  2NPS D;  3M9H A;  1LTB C;  1FJK A;  1SVF A;  2J59 M;  4L7X A;  5LKX A;  1NH4 A;  4N78 E;  2H0D A;  2FUI A;  5CCH D;  2N1T A;  2GUS A;  3L36 A;  3C9I A;  2WT7 B;  2YRE A;  3RPG B;  2HOD B;  3G3Z A;  5AW9 B;  3KV6 A;  1LTG C;  3P8C D;  2Z5H A;  1JTH A;  2Q7C A;  3BRT B;  1N7L A;  1KQL A;  4C46 A;  2YO2 A;  3P7K A;  3P8C E;  2IPP A;  2C2L A;  5CCH A;  2ZET C;  1IO4 A;  5AVV B;  4N78 D;  4LK9 A;  2P7J A;  2NPS C;  3HRN A;  1VFY A;  3O33 A;  2WWW A;  2LN0 A;  1JOC A;  3HE5 B;  2Q9I A;  3C5K A;  4YBS A;  5CJ0 A;  3GL6 A;  2E6R A;  3O7A A;  5AVZ B;  1Z56 A;  3NMD A;  1S9K D;  1GTW A;  3HCT A;  2IFN A;  3M0D C;  1T8Z A;  3KV5 A;  2P67 A;  2ZFC A;  2H7H A;  2HFE D;  1GDT A;  1JY2 P;  1GL2 A;  3M9B A;  2ZXE B;  2H8P D;  4BHW A;  1F62 A;  1DEB A;  2YMY A;  2FSA A;  4NN2 A;  3KQG A;  3LQI A;  3T7L A;  4AUW A;  1XWH A;  3B5N A;  3ZNI A;  1SQP K;  2R32 A;  4JYC A;  2XV5 A;  3N9L A;  1IK9 A;  5AVR B;  1G25 A;  1RF1 A;  5KJ7 C;  1JY3 O;  1RY3 A;  1PFI A;  3ZTG A;  4N3W A;  5B8D A;  3N9P A;  5H1U A;  4IFM A;  1N7S C;  2N1T B;  1KIL B;  1KZU B;  1L4A B;  2NPS A;  2KGG A;  1FDM A;  2G6Q A;  2YQM A;  3LQJ A;  1URQ A;  1SP4 A;  2WPS A;  4AYC B;  3B8E B;  4A0C D;  2I1K A;  2KYV A;  2LXH C;  2CPS A;  1MUU A;  5G04 B;  1FJP A;  2LKM A;  3LW5 H;  4QF2 A;  1W2E A;  1RE3 C;  2ECW A;  3P32 A;  4R2Y A;  1LTA C;  2GM4 A;  1FZA A;  5AVS B;  5AVX B;  4WZ0 A;  2YKO A;  3KDP B;  4C7N A;  3IFM A;  3ASL A;  3V2R A;  3MHH A;  1X4U A;  2MIQ A;  1H8A A;  1FOS E;  2P1J A;  2POH A;  1WEW A;  2DX8 A;  2KLV A;  2FUU A;  1HGV A;  4HH2 A;  4YBT A;  3LRQ A;  2VJF B;  2QM7 A;  1NTZ K;  2WTY A;  2LGG A;  3TNU B;  4A4B A;  5LKT A;  2VP7 A;  5AVW B;  1ZR2 A;  1FZC C;  5C13 A;  1LWU C;  2FFD C;  2QIC A;  3LIE A;  2KU3 A;  2KFT A;  1FP0 A;  1LDJ B;  2JMD A;  2LGV A;  1NU1 K;  4CA1 A;  2L43 A;  1FZE A;  2LXP C;  2VPG A;  5LKU A;  2MJZ A;  2I50 A;  5AW8 B;  1RE3 A;  1IFJ A;  3MUD A;  1GZL A;  1XTG B;  3HD7 B;  4N6J A;  1N7S D;  1N73 A;  2VNF A;  3CLQ A;  1L0L K;  1T3J A;  3U59 A;  1WIL A;  5G0F A;  2Q5U A;  3HUS B;  1M1J B;  2R3C A;  3VMZ A;  3HUS C;  1WEU A;  2LGL A;  1WE9 A;  2MT5 A;  4WY4 A;  1N7S B;  4B86 C;  1URQ B;  3M9Q A;  4IFD K;  1CSB A;  4AQR D;  1RF0 A;  1LTJ A;  5CHX A;  3T6R A;  2R5B A;  2OYH B;  3PHD A;  3VK6 A;  2NAA A;  2RSD A;  2W27 A;  5AW7 B;  3TYY A;  