1JOCA

Eea1 homodimer of c-terminal fyve domain bound to inositol 1,3-diphosphate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
QDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multivalent endosome targeting by homodimeric EEA1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Early Endosomal Autoantigen 1
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jocA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jocA02
4AP4A 2HYED 2KGGA 3QZVA 2MA6A 4WA6A 3ZVZB 1WILA 3T6RA 3T7LA 2L43A 4FIPA 3GL6A 2JMDA 3BRTB 2MIQA 2LV9A 3N9LA 2YYRA 2PNXA 4S3OC 2KWKA 1JM7A 2Y1MA 1G25A 3RPGC 1U6GB 2YQMA 5J3XA 4V3KC 1WEOA 3VK6A 3ZYQA 2C2LA 2ECWA 4A4CA 3N9OA 3N9PA 2MUMA 3NG2A 4GNFA 2ECJA 3ASLA 4WZ3B 2ECTA 3L11A 4A49A 3ZVYA 5G0FA 2LN0A 2L5UA 3U5NA 1E4UA 5I3LA 4B7YC 2VPGA 4GNEA 4ZQLA 1N87A 4CA1A 5H9MA 3SOXA 3DQVR 1ZBDB 2Y43A 2LGKA 2MD8C 4AVXA 4LJNA 5FEYA 4CCGX 2CSZA 5D1LB 4LK9A 1WEPA 3O7AA 1IYMA 2QIZA 2W6BA 2ECIA 2F6NA 2KGIA 3IHPA 3PHDA 3O36A 1HYIA 3I2DA 2YT5A 1Z60A 2DX8A 4UP0A 1Z2QA 5LKTA 5DKAA 4P5OB 5D1MB 1RMDA 4YAXA 3L1XA 2YREA 3HCTA 3M62A 4L7XA 5TDWA 2K16A 5FB0A 2AN6A 2OXQC 2KWOA 5FERA 3HTKC 4C9ZA 2ZETC 1WEWA 4FO9A 5LKZA 2XEUA 5TABA 2CKLA 2K17A 4V3LC 1JOCA 2D8SA 2MD7B 5H1VA 5B75A 1WENA 2RI7A 3PUQA 4QF3A 2LRIC 4ZUXU 2MNYA 4A4BA 2YW8A 3KV5A 5H1TA 5TBNA 1T1HA 2H0DB 2M85A 3SOUA 1V87A 5LKXA 4AYCA 3O34A 4I7CA 5TDRA 4YBTA 4Q6FA 2EODA 2VJFA 4IC2A 3U5OA 5B79A 2L0BA 1WEUA 3GV4A 4PPEA 2G43A 1WEQA 2M6MA 2VPBA 2VPDA 2VJEB 4YABA 3O37A 1VD4A 2UZGA 2E6RA 2HDPA 2VJEA 2QJ0A 3RPGB 1VYXA 4B86C 1MM2A 5C13A 5G04B 4N4FA 2G6QA 2VP7A 3HCUA 2YKOA 2LXPC 3O35A 5LCWB 4WZ0A 3ZNIA 3EQ2A 2CSYA 1X4UA 2KWNA 3L4FA 2G45A 5KH9A 3N9QA 4YBMA 2PUYA 2ECGA 1WIMA 5H1UA 2YQLA 2YHOA 3N9MA 3O33A 1FP0A 4FK5A 4BHWA 3ZPVE 4XI1A 2FUUA 2K4DA 3LQIA 3BRVB 5KH7A 4LKAA 3L1ZB 1WEEA 4MSXA 2E6SA 5EYAF 2FUIA 2ECNA 3M63A 3C5KA 3RTRB 1K2FA 3M99A 4I7DA 1FBVA 5FB1A 4S3OB 4NN2A 2CT2A 3U5MA 2YKPA 1LDKC 1X4JA 2LXHC 3LQJA 4GNDA 1XWHA 4QF2A 3SHBA 2F42A 2YKQA 3EB6A 2KFTA 4R2YA 2M3HA 4LADB 3N9NA 2JMJA 2C2VS 4X3GA 3CL3D 2XB1A 3HCSA 4YBSA 1WFKA 2EGPA 4FJCA 2YHNA 5TRBA 3SOWA 1WE9A 3KV6A 4LLBA 2KE1A 3PURA 4N3WA 5AITA 2QICA 4A0CD 4IC3A 4WZ2A 1BORA 4I7BA 4MVTA 1WGMA 4YC9A 3O70A 2LGLA 4L58A 2JMIA 4TKPB 4BBQA 5JG6A 3FL2A 1WEVA 1MM3A 2Y1NA 1VFYA 3DPLR 2NAAA 2YUCA 1LDJB 5D1KB 2LGGA 1DVPA 2IDAA 4O64A 2RSDA 1WEMA 2I50A 4UP5A 3LQHA 2KR4A 2KWJA 4UI9B 1CHCA 5B78A 5C11A 2H0DA 2MNZA 5G05B 3C6WA 2BAYA 2L75A 2M1RA 1X4IA 1HYJA 3MHHA 4R7EA 4W4UA 2CKLB 1Z6UA 2YU4A 4ZDTA 2F6JA 1WESA 3V43A 4YATA 4GB0A 3MHSA 3LRQA 3KQIA 3U5PA 5B76A 5B77A 4R8PK 2YSJA 5DINA 5AIUA 2KYUA 2MA5A 4YADA 4F52B 3KNVA 4AYCB 2LGVA 5KH3A 2KIZA 2KREA 3ZPV1 2VPEA 2MT5A 2YURA 1F62A 2JRJA 2LQ6A 2FSAA 3ZTGA 2YSMA 4GNGA 5LKUA 5B8DA 1JM7B 4PTBA 2L80A 2EA6A 2VJFB 2LDRA 3EB5A 2VNFA 2K1JA 4AUQB 2ECVA 2KU3A
chains in the Genus database with same CATH superfamily
2WWWA 4PV1C 3S9OA 1FZCB 4UB6H 3B5NB 2YMKA 2KGGA 2C0WA 2O01H 1J1EB 1IC2A 4WA6A 2KLVA 3H1ID 3T7LA 4FIPA 1ZN5A 4W7ZA 1K05A 2Q6QA 4U3FD 1NTZG 4U7JA 1KZUB 3GF7A 1NTZE 2QE7H 2PNXA 1OVVA 1AVYA 2KWKA 1JM7A 3M91A 4OGQC 2WSEJ 4K35A 2Y1MA 3P7KA 1QL1A 1G25A 2KP8A 3RPGC 3AE8C 5J3XA 1WEOA 1L4AB 5AVSB 3K5BA 4H44D 3A0HH 5TISH 2C2LA 1FZGA 2ECWA 1LTJC 2W27A 4Z1MH 2MUMA 3L70J 2D8UA 1NU1E 2FFDB 4W80A 4WZ3B 2ECTA 1AQTA 4EYYQ 1E5WA 5CCGD 3L11A 4EIJA 5G0FA 2WT7B 1KORA 2LN0A 1HBWA 4UB6E 1N7SA 4B7YC 2EGMA 1UIXA 4CA1A 3BCCD 2E42A 1OW6A 1EZVE 2JWAA 3L75D 1ZR4A 1VQ5P 4AVXA 2AXTH 4LJNA 2IBZD 1AVOA 1WEPA 1PP9E 1IYMA 3O47A 5B66E 1FZEA 2W83C 1JM0A 2W6BA 2ECIA 3WUVA 3O36A 3VYIA 3IF4A 2KK7A 1Z60A 3HE4B 4GKGA 1KB9D 3H1HJ 4O62A 1Z2QA 3KPEA 1NTKG 1NU1D 5DKAA 1LTTC 1SVFA 1KB9H 3CXHI 5CMZA 1S4XA 2V7QJ 2K16A 2FYUG 5CJ4A 2AN6A 2KWOA 1S5LX 3WUTA 3V6IA 3MIWA 3HTKC 4I6MC 1BE3D 1LJ2A 2M13A 3A0BH 1OX3A 3Q1MA 5H1VA 5B75A 3NTNA 1FE6A 4JQ0D 2E74B 3HTKA 3AE9C 1MUUA 2N1TC 5TBNA 1NTMD 3H1HG 1VPCA 3E2DA 3GG2A 2G8YA 1PGJA 3HUSA 5LKXA 4AYCA 3O34A 5TDRA 1Y9BA 1MKMA 3A7OA 2IQJA 4IC2A 3U5OA 2XDJA 1J2JB 2L0BA 5AW4B 1FZFA 1JTHB 3H1KJ 4IL6E 1DEEG 3Q5PA 1TU3F 1XTGB 1KC8Q 1QEXA 2FFWA 2YXRB 3CCQP 2D2CB 4IL6X 1RHZB 1NTZD 3KZIH 5KLVE 1KFNA 2XP0A 2HYNA 2JR8A 1VYXA 1LT9B 3L73G 2RKLA 1A02J 3L72J 1NTMK 1BCCG 1SQQJ 3N4XA 2Z4EA 2WSSH 2VP7A 3PHLA 1N7SC 2LXPC 3QH9A 1SQXJ 4QMAA 2K3RA 5SVXA 2CSYA 4H44B 3SWYA 5KH9A 5CHXA 3HD7C 4R4LA 2FYUD 3HE5B 3JSVC 2WSCH 5H1UA 2A45I 1NAFA 2Q1KA 3N9MA 1VQLP 5KKZB 2V4HA 1GW3A 3R2PA 1NTKD 2FUUA 3EFGA 2FYNC 2ZXEB 1J1DB 3B5ND 4GOEA 2OWAA 1YHQP 1KYOH 3TDKA 2Q3EA 1PV3A 1VF5C 2FUIA 2YNYA 4XA4A 2HFED 2R3CA 2OTLP 1HJ0A 4PJ0E 3RTRB 4D6TG 2A45G 3KHUA 4I7DA 1FBVA 2P10A 3U1CA 4EI2A 1PIXA 1LNQA 1X4JA 2B0OE 1PPJD 3LQJA 1XWHA 2YO3A 2YKQA 4PV1D 2C2VS 3CL3D 3HCSA 3JUEA 2M8RA 2EGPA 4EDFA 2H43A 2M0BA 1LT9A 3M9HA 2KIKA 3FGAD 5AW2B 2IBZE 4LLBA 2NPSA 2IBZI 5AITA 5AVUB 1PPJG 5DJUB 1L0NK 1DEBA 1LT1A 1Y8AA 3GMAA 2SPZA 2WT7A 3BATA 3WU2H 2AXTE 2PFXA 1NWQA 4Z0OA 2YMYA 2FFDA 3G3ZA 1SQPD 1YTZI 3W68A 3M06A 4W7YA 1CW5A 4L73A 3CC7P 2BCCD 4C46A 1RE4C 4DOJA 1FDOA 3TGUJ 2LGGA 1EDLA 1DVPA 4O64A 2QIWA 2RSDA 1WMKA 3USSA 4L75A 2JEEA 3CXHE 1CHCA 3RK3C 1ZRTD 3RL0g 2BAYA 2L75A 2R5DA 2M1RA 2J58A 5KLVK 3BCCG 1HYJA 1QGKB 2F6JA 4DJGA 1LWUA 2LAUA 2WMMA 4B86A 3KDPB 4GB0A 3MHSA 1NTME 4Y99C 5AVYB 3V5BA 2JM3A 3KQIA 1OVUA 5B76A 2IX7C 2YSJA 5DINA 1KILC 3CX5E 3VOPA 5AIUA 2KS1A 2C0XA 3KNVA 4PD4D 3B5NC 1YYCA 3TNUA 2LGVA 1KILA 4PV1B 1VF5D 3OJAB 2MT5A 3L75E 2IYPA 2YURA 1J1DC 2QVAA 1X8YA 1FU1A 1VQ6P 2FYNB 1DIPA 2FSAA 3L74J 3LIEA 3JC22 2NRGA 3KYQA 2QSIA 2NPSC 2OGUA 5E79E 2FYZA 2LDRA 5C39A 4OH8B 3EB5A 2VNFA 1OWAA 2JDIH 1AV1A 1SFCD 2L43A 1S9KE 1SQQD 3H6PA 3GL6A 2JMDA 4I1LA 1H0TA 3B5NA 2MIQA 2LV9A 3N9LA 1BGYG 1ZLLA 4S3OC 3N7NA 5AW8B 1M7LA 3LVQE 3G9RA 3T9KA 1IZNB 3L70D 4V3KC 1R8EA 1H8AA 3CCMP 3CCVP 3VK6A 2QJYB 5GTHE 2KNCA 3H1JG 1BGYE 3N9PA 2BEQD 1W2EA 1IFIA 3NG2A 4GNFA 4UB8H 3ASLA 1LWUC 5KLIB 3V2NA 1NKZB 4A49A 2KS1B 2ZYAA 3FEHA 3H1KG 5CCGC 2K1AA 5APTA 3R4YA 2I1JA 3AE2C 4ZQLA 1AFOA 3D6ZA 2KI7B 3NFQA 1KYOI 2D2CD 5AVTB 5KAFE 1VQPP 3RL0C 2OARA 4ZNCA 2CRWA 2E5YA 1EDJA 2MD8C 5FEYA 4CCGX 5D1LB 2WSEH 4LK9A 3L73J 1URQD 3II6A 3L75G 2LR2A 1JY2N 1M8OB 2E76C 2Z5IA 4H13C 2KGIA 3BCCE 3VMAA 5SVIB 4EOTA 1HYIA 5GTIE 2M5AA 3L74E 1RF1C 5APUA 1M1KQ 1HUCA 5AVZB 2IFNA 4RJTA 2BCCJ 2OTKE 4P5OB 2P7JA 1RMDA 4YAXA 5KJ7C 2FXOA 3HD7A 2O01J 1RF0C 4L7XA 3GHGB 3M0AA 4IFDK 4U3FJ 3CX5I 1PGPA 1LTSC 3P8MC 1IK9A 1U7MA 3CX5D 1Z56A 5SVYA 3H1LD 2BASA 1SQXK 2DW3A 3G6EP 1BSNA 2K88A 4FO9A 5CCGA 2K17A 4V3LC 1JOCA 2D8SA 3Q5RA 1NTMJ 2RI7A 2XOCA 4QF3A 2QM7A 4N78D 1FC2C 3Q1DA 3CXHD 2YW8A 4IFFA 1L0LJ 1MBMA 1YJNP 2HG5D 2QEXP 3KV5A 5H1TA 1NKNA 3SOUA 1M57D 3H1JD 2W90A 4H0LD 3TGUE 2XV5A 5B79A 2WPRA 1T2KD 1WEUA 1KYOD 2WSCJ 3CI9A 3GW6A 1PPJE 3HUSB 1RF1A 1FZBA 5AVQB 2H88C 2E61A 2FFDC 2G3AA 2VJEB 1URQC 1NTKK 4D6TE 2N1TD 4L76A 1SFCA 2UZGA 1SQQG 3ITKA 2HDPA 1S72P 1L4AC 3VMYA 3RPGB 3KQGA 1ZV8A 4A7PA 4OGQB 2KZJA 2UWJE 4OGEA 3I5CA 2G6QA 3CCSP 3FXEA 1NVOA 2QA4P 3O35A 5KKZC 4WZ0A 2W6AA 1YJWP 3V2RA 1EDIA 2QJYC 1L4AD 3AEFC 3L4FA 2G45A 1KD1Q 3M7KA 3F89A 1FDMA 5APQA 2FXPA 1JY2O 2H89C 4YBMA 2PUYA 2QG4A 3W67A 2I8DA 2FYUE 2FYUJ 3FWLA 2IZ0A 3ZPVE 3G71P 4XI1A 1FOSE 2JUNA 2DSMA 5AW6B 1OW8A 1RE4A 1CI6A 1EDKA 2XU6A 3RK2B 5KH7A 4LKAA 1JY2P 1FZAA 5KTBA 3VN0A 2JO1A 1VQOP 2E6SA 5EYAF 1BSHA 1NAYA 2ZT9B 1VQMP 5APXA 3C5KA 4HKZH 3MTUE 3M99A 4F1PA 2NPSB 4S3OB 3RK2C 3U5MA 2Q7CA 1EZVG 3OA7A 2L5GB 4D6TJ 2KB7P 2PAJA 4H13D 1SQXE 3MDBC 1U7JA 2QJKC 2XB1A 1RQVA 3AEAC 2KOGA 1SQQE 4FJCA 3L72E 1Y47A 1YQ3C 2WZ7A 4Y99B 5KLVJ 4I7BA 2CPBA 5KLVD 4RO0A 3C9IA 2LGLA 2Q9IA 1FDIA 3L36A 1L0LE 1L0LG 1WEVA 3RK3E 1IO4A 1MM3A 3B4SA 3DPLR 3RK3B 1GU4A 1LDJB 1R5SA 1BE3G 2Y9ZA 1OZHA 3H32B 2JWDA 1NH4A 4NPFX 3VP9A 1G2CA 2I50A 1FAVA 4WY4D 2KWJA 3LQHA 4UP5A 5C11A 4U3FE 2XOZA 3NXSA 1X4IA 1EC5A 1RF0A 4W4UA 4R7EA 2BCCE 2ZJSE 2CPSA 2XKMA 5TISE 4YATA 3CX5H 4BXLA 3LDYA 3LRQA 3PLWA 1Q81Q 1GL2C 2CSVA 3BCCJ 5SVIA 5B77A 4R8PK 2CONA 2LKMA 3KZIE 1E79H 2Y0EA 4GIFA 2KYUA 3L73E 2MA5A 5AW3B 4F52B 1IFNA 2P57A 1M1JC 3L37A 4AYCB 2QRXA 1GL2A 3FWNA 3GHGA 5KH3A 2KIZA 1WRGA 3ZPV1 2LXBA 5AVXB 2O01N 3OAKA 2LQ6A 3ZTGA 2W8ZA 5CCHD 1R5LA 1T3UA 4GNGA 4AUWA 5LKUA 1AQ5A 2VJFB 1LTJB 4PD4E 3M9BA 3PRJA 2R3SA 2OYOA 1PP9J 1BCCD 1WT6A 1RY3A 1P84I 1BGYJ 3AE5C 4GODA 1QL2A 4H13B 2R5BA 3LJUX 1SS1A 1QLED 2KSJA 2FD4A 3L71G 4UB8E 2YYRA 2C9NY 4DT0A 3RL0B 4C7NB 3SSUA 1K9MQ 2YQMA 1H0TB 1PZQA 3TGUG 1FZCC 2O1KA 4RESB 3L70E 1VQKP 4YTPC 2QM8A 3QWOC 3ZYQA 4A4CA 2YIUC 1L0NG 2J59M 2ZVNB 1VQ9P 4HJGH 3GF3A 3RK2D 2ECJA 1N7SB 1EQ7A 3JCUH 2WVRA 1QVGO 1S2EA 2IPPA 5AW5B 1SQBG 1JY3P 3C8VA 1N73C 2L5UA 3U5NA 1HTLC 2ZFCA 4R4MA 5AW0B 1L0LK 3CC4P 2VPGA 4GNEA 2N9BA 3HD7B 1NTZJ 1N87A 1DD4A 3O8ZA 5H9MA 2HPCA 2E75C 2AEJA 5KLVG 3L75J 1ZBDB 1ZMEC 2IYOA 3CWBD 3IR9A 2LGKA 4D6TD 5AVRB 3H25A 1PL5A 1SQVK 1YJ9P 2VRSA 5APSA 2K37A 2QIZA 4JYBA 4YXWH 5GTIH 2BCCG 3A2AA 1LT9C 3PHDA 3IHPA 5KJ7A 1OFCX 2I1KA 3I2DA 2L7PA 3V4QA 2AXCA 2DX8A 4UP0A 3Q5SA 3CCRP 4YXDC 2GM4A 5LKTA 3PP5A 4Z0RA 5D1MB 1YTZT 3L1XA 2YREA 3HCTA 2H8PD 2N1TB 2M5AB 2E74C 5FB0A 1P84E 3RGUA 2XOYA 3B8EB 2PP6A 3B71A 5FERA 1JEKA 1HWTC 3BASA 2HLOA 4C9ZA 2ZETC 1WEWA 1FOSF 2CKLA 3E1IA 4ZKPA 1WENA 5BVZA 2LRIC 4PJ0H 2WPQA 1SQVG 2MNYA 2Q5UA 4A4BA 1KILB 1SQBD 1EZVI 4LC1A 1VDFA 4L74A 1MV8A 3O6QA 2AEMA 3CC2P 2M85A 3H1JJ 5BU8B 2R44A 4YBTA 4Q6FA 1YIJP 1Q2NA 1URQA 2PGDA 3WUUA 3UIAA 3E7KA 1USDA 1W5CE 2WITA 4KHXA 3GV4A 4PPEA 1OMIA 1WEQA 1LP1B 2M6MA 4JF7A 1IJDB 1GK4A 3CMEP 3KDEC 2YVRA 4YABA 3H1LE 2Y0DA 2OYIA 1OVRA 2OTJP 5B66H 3O37A 1VD4A 2E76D 3MD0A 2GUSA 3HD7D 3U59A 5DJTB 3H32A 3H1HD 2QJ0A 2MKEA 1LTGC 3SUBA 3F5HA 4I7ZB 2WPVB 1CZQA 1N7SD 4N4FA 3VMXA 2MKVA 4N6JA 1NU1K 1GL2B 2JKVA 4KT0J 5LCWB 5CBNA 3ZNIA 1X9VA 3EQ2A 5K5GB 1ZXGA 2KWNA 4WBAA 1RF1B 3DDTA 2V7QH 1N8RQ 3L74G 2ECGA 1CI6B 4QQ4A 1S1CX 1RQUA 3O33A 3RL0D 4FK5A 1D7MA 3A0HE 4GOFA 1NU1G 2B87B 3D6YA 1KB9E 4IOIH 1KTMA 4N3YB 3L71E 2K4DA 1FJKA 2P2UA 1DCQA 3BRVB 3L1ZB 2KYVA 1WEEA 3G4SP 1GTWA 4MSXA 2ZXXA 4ASWA 1DD3A 1IFJA 3FANA 2P1JA 1HVVA 1NJIQ 4JPZB 1NOHA 1H88A 1HH0A 1Q90D 3M63A 1YITP 1VQ4P 1K2FA 5B5EH 1LTAC 5FB1A 5M1BA 2C9LY 3CWBG 2CT2A 2YKPA 1LWUB 3IN6A 1LDKC 3I55P 4TT3H 4WVZA 5E79H 1BCCE 1EXIA 3SHBA 1N2DC 2F42A 1J1EC 4R2YA 2M3HA 1YQ4C 1VQ8P 4LADB 3P32A 3N9NA 5H2FE 2KLUA 4YBSA 3H1KE 2B9BA 2O3JA 1IK7A 1SQBK 4K3AA 1WE9A 1KQLA 1L0ND 2HODB 3JCUE 2QICA 2B88A 1VQNP 1M1JA 1BORA 1M56D 1JY3O 1SQXD 1VL2A 3O70A 3PLNA 4L58A 2ZT9C 2E75B 3MZWB 2JMIA 4HYTB 3L72D 4BBQA 5JG6A 4PD4I 1IFMA 4WY4B 3EWKA 5AW9B 1GDTA 3TF5A 4BRYB 1IFDA 1A02F 5D1KB 3H1LG 3HRNA 3CCEP 1KQSO 4I2LC 1WEMA 2KR4A 5B78A 2MNZA 2IDBA 1JUNA 3L70G 4DCKA 2E75D 3MHHA 1KFMA 1IFPA 1UIIA 2CKLB 1OXZA 1KN7A 3H1HE 1Z6UA 1KB9I 3LW5H 3V2PA 4OGCA 2FXMA 1S5LH 2BEZF 1OW7A 3VTPC 3U5PA 5APVA 1X22A 3A5TA 1K8AQ 1AJYA 3AE3C 4YADA 1JY3N 3FJUB 4ASVA 1HGZA 3RK3D 3CCLP 1KMIZ 2MJZA 3L73D 3M0DC 1GZLA 3GLMA 1P84D 3HTKB 2KREA 1SFCC 4HB1A 1SQPE 4Y28J 1F62A 3ABVC 3T97A 2M3BA 3D71A 2WSFJ 3P8CD 5KAFH 5AVWB 2J5UA 3RBXA 4AUQB 1EXJA 2ECVA 1NU1J 2P67A 4AP4A 2HYED 3O6QB 3QZVA 2N9YB 1NYHA 4OWFA 2MA6A 3ZVZB 1WILA 3T6RA 3A0BE 1W2BO 1PP9G 2OQQA 2RN0A 3BRTB 1MFZA 3LIDA 2DJAA 4M3LA 5BU5A 1PGOA 1N86A 3MUDC 4I7ZC 1SQVD 2NPSD 1L0LD 5AW1B 2ZYGA 1BE3J 1U6GB 2ZT9D 1OIPA 1JB0J 3Q2YA 1GW4A 1X79B 3FX0A 2QJPC 1GK6A 2B89A 3M0DA 1VQ7P 3RBZA 1L2PA 1SQBE 3N9OA 1SQBJ 2GUVA 1GL2D 4C7NA 3GHGC 2CRRA 4HH2A 1USEA 4BWNA 1L0NE 1KILE 2ZVOB 2HPCB 3IFMA 1BE3E 3ZVYA 3ZDMA 2A06D 3C1LA 1SQPG 4RKUJ 1E4UA 5I3LA 1G1IA 3L35A 1BDDA 2HR3A 2RH0A 4U3FG 3T97B 3SOXA 1N7LA 2E76B 1EZVD 2FYUK 1JCCA 3DQVR 4DZOA 3AEGC 1BDCA 1S3JA 2Y43A 2O1JA 4JBZA 1XTCC 2KUBA 1S9KD 1L4AA 3CWBE 5KAIH 1LTJA 2CSZA 3O7AA 3OW2O 3TSIA 1RE3A 3MGNA 2L91A 4OGQD 3CCJP 2F6NA 1T3JA 3BVHA 2QJKB 3AEEC 1ZR2A 5K3QA 4WB4A 1KYOE 1AA0A 2YT5A 1DX7A 3VP8A 4LLHA 5GTHH 3TK1A 4H44C 1ZW0A 1RE3C 1K04A 5KLIC 2OYIC 1SQPJ 5KAIE 3H7HA 1KILD 1FZCA 2OYHB 3M62A 1SP4A 5TDWA 1NGMB 1NTKJ 3AE4C 2OXQC 2XNDH 1SQVJ 2POHA 1H89A 1HF9A 2KXPB 4H0LB 1KQFB 5LKZA 2XEUA 5TABA 2HODA 2K9JA 5B5EE 1G1JA 3MP7B 1SQQK 2MD7B 3PUQA 1SQPK 4ZUXU 3AE6C 3VMZA 2D2CC 4CPGA 2YXQB 3U1AA 3CMAP 2A06G 4XFJA 1ZOYC 2R32A 2OYIB 1Q82Q 1T1HA 2H0DB 2E74D 3H1IG 1P84H 1V87A 1QVFO 4PD4H 2ITAA 2E43A 4ZMDA 4I7CA 1NHLA 2KSEA 4H0LC 