5LKZ A;  1J1D B;  1MFZ A;  3A7O A;  4JYB A;  1WEN A;  5EYA F;  2MD7 B;  3O36 A;  4GB0 A;  1WT6 A;  1SQB K;  5AVQ B;  2KWJ A;  3ZPV E;  3N4X A;  3DQV R;  3MD0 A;  3ZVZ B;  3HTK A;  1SQX K;  4F52 B;  2K17 A;  3KPE A;  4FJC A;  2EOD A;  3M0D A;  4I7B A;  2H43 A;  3HE4 A;  4ZKP A;  1URQ D;  1RF1 B;  1FAV A;  1GK6 A;  4WZ2 A;  3SOX A;  1FZC B;  2KB7 P;  4I2L C;  1H89 A;  2KIZ A;  2R5D A;  3TSI A;  1FZB A;  4L58 A;  5AW5 B;  2MD8 C;  3SOW A;  2LQ6 A;  1FBV A;  1WEO A;  1G2C A;  1JM7 B;  4ZKU A;  2QM8 A;  2QJ0 A;  1IFD A;  2L75 A;  4V3L C;  1CI6 B;  1GU4 A;  3V4W A;  3MHS A;  1M7L A;  3V5B A;  3OJA B;  1T2K D;  1MM3 A;  4YAT A;  1QL2 A;  1M1J C;  1IYM A;  2H0D B;  3L37 A;  2FFD A;  5AW1 B;  1GK4 A;  4W80 A;  1E5W A;  1OWA A;  3V43 A;  3OAK A;  1KFM A;  1WFK A;  3CL3 D;  1WGM A;  3PUQ A;  2YSJ A;  1RE4 C;  5KH9 A;  4O64 A;  3PP5 A;  1HWT C;  3LQH A;  3RK2 D;  5AW2 B;  2Y1M A;  4ZDT A;  3A5T A;  5TBN A;  5J3X A;  1X9V A;  4ZUX U;  2L80 A;  1ZLL A;  3H32 B;  1CZQ A;  5CCG C;  5TAB A;  1JY2 N;  5CMZ A;  5FB1 A;  1FOS F;  1LTI C;  2XEU A;  2UZG A;  5AVY B;  3VMY A;  3V4Q A;  5AIT A;  1HVV A;  1NTM K;  5APW A;  1T3U A;  2EGP A;  4WY4 D;  5TRB A;  2WZ7 A;  3BRV B;  2M6M A;  2ECN A;  4DOJ A;  3N9O A;  3NXS A;  3HD7 D;  4I7D A;  3U5O A;  1GU5 A;  4WB4 A;  2JMI A;  1H88 A;  3RL0 D;  2LGK A;  3II6 A;  2RI7 A;  2CT2 A;  4UP5 A;  1LWU B;  2O1J A;  1JCC A;  3NFQ A;  2YHO A;  2ECG A;  4BBQ A;  2WSE H;  4X3G A;  1N73 C;  3KYQ A;  1N2D C;  3TK1 A;  1JM7 A;  3HD7 A;  4W4U A;  4XI1 A;  1DX7 A;  4OH8 B;  2VJE A;  3HTK C;  5B76 A;  1JY3 N;  1MZ9 A;  4GIF A;  4N4F A;  1MV8 A;  1LT9 A;  1JY3 P;  5AVT B;  3PUR A;  1DH3 A;  1GL2 C;  3O8Z A;  2W6A A;  2XU6 A;  3SHB A;  4I6M C;  3N9M A;  4M3L A;  1WES A;  3I5C A;  1JO5 A;  3I2D A;  2OYH A;  4LAD B;  1KIL C;  1L4A C;  2PP6 A;  3N9Q A;  1SQV K;  3RTR B;  2CSY A;  2XKM A;  2ECI A;  2VJF A;  1HJB A;  5C11 A;  3C6W A;  2JJL A;  2YNY A;  3V2P A;  2LV9 A;  3IR9 A;  1WEV A;  4PPE A;  1WIM A;  1N73 B;  2M1R A;  3VYI A;  4C7N B;  4AUQ B;  1L0N K;  3RK3 B;  1SFC A;  3ZYQ A;  1FU1 A;  1NOH A;  2PAJ A;  4I7C A;  1G2C B;  2WSF H;  3NTN A;  3M62 A;  5H1V A;  3O34 A;  3GHG B;  2O01 H;  2W6B A;  1U6G B;  4AVX A;  1Z6U A;  1RE4 A;  5I3L A;  1LTJ B;  2YKQ A;  3OA7 A;  1ZV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...