4C7RA 2IZ1A 2EODA 3AE7C 2VJFA 1HGVA 1N73B 4WWIA 4XE5B 4YPCA 3S1KA 2Z5HA 5EFWB 1PGQA 2G43A 3NMDA 3IAOA 5TJHA 2OYHC 3V4WA 2FKWB 1YI2P 2VPBA 3KXDA 2VPDA 2GA1A 5CCHC 1SLQA 2YO2A 4LGDE 2RR4A 2YIUB 1LGHB 1GD2E 3Q3DA 3DWDA 4GDOA 5APYA 2E6RA 2ZAEB 1PP9D 1MFTA 2VJEA 1ZP0C 3AE1C 2FBWC 4TLFA 2FY8A 4B86C 2B87A 1MM2A 1U57A 2K9JB 1S5LE 3E1RA 5C13A 5G04B 3I56P 3H1IJ 4WY4A 2P58A 2IFMA 5APWA 4NPEA 1M90Q 4ZKUA 1URQB 4BRYA 3HCUA 3AEBC 2YKOA 1RH5B 3CLQA 2KZIA 3HUSC 2H7HA 1X4UA 3L72G 1BCCJ 4GT1A 3SFEC 3FM8C 1ZRTE 3N9QA 1G2CB 1CSBA 3LVRE 5CCHA 1SQXG 1WIMA 2YQLA 4H9DA 2YHOA 2KKXA 1FP0A 1QX8A 1FBMA 4BHWA 1T2KC 2K9YA 1DH3A 1MZ9A 5CJ0A 1JCDA 3LQIA 3WMM0 2EXUA 1FS0E 3WU2E 2QJPB 3P8CE 2ZYDA 3SWFA 1JTHA 3FXDA 3L71J 2WQYC 3H1IE 3D70A 2Y9YA 1M1JB 1N73A 3HE5A 2ECNA 2NZ2A 2E5TA 3PJSK 1LTBC 4NN2A 1Q86Q 1NTZK 4N78E 2LXHC 2XZRA 1GMJA 4GNDA 4QF2A 1T8ZA 3EB6A 2KFTA 4JYCA 1SFCB 2JMJA 1T6AA 4X3GA 4KJMA 1WFKA 3HE4A 3PH0A 2YHNA 3TYYA 4MN4C 3CPWO 1KV4A 3KV6A 5TRBA 4NPDA 3SWKA 3SOWA 5CBOA 2KE1A 3PURA 4N3WA 4A0CD 1KQGB 2WPSA 4IC3A 1JMMA 4WZ2A 4MVTA 1WGMA 4YC9A 1NTMG 3FAOA 2XNXA 2KKYA 2W6JH 2A45H 3H1LJ 1VF5B 4TKPB 5AW7B 3FL2A 2CK3H 2Y1NA 3EFFK 2LXCB 1X0TA 1VFYA 2NAAA 2YUCA 5AVVB 2IDAA 1SQVE 1JO5A 1GU5A 1NTKE 2A06E 2PRRA 4UI9B 2RMZA 3CXHH 2AEFA 2H0DA 3H1JE 5G05B 4WY4C 3C6WA 1JNMA 1K73Q 1PFIA 3TGUD 1NO4A 3M9QA 2N1TA 3V2QA 5H2FH 3AEDC 3PTZA 4IL6H 2YU4A 4ZDTA 1WESA 2JJLA 3A3YB 3V43A 3CCUP 3H1KD 4AQRD 3MUDA 3MHVA 3L71D 2WTYA 5KJ7D 4IFMA 1LTIC 2IBZG 3SFDC 4O9BA 1JMBA 2WSFH 3CWBJ 4OVNF 2OYHA 2VPEA 3LW5J 2JP3A 2KNCB 2JRJA 1LP1A 3L74D 1FJPA 2Y0CA 5L8RJ 3S4RA 2YSMA 1YBKA 3CD6P 3TNUB 5B8DA 1JM7B 1HJBA 2L80A 4PTBA 1BGYD 2EA6A 2Q3IA 2M3EA 1L0NJ 2K1JA 3AECC 1Q7YQ 2KU3A
chains in the Genus database with same CATH topology
1WT6A 2WWWA 1OWAA 2P67A 1RY3A 1FZCB 4AP4A 3B5NB 2HYED 2KGGA 1QL2A 2C0WA 2O01H 1J1EB 3QZVA 1SFCD 1IC2A 2MA6A 4WA6A 3ZVZB 2R5BA 2KLVA 1WILA 3T6RA 3T7LA 2L43A 1S9KE 4FIPA 5B75A 3H6PA 1ZN5A 3GL6A 2JMDA 4W7ZA 4I1LA 2KSJA 3BRTB 1MFZA 3B5NA 3LIDA 2MIQA 2LV9A 4M3LA 5BU5A 3N9LA 2YYRA 1KZUB 1ZLLA 2PNXA 2C9NY 4S3OC 1N86A 3RL0B 2KWKA 1JM7A 3M91A 3N7NA 5AW8B 2NPSD 5AW1B 1M7LA 3P7KA 2Y1MA 4C7NB 1QL1A 1G25A 2KP8A 3RPGC 1U6GB 2YQMA 5J3XA 4V3KC 1WEOA 1L4AB 1FZCC 1H8AA 2O1KA 5AVSB 4RESB 1GW4A 3VK6A 1X79B 1GK6A 2QM8A 3M0DA 3ZYQA 2C2LA 1FZGA 2ECWA 4A4CA 3N9OA 1LTJC 2W27A 2GUVA 1GL2D 2J59M 1W2EA 2MUMA 3N9PA 4C7NA 1IFIA 3NG2A 3GHGC 4HH2A 3RK2D 2FFDB 4GNFA 2ECJA 1N7SB 4W80A 3ASLA 4WZ3B 1LWUC 1EQ7A 2ECTA 2HPCB 3IFMA 3V2NA 1E5WA 5CCGD 1NKZB 3L11A 4A49A 3ZVYA 4EIJA 5G0FA 2WT7B 2IPPA 5AW5B 1JY3P 5CCGC 2LN0A 1N73C 5APTA 1HBWA 2L5UA 1HTLC 3U5NA 2ZFCA 5AW0B 1N7SA 1L0LK 1E4UA 2I1JA 5I3LA 4B7YC 2VPGA 4GNEA 1G1IA 2N9BA 3HD7B 4ZQLA 3L35A 1AFOA 1N87A 3O8ZA 4CA1A 5H9MA 2HPCA 3SOXA 1N7LA 3NFQA 2FYUK 1JCCA 3DQVR 4DZOA 1ZBDB 5AVTB 2E42A 2Y43A 2O1JA 3RL0C 2OARA 1XTCC 3IR9A 2LGKA 1ZR4A 1S9KD 1L4AA 2MD8C 5AVRB 4AVXA 1LTJA 4LJNA 1SQVK 2CSZA 5FEYA 5D1LB 2VRSA 2WSEH 4LK9A 1WEPA 4CCGX 3O7AA 5APSA 1URQD 3II6A 3TSIA 1JY2N 1IYMA 2QIZA 1FZEA 1RE3A 3MGNA 4JYBA 2Z5IA 2W6BA 2ECIA 3A2AA 2F6NA 1LT9C 2KGIA 3IHPA 3PHDA 5KJ7A 1T3JA 3BVHA 3O36A 3VYIA 2I1KA 4EOTA 1ZR2A 3I2DA 1HYIA 4WB4A 3V4QA 2YT5A 1DX7A 3VP8A 1RF1C 1Z60A 3HE4B 4LLHA 5APUA 2DX8A 4GKGA 4UP0A 3TK1A 1Z2QA 1HUCA 3KPEA 5AVZB 1RE3C 2IFNA 2GM4A 3PP5A 5LKTA 5DKAA 4P5OB 2OYIC 2P7JA 5D1MB 1RMDA 4YAXA 1YTZT 5KJ7C 1LTTC 3L1XA 1SVFA 3HD7A 1KILD 2H8PD 2N1TB 1FZCA 1RF0C 5CMZA 2OYHB 2YREA 3HCTA 3M62A 3GHGB 1SP4A 3M0AA 4L7XA 5TDWA 4IFDK 2K16A 1LTSC 3P8MC 5FB0A 5CJ4A 1IK9A 2AN6A 2OXQC 3B8EB 2POHA 2PP6A 1Z56A 1H89A 2KWOA 5FERA 1HWTC 3MIWA 2BASA 1SQXK 3HTKC 3BASA 4I6MC 2HLOA 4C9ZA 2ZETC 1WEWA 4FO9A 5LKZA 2XEUA 1FOSF 5TABA 2CKLA 2HODA 3E1IA 5CCGA 2K17A 4V3LC 1JOCA 1G1JA 4ZKPA 2D8SA 1SQQK 2MD7B 5H1VA 1WENA 5BVZA 2RI7A 1SQPK 3PUQA 4QF3A 3NTNA 2LRIC 2QM7A 4N78D 4ZUXU 2WPQA 3VMZA 2MNYA 2Q5UA 3U1AA 1KILB 4A4BA 3HTKA 4IFFA 2YW8A 4LC1A 1MUUA 1VDFA 2N1TC 2HG5D 2R32A 1MV8A 3KV5A 1NKNA 5H1TA 2OYIB 5TBNA 1T1HA 2H0DB 1VPCA 2M85A 3SOUA 5BU8B 1V87A 3HUSA 5LKXA 2E43A 4AYCA 3O34A 4I7CA 1NHLA 5TDRA 4YBTA 4Q6FA 4C7RA 2EODA 3A7OA 2VJFA 1URQA 1HGVA 1N73B 3UIAA 4IC2A 2XV5A 3U5OA 5B79A 2WITA 2WPRA 1J2JB 2XDJA 4KHXA 4XE5B 1T2KD 5AW4B 1WEUA 2L0BA 3GV4A 4PPEA 1FZFA 1JTHB 3CI9A 2Z5HA 2G43A 1WEQA 3HUSB 1RF1A 4JF7A 1FZBA 2M6MA 3NMDA 5AVQB 1XTGB 3V4WA 1IJDB 1GK4A 2FKWB 2FFDC 2OYHC 2VPBA 2VPDA 5CCHC 2VJEB 1URQC 4YABA 1NTKK 2N1TD 1SLQA 2YO2A 2OYIA 4LGDE 3O37A 1LGHB 1VD4A 1GD2E 3MD0A 2GUSA 4UP5A 5APYA 1SFCA 3HD7D 3U59A 2E6RA 2UZGA 2HDPA 1L4AC 2VJEA 1KFNA 2HYNA 3H32A 3VMYA 2QJ0A 3RPGB 1VYXA 4B86C 1LT9B 1LTGC 1MM2A 3KQGA 1ZV8A 1A02J 5C13A 5G04B 4WY4A 1CZQA 2IFMA 5APWA 1N7SD 3I5CA 1NTMK 4N4FA 3N4XA 3VMXA 4ZKUA 2G6QA 2Z4EA 1URQB 2VP7A 3HCUA 1N7SC 4N6JA 1NU1K 2YKOA 3CLQA 1GL2B 3HUSC 2LXPC 3O35A 5LCWB 4WZ0A 3ZNIA 1X9VA 2H7HA 3EQ2A 2CSYA 2W6AA 3V2RA 1X4UA 2KWNA 4WBAA 1L4AD 3L4FA 3SWYA 1RF1B 2G45A 1FDMA 5KH9A 4GT1A 3HD7C 5CHXA 5APQA 3N9QA 1G2CB 1JY2O 1CSBA 3HE5B 2PUYA 5CCHA 2ECGA 4YBMA 1WIMA 2WSCH 5H1UA 2A45I 1CI6B 2YQLA 1NAFA 2YHOA 3N9MA 3O33A 3RL0D 1FP0A 1FBMA 4FK5A 4BHWA 1T2KC 3ZPVE 4XI1A 1FOSE 1GW3A 1DH3A 3R2PA 5AW6B 2FUUA 1MZ9A 3EFGA 4N3YB 5CJ0A 2K4DA 1RE4A 1FJKA 1CI6A 1JCDA 2XU6A 3RK2B 3LQIA 2P2UA 3WMM0 3BRVB 5KH7A 4LKAA 2ZXEB 1J1DB 3L1ZB 1JY2P 1FZAA 2KYVA 1WEEA 1GTWA 3B5ND 3P8CE 5KTBA 4MSXA 3SWFA 3VN0A 1JTHA 1IFJA 2P1JA 1HVVA 2E6SA 5EYAF 2FUIA 2YNYA 4XA4A 1NOHA 2HFED 1M1JB 1H88A 1HH0A 3HE5A 1N73A 2ECNA 3M63A 2R3CA 5APXA 3C5KA 3RTRB 1K2FA 2A45G 1LTAC 3MTUE 3M99A 4I7DA 2NPSB 1FBVA 5FB1A 4S3OB 3RK2C 1LTBC 3U1CA 2C9LY 4NN2A 2CT2A 3U5MA 2YKPA 1LWUB 2Q7CA 1NTZK 4N78E 1LDKC 1X4JA 2LXHC 2XZRA 3LQJA 4GNDA 1XWHA 3OA7A 4QF2A 2YO3A 1T8ZA 2L5GB 3SHBA 1N2DC 2F42A 2YKQA 1J1EC 2KB7P 3EB6A 2KFTA 4R2YA 4JYCA 2M3HA 1SFCB 4LADB 3P32A 2PAJA 3N9NA 2JMJA 2C2VS 4X3GA 3CL3D 2XB1A 3HCSA 4YBSA 1WFKA 2M8RA 2EGPA 3HE4A 2H43A 1LT9A 2KOGA 3M9HA 1SQBK 4FJCA 5AW2B 2YHNA 3TYYA 5TRBA 1WE9A 3KV6A 2NPSA 4LLBA 1KQLA 3SOWA 2KE1A 2HODB 3PURA 4N3WA 5AITA 5AVUB 2QICA 2WPSA 4IC3A 4A0CD 1JMMA 4WZ2A 1L0NK 1DEBA 1M1JA 2WZ7A 4Y99B 1BORA 4I7BA 4MVTA 1WGMA 1JY3O 2CPBA 4YC9A 2WT7A 3BATA 3O70A 3C9IA 2LGLA 2Q9IA 2XNXA 4L58A 3L36A 2JMIA 2A45H 1NWQA 2YMYA 4HYTB 2FFDA 3G3ZA 4TKPB 4BBQA 5AW7B 5JG6A 3FL2A 1YTZI 1WEVA 1IFMA 1IO4A 1MM3A 2Y1NA 4WY4B 1VFYA 3M06A 3DPLR 4W7YA 1CW5A 5AW9B 1GDTA 2NAAA 2YUCA 3RK3B 4C46A 1GU4A 1LDJB 1RE4C 1IFDA 1A02F 4DOJA 5D1KB 3H32B 5AVVB 3HRNA 2LGGA 1DVPA 2IDAA 1JO5A 4O64A 1GU5A 4I2LC 2RSDA 1WEMA 1NH4A 3VP9A 2I50A 1G2CA 2JEEA 1FAVA 4WY4D 2KR4A 2KWJA 1CHCA 3LQHA 3RK3C 4UI9B 5B78A 5C11A 2H0DA 2MNZA 5G05B 4WY4C 3C6WA 1JNMA 2BAYA 1PFIA 2L75A 1JUNA 3NXSA 2R5DA 2M1RA 1X4IA 1NO4A 1RF0A 2J58A 2N1TA 3M9QA 3V2QA 5KLVK 3MHHA 4R7EA 4W4UA 1HYJA 1KFMA 2CKLB 1OXZA 1Z6UA 2YU4A 4ZDTA 2CPSA 2F6JA 1WESA 2JJLA 3A3YB 2XKMA 3V43A 1LWUA 4YATA 3LW5H 3V2PA 4B86A 3KDPB 4GB0A 2FXMA 4AQRD 3MHSA 3MUDA 4Y99C 5AVYB 3V5BA 2WTYA 3LRQA 3KQIA 1GL2C 3VTPC 3U5PA 5B76A 5B77A 2IX7C 5KJ7D 5APVA 2YSJA 5DINA 4R8PK 1KILC 3A5TA 3VOPA 4IFMA 2LKMA 5AIUA 2KYUA 4GIFA 2C0XA 2MA5A 4YADA 5AW3B 1JY3N 1LTIC 4F52B 1IFNA 1HGZA 3RK3D 1M1JC 3L37A 3KNVA 4AYCB 4O9BA 2MJZA 3M0DC 2WSFH 1GZLA 1GL2A 3B5NC 3GHGA 1YYCA 3TNUA 2LGVA 3HTKB 2OYHA 2KIZA 5KH3A 1KILA 2KREA 1SFCC 1WRGA 3ZPV1 3OJAB 2VPEA 2MT5A 5AVXB 2YURA 1J1DC 1F62A 3OAKA 2JRJA 1FJPA 3T97A 1X8YA 2M3BA 1FU1A 2LQ6A 2FSAA 3ZTGA 5CCHD 2YSMA 3LIEA 1T3UA 3TNUB 4GNGA 4AUWA 5LKUA 5B8DA 1JM7B 1HJBA 1AQ5A 3P8CD 2L80A 4PTBA 3KYQA 2EA6A 2VJFB 1LTJB 2NPSC 3M9BA 2FYZA 5AVWB 2LDRA 2Q3IA 4OH8B 3EB5A 2VNFA 2K1JA 4AUQB 2ECVA 2KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP4 A;  2HYE D;  2KGG A;  3QZV A;  2MA6 A;  4WA6 A;  3ZVZ B;  1WIL A;  3T6R A;  3T7L A;  2L43 A;  4FIP A;  3GL6 A;  2JMD A;  3BRT B;  2MIQ A;  2LV9 A;  3N9L A;  2YYR A;  2PNX A;  4S3O C;  2KWK A;  1JM7 A;  2Y1M A;  1G25 A;  3RPG C;  1U6G B;  2YQM A;  5J3X A;  4V3K C;  1WEO A;  3VK6 A;  3ZYQ A;  2C2L A;  2ECW A;  4A4C A;  3N9O A;  3N9P A;  2MUM A;  3NG2 A;  4GNF A;  2ECJ A;  3ASL A;  4WZ3 B;  2ECT A;  3L11 A;  4A49 A;  3ZVY A;  5G0F A;  2LN0 A;  2L5U A;  3U5N A;  1E4U A;  5I3L A;  4B7Y C;  2VPG A;  4GNE A;  4ZQL A;  1N87 A;  4CA1 A;  5H9M A;  3SOX A;  3DQV R;  1ZBD B;  2Y43 A;  2LGK A;  2MD8 C;  4AVX A;  4LJN A;  5FEY A;  4CCG X;  2CSZ A;  5D1L B;  4LK9 A;  1WEP A;  3O7A A;  1IYM A;  2QIZ A;  2W6B A;  2ECI A;  2F6N A;  2KGI A;  3IHP A;  3PHD A;  3O36 A;  1HYI A;  3I2D A;  2YT5 A;  1Z60 A;  2DX8 A;  4UP0 A;  1Z2Q A;  5LKT A;  5DKA A;  4P5O B;  5D1M B;  1RMD A;  4YAX A;  3L1X A;  2YRE A;  3HCT A;  3M62 A;  4L7X A;  5TDW A;  2K16 A;  5FB0 A;  2AN6 A;  2OXQ C;  2KWO A;  5FER A;  3HTK C;  4C9Z A;  2ZET C;  1WEW A;  4FO9 A;  5LKZ A;  2XEU A;  5TAB A;  2CKL A;  2K17 A;  4V3L C;  1JOC A;  2D8S A;  2MD7 B;  5H1V A;  5B75 A;  1WEN A;  2RI7 A;  3PUQ A;  4QF3 A;  2LRI C;  4ZUX U;  2MNY A;  4A4B A;  2YW8 A;  3KV5 A;  5H1T A;  5TBN A;  1T1H A;  2H0D B;  2M85 A;  3SOU A;  1V87 A;  5LKX A;  4AYC A;  3O34 A;  4I7C A;  5TDR A;  4YBT A;  4Q6F A;  2EOD A;  2VJF A;  4IC2 A;  3U5O A;  5B79 A;  2L0B A;  1WEU A;  3GV4 A;  4PPE A;  2G43 A;  1WEQ A;  2M6M A;  2VPB A;  2VPD A;  2VJE B;  4YAB A;  3O37 A;  1VD4 A;  2UZG A;  2E6R A;  2HDP A;  2VJE A;  2QJ0 A;  3RPG B;  1VYX A;  4B86 C;  1MM2 A;  5C13 A;  5G04 B;  4N4F A;  2G6Q A;  2VP7 A;  3HCU A;  2YKO A;  2LXP C;  3O35 A;  5LCW B;  4WZ0 A;  3ZNI A;  3EQ2 A;  2CSY A;  1X4U A;  2KWN A;  3L4F A;  2G45 A;  5KH9 A;  3N9Q A;  4YBM A;  2PUY A;  2ECG A;  1WIM A;  5H1U A;  2YQL A;  2YHO A;  3N9M A;  3O33 A;  1FP0 A;  4FK5 A;  4BHW A;  3ZPV E;  4XI1 A;  2FUU A;  2K4D A;  3LQI A;  3BRV B;  5KH7 A;  4LKA A;  3L1Z B;  1WEE A;  4MSX A;  2E6S A;  5EYA F;  2FUI A;  2ECN A;  3M63 A;  3C5K A;  3RTR B;  1K2F A;  3M99 A;  4I7D A;  1FBV A;  5FB1 A;  4S3O B;  4NN2 A;  2CT2 A;  3U5M A;  2YKP A;  1LDK C;  1X4J A;  2LXH C;  3LQJ A;  4GND A;  1XWH A;  4QF2 A;  3SHB A;  2F42 A;  2YKQ A;  3EB6 A;  2KFT A;  4R2Y A;  2M3H A;  4LAD B;  3N9N A;  2JMJ A;  2C2V S;  4X3G A;  3CL3 D;  2XB1 A;  3HCS A;  4YBS A;  1WFK A;  2EGP A;  4FJC A;  2YHN A;  5TRB A;  3SOW A;  1WE9 A;  3KV6 A;  4LLB A;  2KE1 A;  3PUR A;  4N3W A;  5AIT A;  2QIC A;  4A0C D;  4IC3 A;  4WZ2 A;  1BOR A;  4I7B A;  4MVT A;  1WGM A;  4YC9 A;  3O70 A;  2LGL A;  4L58 A;  2JMI A;  4TKP B;  4BBQ A;  5JG6 A;  3FL2 A;  1WEV A;  1MM3 A;  2Y1N A;  1VFY A;  3DPL R;  2NAA A;  2YUC A;  1LDJ B;  5D1K B;  2LGG A;  1DVP A;  2IDA A;  4O64 A;  2RSD A;  1WEM A;  2I50 A;  4UP5 A;  3LQH A;  2KR4 A;  2KWJ A;  4UI9 B;  1CHC A;  5B78 A;  5C11 A;  2H0D A;  2MNZ A;  5G05 B;  3C6W A;  2BAY A;  2L75 A;  2M1R A;  1X4I A;  1HYJ A;  3MHH A;  4R7E A;  4W4U A;  2CKL B;  1Z6U A;  2YU4 A;  4ZDT A;  2F6J A;  1WES A;  3V43 A;  4YAT A;  4GB0 A;  3MHS A;  3LRQ A;  3KQI A;  3U5P A;  5B76 A;  5B77 A;  4R8P K;  2YSJ A;  5DIN A;  5AIU A;  2KYU A;  2MA5 A;  4YAD A;  4F52 B;  3KNV A;  4AYC B;  2LGV A;  5KH3 A;  2KIZ A;  2KRE A;  3ZPV 1;  2VPE A;  2MT5 A;  2YUR A;  1F62 A;  2JRJ A;  2LQ6 A;  2FSA A;  3ZTG A;  2YSM A;  4GNG A;  5LKU A;  5B8D A;  1JM7 B;  4PTB A;  2L80 A;  2EA6 A;  2VJF B;  2LDR A;  3EB5 A;  2VNF A;  2K1J A;  4AUQ B;  2ECV A;  2KU3 A; 
#chains in the Genus database with same CATH topology
 2WWW A;  4PV1 C;  3S9O A;  1FZC B;  4UB6 H;  3B5N B;  2YMK A;  2KGG A;  2C0W A;  2O01 H;  1J1E B;  1IC2 A;  4WA6 A;  2KLV A;  3H1I D;  3T7L A;  4FIP A;  1ZN5 A;  4W7Z A;  1K05 A;  2Q6Q A;  4U3F D;  1NTZ G;  4U7J A;  1KZU B;  3GF7 A;  1NTZ E;  2QE7 H;  2PNX A;  1OVV A;  1AVY A;  2KWK A;  1JM7 A;  3M91 A;  4OGQ C;  2WSE J;  4K35 A;  2Y1M A;  3P7K A;  1QL1 A;  1G25 A;  2KP8 A;  3RPG C;  3AE8 C;  5J3X A;  1WEO A;  1L4A B;  5AVS B;  3K5B A;  4H44 D;  3A0H H;  5TIS H;  2C2L A;  1FZG A;  2ECW A;  1LTJ C;  2W27 A;  4Z1M H;  2MUM A;  3L70 J;  2D8U A;  1NU1 E;  2FFD B;  4W80 A;  4WZ3 B;  2ECT A;  1AQT A;  4EYY Q;  1E5W A;  5CCG D;  3L11 A;  4EIJ A;  5G0F A;  2WT7 B;  1KOR A;  2LN0 A;  1HBW A;  4UB6 E;  1N7S A;  4B7Y C;  2EGM A;  1UIX A;  4CA1 A;  3BCC D;  2E42 A;  1OW6 A;  1EZV E;  2JWA A;  3L75 D;  1ZR4 A;  1VQ5 P;  4AVX A;  2AXT H;  4LJN A;  2IBZ D;  1AVO A;  1WEP A;  1PP9 E;  1IYM A;  3O47 A;  5B66 E;  1FZE A;  2W83 C;  1JM0 A;  2W6B A;  2ECI A;  3WUV A;  3O36 A;  3VYI A;  3IF4 A;  2KK7 A;  1Z60 A;  3HE4 B;  4GKG A;  1KB9 D;  3H1H J;  4O62 A;  1Z2Q A;  3KPE A;  1NTK G;  1NU1 D;  5DKA A;  1LTT C;  1SVF A;  1KB9 H;  3CXH I;  5CMZ A;  1S4X A;  2V7Q J;  2K16 A;  2FYU G;  5CJ4 A;  2AN6 A;  2KWO A;  1S5L X;  3WUT A;  3V6I A;  3MIW A;  3HTK C;  4I6M C;  1BE3 D;  1LJ2 A;  2M13 A;  3A0B H;  1OX3 A;  3Q1M A;  5H1V A;  5B75 A;  3NTN A;  1FE6 A;  4JQ0 D;  2E74 B;  3HTK A;  3AE9 C;  1MUU A;  2N1T C;  5TBN A;  1NTM D;  3H1H G;  1VPC A;  3E2D A;  3GG2 A;  2G8Y A;  1PGJ A;  3HUS A;  5LKX A;  4AYC A;  3O34 A;  5TDR A;  1Y9B A;  1MKM A;  3A7O A;  2IQJ A;  4IC2 A;  3U5O A;  2XDJ A;  1J2J B;  2L0B A;  5AW4 B;  1FZF A;  1JTH B;  3H1K J;  4IL6 E;  1DEE G;  3Q5P A;  1TU3 F;  1XTG B;  1KC8 Q;  1QEX A;  2FFW A;  2YXR B;  3CCQ P;  2D2C B;  4IL6 X;  1RHZ B;  1NTZ D;  3KZI H;  5KLV E;  1KFN A;  2XP0 A;  2HYN A;  2JR8 A;  1VYX A;  1LT9 B;  3L73 G;  2RKL A;  1A02 J;  3L72 J;  1NTM K;  1BCC G;  1SQQ J;  3N4X A;  2Z4E A;  2WSS H;  2VP7 A;  3PHL A;  1N7S C;  2LXP C;  3QH9 A;  1SQX J;  4QMA A;  2K3R A;  5SVX A;  2CSY A;  4H44 B;  3SWY A;  5KH9 A;  5CHX A;  3HD7 C;  4R4L A;  2FYU D;  3HE5 B;  3JSV C;  2WSC H;  5H1U A;  2A45 I;  1NAF A;  2Q1K A;  3N9M A;  1VQL P;  5KKZ B;  2V4H A;  1GW3 A;  3R2P A;  1NTK D;  2FUU A;  3EFG A;  2FYN C;  2ZXE B;  1J1D B;  3B5N D;  4GOE A;  2OWA A;  1YHQ P;  1KYO H;  3TDK A;  2Q3E A;  1PV3 A;  1VF5 C;  2FUI A;  2YNY A;  4XA4 A;  2HFE D;  2R3C A;  2OTL P;  1HJ0 A;  4PJ0 E;  3RTR B;  4D6T G;  2A45 G;  3KHU A;  4I7D A;  1FBV A;  2P10 A;  3U1C A;  4EI2 A;  1PIX A;  1LNQ A;  1X4J A;  2B0O E;  1PPJ D;  3LQJ A;  1XWH A;  2YO3 A;  2YKQ A;  4PV1 D;  2C2V S;  3CL3 D;  3HCS A;  3JUE A;  2M8R A;  2EGP A;  4EDF A;  2H43 A;  2M0B A;  1LT9 A;  3M9H A;  2KIK A;  3FGA D;  5AW2 B;  2IBZ E;  4LLB A;  2NPS A;  2IBZ I;  5AIT A;  5AVU B;  1PPJ G;  5DJU B;  1L0N K;  1DEB A;  1LT1 A;  1Y8A A;  3GMA A;  2SPZ A;  2WT7 A;  3BAT A;  3WU2 H;  2AXT E;  2PFX A;  1NWQ A;  4Z0O A;  2YMY A;  2FFD A;  3G3Z A;  1SQP D;  1YTZ I;  3W68 A;  3M06 A;  4W7Y A;  1CW5 A;  4L73 A;  3CC7 P;  2BCC D;  4C46 A;  1RE4 C;  4DOJ A;  1FDO A;  3TGU J;  2LGG A;  1EDL A;  1DVP A;  4O64 A;  2QIW A;  2RSD A;  1WMK A;  3USS A;  4L75 A;  2JEE A;  3CXH E;  1CHC A;  3RK3 C;  1ZRT D;  3RL0 g;  2BAY A;  2L75 A;  2R5D A;  2M1R A;  2J58 A;  5KLV K;  3BCC G;  1HYJ A;  1QGK B;  2F6J A;  4DJG A;  1LWU A;  2LAU A;  2WMM A;  4B86 A;  3KDP B;  4GB0 A;  3MHS A;  1NTM E;  4Y99 C;  5AVY B;  3V5B A;  2JM3 A;  3KQI A;  1OVU A;  5B76 A;  2IX7 C;  2YSJ A;  5DIN A;  1KIL C;  3CX5 E;  3VOP A;  5AIU A;  2KS1 A;  2C0X A;  3KNV A;  4PD4 D;  3B5N C;  1YYC A;  3TNU A;  2LGV A;  1KIL A;  4PV1 B;  1VF5 D;  3OJA B;  2MT5 A;  3L75 E;  2IYP A;  2YUR A;  1J1D C;  2QVA A;  1X8Y A;  1FU1 A;  1VQ6 P;  2FYN B;  1DIP A;  2FSA A;  3L74 J;  3LIE A;  3JC2 2;  2NRG A;  3KYQ A;  2QSI A;  2NPS C;  2OGU A;  5E79 E;  2FYZ A;  2LDR A;  5C39 A;  4OH8 B;  3EB5 A;  2VNF A;  1OWA A;  2JDI H;  1AV1 A;  1SFC D;  2L43 A;  1S9K E;  1SQQ D;  3H6P A;  3GL6 A;  2JMD A;  4I1L A;  1H0T A;  3B5N A;  2MIQ A;  2LV9 A;  3N9L A;  1BGY G;  1ZLL A;  4S3O C;  3N7N A;  5AW8 B;  1M7L A;  3LVQ E;  3G9R A;  3T9K A;  1IZN B;  3L70 D;  4V3K C;  1R8E A;  1H8A A;  3CCM P;  3CCV P;  3VK6 A;  2QJY B;  5GTH E;  2KNC A;  3H1J G;  1BGY E;  3N9P A;  2BEQ D;  1W2E A;  1IFI A;  3NG2 A;  4GNF A;  4UB8 H;  3ASL A;  1LWU C;  5KLI B;  3V2N A;  1NKZ B;  4A49 A;  2KS1 B;  2ZYA A;  3FEH A;  3H1K G;  5CCG C;  2K1A A;  5APT A;  3R4Y A;  2I1J A;  3AE2 C;  4ZQL A;  1AFO A;  3D6Z A;  2KI7 B;  3NFQ A;  1KYO I;  2D2C D;  5AVT B;  5KAF E;  1VQP P;  3RL0 C;  2OAR A;  4ZNC A;  2CRW A;  2E5Y A;  1EDJ A;  2MD8 C;  5FEY A;  4CCG X;  5D1L B;  2WSE H;  4LK9 A;  3L73 J;  1URQ D;  3II6 A;  3L75 G;  2LR2 A;  1JY2 N;  1M8O B;  2E76 C;  2Z5I A;  4H13 C;  2KGI A;  3BCC E;  3VMA A;  5SVI B;  4EOT A;  1HYI A;  5GTI E;  2M5A A;  3L74 E;  1RF1 C;  5APU A;  1M1K Q;  1HUC A;  5AVZ B;  2IFN A;  4RJT A;  2BCC J;  2OTK E;  4P5O B;  2P7J A;  1RMD A;  4YAX A;  5KJ7 C;  2FXO A;  3HD7 A;  2O01 J;  1RF0 C;  4L7X A;  3GHG B;  3M0A A;  4IFD K;  4U3F J;  3CX5 I;  1PGP A;  1LTS C;  3P8M C;  1IK9 A;  1U7M A;  3CX5 D;  1Z56 A;  5SVY A;  3H1L D;  2BAS A;  1SQX K;  2DW3 A;  3G6E P;  1BSN A;  2K88 A;  4FO9 A;  5CCG A;  2K17 A;  4V3L C;  1JOC A;  2D8S A;  3Q5R A;  1NTM J;  2RI7 A;  2XOC A;  4QF3 A;  2QM7 A;  4N78 D;  1FC2 C;  3Q1D A;  3CXH D;  2YW8 A;  4IFF A;  1L0L J;  1MBM A;  1YJN P;  2HG5 D;  2QEX P;  3KV5 A;  5H1T A;  1NKN A;  3SOU A;  1M57 D;  3H1J D;  2W90 A;  4H0L D;  3TGU E;  2XV5 A;  5B79 A;  2WPR A;  1T2K D;  1WEU A;  1KYO D;  2WSC J;  3CI9 A;  3GW6 A;  1PPJ E;  3HUS B;  1RF1 A;  1FZB A;  5AVQ B;  2H88 C;  2E61 A;  2FFD C;  2G3A A;  2VJE B;  1URQ C;  1NTK K;  4D6T E;  2N1T D;  4L76 A;  1SFC A;  2UZG A;  1SQQ G;  3ITK A;  2HDP A;  1S72 P;  1L4A C;  3VMY A;  3RPG B;  3KQG A;  1ZV8 A;  4A7P A;  4OGQ B;  2KZJ A;  2UWJ E;  4OGE A;  3I5C A;  2G6Q A;  3CCS P;  3FXE A;  1NVO A;  2QA4 P;  3O35 A;  5KKZ C;  4WZ0 A;  2W6A A;  1YJW P;  3V2R A;  1EDI A;  2QJY C;  1L4A D;  3AEF C;  3L4F A;  2G45 A;  1KD1 Q;  3M7K A;  3F89 A;  1FDM A;  5APQ A;  2FXP A;  1JY2 O;  2H89 C;  4YBM A;  2PUY A;  2QG4 A;  3W67 A;  2I8D A;  2FYU E;  2FYU J;  3FWL A;  2IZ0 A;  3ZPV E;  3G71 P;  4XI1 A;  1FOS E;  2JUN A;  2DSM A;  5AW6 B;  1OW8 A;  1RE4 A;  1CI6 A;  1EDK A;  2XU6 A;  3RK2 B;  5KH7 A;  4LKA A;  1JY2 P;  1FZA A;  5KTB A;  3VN0 A;  2JO1 A;  1VQO P;  2E6S A;  5EYA F;  1BSH A;  1NAY A;  2ZT9 B;  1VQM P;  5APX A;  3C5K A;  4HKZ H;  3MTU E;  3M99 A;  4F1P A;  2NPS B;  4S3O B;  3RK2 C;  3U5M A;  2Q7C A;  1EZV G;  3OA7 A;  2L5G B;  4D6T J;  2KB7 P;  2PAJ A;  4H13 D;  1SQX E;  3MDB C;  1U7J A;  2QJK C;  2XB1 A;  1RQV A;  3AEA C;  2KOG A;  1SQQ E;  4FJC A;  3L72 E;  1Y47 A;  1YQ3 C;  2WZ7 A;  4Y99 B;  5KLV J;  4I7B A;  2CPB A;  5KLV D;  4RO0 A;  3C9I A;  2LGL A;  2Q9I A;  1FDI A;  3L36 A;  1L0L E;  1L0L G;  1WEV A;  3RK3 E;  1IO4 A;  1MM3 A;  3B4S A;  3DPL R;  3RK3 B;  1GU4 A;  1LDJ B;  1R5S A;  1BE3 G;  2Y9Z A;  1OZH A;  3H32 B;  2JWD A;  1NH4 A;  4NPF X;  3VP9 A;  1G2C A;  2I50 A;  1FAV A;  4WY4 D;  2KWJ A;  3LQH A;  4UP5 A;  5C11 A;  4U3F E;  2XOZ A;  3NXS A;  1X4I A;  1EC5 A;  1RF0 A;  4W4U A;  4R7E A;  2BCC E;  2ZJS E;  2CPS A;  2XKM A;  5TIS E;  4YAT A;  3CX5 H;  4BXL A;  3LDY A;  3LRQ A;  3PLW A;  1Q81 Q;  1GL2 C;  2CSV A;  3BCC J;  5SVI A;  5B77 A;  4R8P K;  2CON A;  2LKM A;  3KZI E;  1E79 H;  2Y0E A;  4GIF A;  2KYU A;  3L73 E;  2MA5 A;  5AW3 B;  4F52 B;  1IFN A;  2P57 A;  1M1J C;  3L37 A;  4AYC B;  2QRX A;  1GL2 A;  3FWN A;  3GHG A;  5KH3 A;  2KIZ A;  1WRG A;  3ZPV 1;  2LXB A;  5AVX B;  2O01 N;  3OAK A;  2LQ6 A;  3ZTG A;  2W8Z A;  5CCH D;  1R5L A;  1T3U A;  4GNG A;  4AUW A;  5LKU A;  1AQ5 A;  2VJF B;  1LTJ B;  4PD4 E;  3M9B A;  3PRJ A;  2R3S A;  2OYO A;  1PP9 J;  1BCC D;  1WT6 A;  1RY3 A;  1P84 I;  1BGY J;  3AE5 C;  4GOD A;  1QL2 A;  4H13 B;  2R5B A;  3LJU X;  1SS1 A;  1QLE D;  2KSJ A;  2FD4 A;  3L71 G;  4UB8 E;  2YYR A;  2C9N Y;  4DT0 A;  3RL0 B;  4C7N B;  3SSU A;  1K9M Q;  2YQM A;  1H0T B;  1PZQ A;  3TGU G;  1FZC C;  2O1K A;  4RES B;  3L70 E;  1VQK P;  4YTP C;  2QM8 A;  3QWO C;  3ZYQ A;  4A4C A;  2YIU C;  1L0N G;  2J59 M;  2ZVN B;  1VQ9 P;  4HJG H;  3GF3 A;  3RK2 D;  2ECJ A;  1N7S B;  1EQ7 A;  3JCU H;  2WVR A;  1QVG O;  1S2E A;  2IPP A;  5AW5 B;  1SQB G;  1JY3 P;  3C8V A;  1N73 C;  2L5U A;  3U5N A;  1HTL C;  2ZFC A;  4R4M A;  5AW0 B;  1L0L K;  3CC4 P;  2VPG A;  4GNE A;  2N9B A;  3HD7 B;  1NTZ J;  1N87 A;  1DD4 A;  3O8Z A;  5H9M A;  2HPC A;  2E75 C;  2AEJ A;  5KLV G;  3L75 J;  1ZBD B;  1ZME C;  2IYO A;  3CWB D;  3IR9 A;  2LGK A;  4D6T D;  5AVR B;  3H25 A;  1PL5 A;  1SQV K;  1YJ9 P;  2VRS A;  5APS A;  2K37 A;  2QIZ A;  4JYB A;  4YXW H;  5GTI H;  2BCC G;  3A2A A;  1LT9 C;  3PHD A;  3IHP A;  5KJ7 A;  1OFC X;  2I1K A;  3I2D A;  2L7P A;  3V4Q A;  2AXC A;  2DX8 A;  4UP0 A;  3Q5S A;  3CCR P;  4YXD C;  2GM4 A;  5LKT A;  3PP5 A;  4Z0R A;  5D1M B;  1YTZ T;  3L1X A;  2YRE A;  3HCT A;  2H8P D;  2N1T B;  2M5A B;  2E74 C;  5FB0 A;  1P84 E;  3RGU A;  2XOY A;  3B8E B;  2PP6 A;  3B71 A;  5FER A;  1JEK A;  1HWT C;  3BAS A;  2HLO A;  4C9Z A;  2ZET C;  1WEW A;  1FOS F;  2CKL A;  3E1I A;  4ZKP A;  1WEN A;  5BVZ A;  2LRI C;  4PJ0 H;  2WPQ A;  1SQV G;  2MNY A;  2Q5U A;  4A4B A;  1KIL B;  1SQB D;  1EZV I;  4LC1 A;  1VDF A;  4L74 A;  1MV8 A;  3O6Q A;  2AEM A;  3CC2 P;  2M85 A;  3H1J J;  5BU8 B;  2R44 A;  4YBT A;  4Q6F A;  1YIJ P;  1Q2N A;  1URQ A;  2PGD A;  3WUU A;  3UIA A;  3E7K A;  1USD A;  1W5C E;  2WIT A;  4KHX A;  3GV4 A;  4PPE A;  1OMI A;  1WEQ A;  1LP1 B;  2M6M A;  4JF7 A;  1IJD B;  1GK4 A;  3CME P;  3KDE C;  2YVR A;  4YAB A;  3H1L E;  2Y0D A;  2OYI A;  1OVR A;  2OTJ P;  5B66 H;  3O37 A;  1VD4 A;  2E76 D;  3MD0 A;  2GUS A;  3HD7 D;  3U59 A;  5DJT B;  3H32 A;  3H1H D;  2QJ0 A;  2MKE A;  1LTG C;  3SUB A;  3F5H A;  4I7Z B;  2WPV B;  1CZQ A;  1N7S D;  4N4F A;  3VMX A;  2MKV A;  4N6J A;  1NU1 K;  1GL2 B;  2JKV A;  4KT0 J;  5LCW B;  5CBN A;  3ZNI A;  1X9V A;  3EQ2 A;  5K5G B;  1ZXG A;  2KWN A;  4WBA A;  1RF1 B;  3DDT A;  2V7Q H;  1N8R Q;  3L74 G;  2ECG A;  1CI6 B;  4QQ4 A;  1S1C X;  1RQU A;  3O33 A;  3RL0 D;  4FK5 A;  1D7M A;  3A0H E;  4GOF A;  1NU1 G;  2B87 B;  3D6Y A;  1KB9 E;  4IOI H;  1KTM A;  4N3Y B;  3L71 E;  2K4D A;  1FJK A;  2P2U A;  1DCQ A;  3BRV B;  3L1Z B;  2KYV A;  1WEE A;  3G4S P;  1GTW A;  4MSX A;  2ZXX A;  4ASW A;  1DD3 A;  1IFJ A;  3FAN A;  2P1J A;  1HVV A;  1NJI Q;  4JPZ B;  1NOH A;  1H88 A;  1HH0 A;  1Q90 D;  3M63 A;  1YIT P;  1VQ4 P;  1K2F A;  5B5E H;  1LTA C;  5FB1 A;  5M1B A;  2C9L Y;  3CWB G;  2CT2 A;  2YKP A;  1LWU B;  3IN6 A;  1LDK C;  3I55 P;  4TT3 H;  4WVZ A;  5E79 H;  1BCC E;  1EXI A;  3SHB A;  1N2D C;  2F42 A;  1J1E C;  4R2Y A;  2M3H A;  1YQ4 C;  1VQ8 P;  4LAD B;  3P32 A;  3N9N A;  5H2F E;  2KLU A;  4YBS A;  3H1K E;  2B9B A;  2O3J A;  1IK7 A;  1SQB K;  4K3A A;  1WE9 A;  1KQL A;  1L0N D;  2HOD B;  3JCU E;  2QIC A;  2B88 A;  1VQN P;  1M1J A;  1BOR A;  1M56 D;  1JY3 O;  1SQX D;  1VL2 A;  3O70 A;  3PLN A;  4L58 A;  2ZT9 C;  2E75 B;  3MZW B;  2JMI A;  4HYT B;  3L72 D;  4BBQ A;  5JG6 A;  4PD4 I;  1IFM A;  4WY4 B;  3EWK A;  5AW9 B;  1GDT A;  3TF5 A;  4BRY B;  1IFD A;  1A02 F;  5D1K B;  3H1L G;  3HRN A;  3CCE P;  1KQS O;  4I2L C;  1WEM A;  2KR4 A;  5B78 A;  2MNZ A;  2IDB A;  1JUN A;  3L70 G;  4DCK A;  2E75 D;  3MHH A;  1KFM A;  1IFP A;  1UII A;  2CKL B;  1OXZ A;  1KN7 A;  3H1H E;  1Z6U A;  1KB9 I;  3LW5 H;  3V2P A;  4OGC A;  2FXM A;  1S5L H;  2BEZ F;  1OW7 A;  3VTP C;  3U5P A;  5APV A;  1X22 A;  3A5T A;  1K8A Q;  1AJY A;  3AE3 C;  4YAD A;  1JY3 N;  3FJU B;  4ASV A;  1HGZ A;  3RK3 D;  3CCL P;  1KMI Z;  2MJZ A;  3L73 D;  3M0D C;  1GZL A;  3GLM A;  1P84 D;  3HTK B;  2KRE A;  1SFC C;  4HB1 A;  1SQP E;  4Y28 J;  1F62 A;  3ABV C;  3T97 A;  2M3B A;  3D71 A;  2WSF J;  3P8C D;  5KAF H;  5AVW B;  2J5U A;  3RBX A;  4AUQ B;  1EXJ A;  2ECV A;  1NU1 J;  2P67 A;  4AP4 A;  2HYE D;  3O6Q B;  3QZV A;  2N9Y B;  1NYH A;  4OWF A;  2MA6 A;  3ZVZ B;  1WIL A;  3T6R A;  3A0B E;  1W2B O;  1PP9 G;  2OQQ A;  2RN0 A;  3BRT B;  1MFZ A;  3LID A;  2DJA A;  4M3L A;  5BU5 A;  1PGO A;  1N86 A;  3MUD C;  4I7Z C;  1SQV D;  2NPS D;  1L0L D;  5AW1 B;  2ZYG A;  1BE3 J;  1U6G B;  2ZT9 D;  1OIP A;  1JB0 J;  3Q2Y A;  1GW4 A;  1X79 B;  3FX0 A;  2QJP C;  1GK6 A;  2B89 A;  3M0D A;  1VQ7 P;  3RBZ A;  1L2P A;  1SQB E;  3N9O A;  1SQB J;  2GUV A;  1GL2 D;  4C7N A;  3GHG C;  2CRR A;  4HH2 A;  1USE A;  4BWN A;  1L0N E;  1KIL E;  2ZVO B;  2HPC B;  3IFM A;  1BE3 E;  3ZVY A;  3ZDM A;  2A06 D;  3C1L A;  1SQP G;  4RKU J;  1E4U A;  5I3L A;  1G1I A;  3L35 A;  1BDD A;  2HR3 A;  2RH0 A;  4U3F G;  3T97 B;  3SOX A;  1N7L A;  2E76 B;  1EZV D;  2FYU K;  1JCC A;  3DQV R;  4DZO A;  3AEG C;  1BDC A;  1S3J A;  2Y43 A;  2O1J A;  4JBZ A;  1XTC C;  2KUB A;  1S9K D;  1L4A A;  3CWB E;  5KAI H;  1LTJ A;  2CSZ A;  3O7A A;  3OW2 O;  3TSI A;  1RE3 A;  3MGN A;  2L91 A;  4OGQ D;  3CCJ P;  2F6N A;  1T3J A;  3BVH A;  2QJK B;  3AEE C;  1ZR2 A;  5K3Q A;  4WB4 A;  1KYO E;  1AA0 A;  2YT5 A;  1DX7 A;  3VP8 A;  4LLH A;  5GTH H;  3TK1 A;  4H44 C;  1ZW0 A;  1RE3 C;  1K04 A;  5KLI C;  2OYI C;  1SQP J;  5KAI E;  3H7H A;  1KIL D;  1FZC A;  2OYH B;  3M62 A;  1SP4 A;  5TDW A;  1NGM B;  1NTK J;  3AE4 C;  2OXQ C;  2XND H;  1SQV J;  2POH A;  1H89 A;  1HF9 A;  2KXP B;  4H0L B;  1KQF B;  5LKZ A;  2XEU A;  5TAB A;  2HOD A;  2K9J A;  5B5E E;  1G1J A;  3MP7 B;  1SQQ K;  2MD7 B;  3PUQ A;  1SQP K;  4ZUX U;  3AE6 C;  3VMZ A;  2D2C C;  4CPG A;  2YXQ B;  3U1A A;  3CMA P;  2A06 G;  4XFJ A;  1ZOY C;  2R32 A;  2OYI B;  1Q82 Q;  1T1H A;  2H0D B;  2E74 D;  3H1I G;  1P84 H;  1V87 A;  1QVF O;  4PD4 H;  2ITA A;  2E43 A;  4ZMD A;  4I7C A;  1NHL A;  2KSE A;  4H0L C;  4C7R A;  2IZ1 A;  2EOD A;  3AE7 C;  2VJF A;  1HGV A;  1N73 B;  4WWI A;  4XE5 B;  4YPC A;  3S1K A;  2Z5H A;  5EFW B;  1PGQ A;  2G43 A;  3NMD A;  3IAO A;  5TJH A;  2OYH C;  3V4W A;  2FKW B;  1YI2 P;  2VPB A;  3KXD A;  2VPD A;  2GA1 A;  5CCH C;  1SLQ A;  2YO2 A;  4LGD E;  2RR4 A;  2YIU B;  1LGH B;  1GD2 E;  3Q3D A;  3DWD A;  4GDO A;  5APY A;  2E6R A;  2ZAE B;  1PP9 D;  1MFT A;  2VJE A;  1ZP0 C;  3AE1 C;  2FBW C;  4TLF A;  2FY8 A;  4B86 C;  2B87 A;  1MM2 A;  1U57 A;  2K9J B;  1S5L E;  3E1R A;  5C13 A;  5G04 B;  3I56 P;  3H1I J;  4WY4 A;  2P58 A;  2IFM A;  5APW A;  4NPE A;  1M90 Q;  4ZKU A;  1URQ B;  4BRY A;  3HCU A;  3AEB C;  2YKO A;  1RH5 B;  3CLQ A;  2KZI A;  3HUS C;  2H7H A;  1X4U A;  3L72 G;  1BCC J;  4GT1 A;  3SFE C;  3FM8 C;  1ZRT E;  3N9Q A;  1G2C B;  1CSB A;  3LVR E;  5CCH A;  1SQX G;  1WIM A;  2YQL A;  4H9D A;  2YHO A;  2KKX A;  1FP0 A;  1QX8 A;  1FBM A;  4BHW A;  1T2K C;  2K9Y A;  1DH3 A;  1MZ9 A;  5CJ0 A;  1JCD A;  3LQI A;  3WMM 0;  2EXU A;  1FS0 E;  3WU2 E;  2QJP B;  3P8C E;  2ZYD A;  3SWF A;  1JTH A;  3FXD A;  3L71 J;  2WQY C;  3H1I E;  3D70 A;  2Y9Y A;  1M1J B;  1N73 A;  3HE5 A;  2ECN A;  2NZ2 A;  2E5T A;  3PJS K;  1LTB C;  4NN2 A;  1Q86 Q;  1NTZ K;  4N78 E;  2LXH C;  2XZR A;  1GMJ A;  4GND A;  4QF2 A;  1T8Z A;  3EB6 A;  2KFT A;  4JYC A;  1SFC B;  2JMJ A;  1T6A A;  4X3G A;  4KJM A;  1WFK A;  3HE4 A;  3PH0 A;  2YHN A;  3TYY A;  4MN4 C;  3CPW O;  1KV4 A;  3KV6 A;  5TRB A;  4NPD A;  3SWK A;  3SOW A;  5CBO A;  2KE1 A;  3PUR A;  4N3W A;  4A0C D;  1KQG B;  2WPS A;  4IC3 A;  1JMM A;  4WZ2 A;  4MVT A;  1WGM A;  4YC9 A;  1NTM G;  3FAO A;  2XNX A;  2KKY A;  2W6J H;  2A45 H;  3H1L J;  1VF5 B;  4TKP B;  5AW7 B;  3FL2 A;  2CK3 H;  2Y1N A;  3EFF K;  2LXC B;  1X0T A;  1VFY A;  2NAA A;  2YUC A;  5AVV B;  2IDA A;  1SQV E;  1JO5 A;  1GU5 A;  1NTK E;  2A06 E;  2PRR A;  4UI9 B;  2RMZ A;  3CXH H;  2AEF A;  2H0D A;  3H1J E;  5G05 B;  4WY4 C;  3C6W A;  1JNM A;  1K73 Q;  1PFI A;  3TGU D;  1NO4 A;  3M9Q A;  2N1T A;  3V2Q A;  5H2F H;  3AED C;  3PTZ A;  4IL6 H;  2YU4 A;  4ZDT A;  1WES A;  2JJL A;  3A3Y B;  3V43 A;  3CCU P;  3H1K D;  4AQR D;  3MUD A;  3MHV A;  3L71 D;  2WTY A;  5KJ7 D;  4IFM A;  1LTI C;  2IBZ G;  3SFD C;  4O9B A;  1JMB A;  2WSF H;  3CWB J;  4OVN F;  2OYH A;  2VPE A;  3LW5 J;  2JP3 A;  2KNC B;  2JRJ A;  1LP1 A;  3L74 D;  1FJP A;  2Y0C A;  5L8R J;  3S4R A;  2YSM A;  1YBK A;  3CD6 P;  3TNU B;  5B8D A;  1JM7 B;  1HJB A;  2L80 A;  4PTB A;  1BGY D;  2EA6 A;  2Q3I A;  2M3E A;  1L0N J;  2K1J A;  3AEC C;  1Q7Y Q;  2KU3 A; 
#chains in the Genus database with same CATH homology
 1WT6 A;  2WWW A;  1OWA A;  2P67 A;  1RY3 A;  1FZC B;  4AP4 A;  3B5N B;  2HYE D;  2KGG A;  1QL2 A;  2C0W A;  2O01 H;  1J1E B;  3QZV A;  1SFC D;  1IC2 A;  2MA6 A;  4WA6 A;  3ZVZ B;  2R5B A;  2KLV A;  1WIL A;  3T6R A;  3T7L A;  2L43 A;  1S9K E;  4FIP A;  5B75 A;  3H6P A;  1ZN5 A;  3GL6 A;  2JMD A;  4W7Z A;  4I1L A;  2KSJ A;  3BRT B;  1MFZ A;  3B5N A;  3LID A;  2MIQ A;  2LV9 A;  4M3L A;  5BU5 A;  3N9L A;  2YYR A;  1KZU B;  1ZLL A;  2PNX A;  2C9N Y;  4S3O C;  1N86 A;  3RL0 B;  2KWK A;  1JM7 A;  3M91 A;  3N7N A;  5AW8 B;  2NPS D;  5AW1 B;  1M7L A;  3P7K A;  2Y1M A;  4C7N B;  1QL1 A;  1G25 A;  2KP8 A;  3RPG C;  1U6G B;  2YQM A;  5J3X A;  4V3K C;  1WEO A;  1L4A B;  1FZC C;  1H8A A;  2O1K A;  5AVS B;  4RES B;  1GW4 A;  3VK6 A;  1X79 B;  1GK6 A;  2QM8 A;  3M0D A;  3ZYQ A;  2C2L A;  1FZG A;  2ECW A;  4A4C A;  3N9O A;  1LTJ C;  2W27 A;  2GUV A;  1GL2 D;  2J59 M;  1W2E A;  2MUM A;  3N9P A;  4C7N A;  1IFI A;  3NG2 A;  3GHG C;  4HH2 A;  3RK2 D;  2FFD B;  4GNF A;  2ECJ A;  1N7S B;  4W80 A;  3ASL A;  4WZ3 B;  1LWU C;  1EQ7 A;  2ECT A;  2HPC B;  3IFM A;  3V2N A;  1E5W A;  5CCG D;  1NKZ B;  3L11 A;  4A49 A;  3ZVY A;  4EIJ A;  5G0F A;  2WT7 B;  2IPP A;  5AW5 B;  1JY3 P;  5CCG C;  2LN0 A;  1N73 C;  5APT A;  1HBW A;  2L5U A;  1HTL C;  3U5N A;  2ZFC A;  5AW0 B;  1N7S A;  1L0L K;  1E4U A;  2I1J A;  5I3L A;  4B7Y C;  2VPG A;  4GNE A;  1G1I A;  2N9B A;  3HD7 B;  4ZQL A;  3L35 A;  1AFO A;  1N87 A;  3O8Z A;  4CA1 A;  5H9M A;  2HPC A;  3SOX A;  1N7L A;  3NFQ A;  2FYU K;  1JCC A;  3DQV R;  4DZO A;  1ZBD B;  5AVT B;  2E42 A;  2Y43 A;  2O1J A;  3RL0 C;  2OAR A;  1XTC C;  3IR9 A;  2LGK A;  1ZR4 A;  1S9K D;  1L4A A;  2MD8 C;  5AVR B;  4AVX A;  1LTJ A;  4LJN A;  1SQV K;  2CSZ A;  5FEY A;  5D1L B;  2VRS A;  2WSE H;  4LK9 A;  1WEP A;  4CCG X;  3O7A A;  5APS A;  1URQ D;  3II6 A;  3TSI A;  1JY2 N;  1IYM A;  2QIZ A;  1FZE A;  1RE3 A;  3MGN A;  4JYB A;  2Z5I A;  2W6B A;  2ECI A;  3A2A A;  2F6N A;  1LT9 C;  2KGI A;  3IHP A;  3PHD A;  5KJ7 A;  1T3J A;  3BVH A;  3O36 A;  3VYI A;  2I1K A;  4EOT A;  1ZR2 A;  3I2D A;  1HYI A;  4WB4 A;  3V4Q A;  2YT5 A;  1DX7 A;  3VP8 A;  1RF1 C;  1Z60 A;  3HE4 B;  4LLH A;  5APU A;  2DX8 A;  4GKG A;  4UP0 A;  3TK1 A;  1Z2Q A;  1HUC A;  3KPE A;  5AVZ B;  1RE3 C;  2IFN A;  2GM4 A;  3PP5 A;  5LKT A;  5DKA A;  4P5O B;  2OYI C;  2P7J A;  5D1M B;  1RMD A;  4YAX A;  1YTZ T;  5KJ7 C;  1LTT C;  3L1X A;  1SVF A;  3HD7 A;  1KIL D;  2H8P D;  2N1T B;  1FZC A;  1RF0 C;  5CMZ A;  2OYH B;  2YRE A;  3HCT A;  3M62 A;  3GHG B;  1SP4 A;  3M0A A;  4L7X A;  5TDW A;  4IFD K;  2K16 A;  1LTS C;  3P8M C;  5FB0 A;  5CJ4 A;  1IK9 A;  2AN6 A;  2OXQ C;  3B8E B;  2POH A;  2PP6 A;  1Z56 A;  1H89 A;  2KWO A;  5FER A;  1HWT C;  3MIW A;  2BAS A;  1SQX K;  3HTK C;  3BAS A;  4I6M C;  2HLO A;  4C9Z A;  2ZET C;  1WEW A;  4FO9 A;  5LKZ A;  2XEU A;  1FOS F;  5TAB A;  2CKL A;  2HOD A;  3E1I A;  5CCG A;  2K17 A;  4V3L C;  1JOC A;  1G1J A;  4ZKP A;  2D8S A;  1SQQ K;  2MD7 B;  5H1V A;  1WEN A;  5BVZ A;  2RI7 A;  1SQP K;  3PUQ A;  4QF3 A;  3NTN A;  2LRI C;  2QM7 A;  4N78 D;  4ZUX U;  2WPQ A;  3VMZ A;  2MNY A;  2Q5U A;  3U1A A;  1KIL B;  4A4B A;  3HTK A;  4IFF A;  2YW8 A;  4LC1 A;  1MUU A;  1VDF A;  2N1T C;  2HG5 D;  2R32 A;  1MV8 A;  3KV5 A;  1NKN A;  5H1T A;  2OYI B;  5TBN A;  1T1H A;  2H0D B;  1VPC A;  2M85 A;  3SOU A;  5BU8 B;  1V87 A;  3HUS A;  5LKX A;  2E43 A;  4AYC A;  3O34 A;  4I7C A;  1NHL A;  5TDR A;  4YBT A;  4Q6F A;  4C7R A;  2EOD A;  3A7O A;  2VJF A;  1URQ A;  1HGV A;  1N73 B;  3UIA A;  4IC2 A;  2XV5 A;  3U5O A;  5B79 A;  2WIT A;  2WPR A;  1J2J B;  2XDJ A;  4KHX A;  4XE5 B;  1T2K D;  5AW4 B;  1WEU A;  2L0B A;  3GV4 A;  4PPE A;  1FZF A;  1JTH B;  3CI9 A;  2Z5H A;  2G43 A;  1WEQ A;  3HUS B;  1RF1 A;  4JF7 A;  1FZB A;  2M6M A;  3NMD A;  5AVQ B;  1XTG B;  3V4W A;  1IJD B;  1GK4 A;  2FKW B;  2FFD C;  2OYH C;  2VPB A;  2VPD A;  5CCH C;  2VJE B;  1URQ C;  4YAB A;  1NTK K;  2N1T D;  1SLQ A;  2YO2 A;  2OYI A;  4LGD E;  3O37 A;  1LGH B;  1VD4 A;  1GD2 E;  3MD0 A;  2GUS A;  4UP5 A;  5APY A;  1SFC A;  3HD7 D;  3U59 A;  2E6R A;  2UZG A;  2HDP A;  1L4A C;  2VJE A;  1KFN A;  2HYN A;  3H32 A;  3VMY A;  2QJ0 A;  3RPG B;  1VYX A;  4B86 C;  1LT9 B;  1LTG C;  1MM2 A;  3KQG A;  1ZV8 A;  1A02 J;  5C13 A;  5G04 B;  4WY4 A;  1CZQ A;  2IFM A;  5APW A;  1N7S D;  3I5C A;  1NTM K;  4N4F A;  3N4X A;  3VMX A;  4ZKU A;  2G6Q A;  2Z4E A;  1URQ B;  2VP7 A;  3HCU A;  1N7S C;  4N6J A;  1NU1 K;  2YKO A;  3CLQ A;  1GL2 B;  3HUS C;  2LXP C;  3O35 A;  5LCW B;  4WZ0 A;  3ZNI A;  1X9V A;  2H7H A;  3EQ2 A;  2CSY A;  2W6A A;  3V2R A;  1X4U A;  2KWN A;  4WBA A;  1L4A D;  3L4F A;  3SWY A;  1RF1 B;  2G45 A;  1FDM A;  5KH9 A;  4GT1 A;  3HD7 C;  5CHX A;  5APQ A;  3N9Q A;  1G2C B;  1JY2 O;  1CSB A;  3HE5 B;  2PUY A;  5CCH A;  2ECG A;  4YBM A;  1WIM A;  2WSC H;  5H1U A;  2A45 I;  1CI6 B;  2YQL A;  1NAF A;  2YHO A;  3N9M A;  3O33 A;  3RL0 D;  1FP0 A;  1FBM A;  4FK5 A;  4BHW A;  1T2K C;  3ZPV E;  4XI1 A;  1FOS E;  1GW3 A;  1DH3 A;  3R2P A;  5AW6 B;  2FUU A;  1MZ9 A;  3EFG A;  4N3Y B;  5CJ0 A;  2K4D A;  1RE4 A;  1FJK A;  1CI6 A;  1JCD A;  2XU6 A;  3RK2 B;  3LQI A;  2P2U A;  3WMM 0;  3BRV B;  5KH7 A;  4LKA A;  2ZXE B;  1J1D B;  3L1Z B;  1JY2 P;  1FZA A;  2KYV A;  1WEE A;  1GTW A;  3B5N D;  3P8C E;  5KTB A;  4MSX A;  3SWF A;  3VN0 A;  1JTH A;  1IFJ A;  2P1J A;  1HVV A;  2E6S A;  5EYA F;  2FUI A;  2YNY A;  4XA4 A;  1NOH A;  2HFE D;  1M1J B;  1H88 A;  1HH0 A;  3HE5 A;  1N73 A;  2ECN A;  3M63 A;  2R3C A;  5APX A;  3C5K A;  3RTR B;  1K2F A;  2A45 G;  1LTA C;  3MTU E;  3M99 A;  4I7D A;  2NPS B;  1FBV A;  5FB1 A;  4S3O B;  3RK2 C;  1LTB C;  3U1C A;  2C9L Y;  4NN2 A;  2CT2 A;  3U5M A;  2YKP A;  1LWU B;  2Q7C A;  1NTZ K;  4N78 E;  1LDK C;  1X4J A;  2LXH C;  2XZR A;  3LQJ A;  4GND A;  1XWH A;  3OA7 A;  4QF2 A;  2YO3 A;  1T8Z A;  2L5G B;  3SHB A;  1N2D C;  2F42 A;  2YKQ A;  1J1E C;  2KB7 P;  3EB6 A;  2KFT A;  4R2Y A;  4JYC A;  2M3H A;  1SFC B;  4LAD B;  3P32 A;  2PAJ A;  3N9N A;  2JMJ A;  2C2V S;  4X3G A;  3CL3 D;  2XB1 A;  3HCS A;  4YBS A;  1WFK A;  2M8R A;  2EGP A;  3HE4 A;  2H43 A;  1LT9 A;  2KOG A;  3M9H A;  1SQB K;  4FJC A;  5AW2 B;  2YHN A;  3TYY A;  5TRB A;  1WE9 A;  3KV6 A;  2NPS A;  4LLB A;  1KQL A;  3SOW A;  2KE1 A;  2HOD B;  3PUR A;  4N3W A;  5AIT A;  5AVU B;  2QIC A;  2WPS A;  4IC3 A;  4A0C D;  1JMM A;  4WZ2 A;  1L0N K;  1DEB A;  1M1J A;  2WZ7 A;  4Y99 B;  1BOR A;  4I7B A;  4MVT A;  1WGM A;  1JY3 O;  2CPB A;  4YC9 A;  2WT7 A;  3BAT A;  3O70 A;  3C9I A;  2LGL A;  2Q9I A;  2XNX A;  4L58 A;  3L36 A;  2JMI A;  2A45 H;  1NWQ A;  2YMY A;  4HYT B;  2FFD A;  3G3Z A;  4TKP B;  4BBQ A;  5AW7 B;  5JG6 A;  3FL2 A;  1YTZ I;  1WEV A;  1IFM A;  1IO4 A;  1MM3 A;  2Y1N A;  4WY4 B;  1VFY A;  3M06 A;  3DPL R;  4W7Y A;  1CW5 A;  5AW9 B;  1GDT A;  2NAA A;  2YUC A;  3RK3 B;  4C46 A;  1GU4 A;  1LDJ B;  1RE4 C;  1IFD A;  1A02 F;  4DOJ A;  5D1K B;  3H32 B;  5AVV B;  3HRN A;  2LGG A;  1DVP A;  2IDA A;  1JO5 A;  4O64 A;  1GU5 A;  4I2L C;  2RSD A;  1WEM A;  1NH4 A;  3VP9 A;  2I50 A;  1G2C A;  2JEE A;  1FAV A;  4WY4 D;  2KR4 A;  2KWJ A;  1CHC A;  3LQH A;  3RK3 C;  4UI9 B;  5B78 A;  5C11 A;  2H0D A;  2MNZ A;  5G05 B;  4WY4 C;  3C6W A;  1JNM A;  2BAY A;  1PFI A;  2L75 A;  1JUN A;  3NXS A;  2R5D A;  2M1R A;  1X4I A;  1NO4 A;  1RF0 A;  2J58 A;  2N1T A;  3M9Q A;  3V2Q A;  5KLV K;  3MHH A;  4R7E A;  4W4U A;  1HYJ A;  1KFM A;  2CKL B;  1OXZ A;  1Z6U A;  2YU4 A;  4ZDT A;  2CPS A;  2F6J A;  1WES A;  2JJL A;  3A3Y B;  2XKM A;  3V43 A;  1LWU A;  4YAT A;  3LW5 H;  3V2P A;  4B86 A;  3KDP B;  4GB0 A;  2FXM A;  4AQR D;  3MHS A;  3MUD A;  4Y99 C;  5AVY B;  3V5B A;  2WTY A;  3LRQ A;  3KQI A;  1GL2 C;  3VTP C;  3U5P A;  5B76 A;  5B77 A;  2IX7 C;  5KJ7 D;  5APV A;  2YSJ A;  5DIN A;  4R8P K;  1KIL C;  3A5T A;  3VOP A;  4IFM A;  2LKM A;  5AIU A;  2KYU A;  4GIF A;  2C0X A;  2MA5 A;  4YAD A;  5AW3 B;  1JY3 N;  1LTI C;  4F52 B;  1IFN A;  1HGZ A;  3RK3 D;  1M1J C;  3L37 A;  3KNV A;  4AYC B;  4O9B A;  2MJZ A;  3M0D C;  2WSF H;  1GZL A;  1GL2 A;  3B5N C;  3GHG A;  1YYC A;  3TNU A;  2LGV A;  3HTK B;  2OYH A;  2KIZ A;  5KH3 A;  1KIL A;  2KRE A;  1SFC C;  1WRG A;  3ZPV 1;  3OJA B;  2VPE A;  2MT5 A;  5AVX B;  2YUR A;  1J1D C;  1F62 A;  3OAK A;  2JRJ A;  1FJP A;  3T97 A;  1X8Y A;  2M3B A;  1FU1 A;  2LQ6 A;  2FSA A;  3ZTG A;  5CCH D;  2YSM A;  3LIE A;  1T3U A;  3TNU B;  4GNG A;  4AUW A;  5LKU A;  5B8D A;  1JM7 B;  1HJB A;  1AQ5 A;  3P8C D;  2L80 A;  4PTB A;  3KYQ A;  2EA6 A;  2VJF B;  1LTJ B;  2NPS C;  3M9B A;  2FYZ A;  5AVW B;  2LDR A;  2Q3I A;  4OH8 B;  3EB5 A;  2VNF A;  2K1J A;  4AUQ B;  2ECV A;  2KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...