1JOCA

Eea1 homodimer of c-terminal fyve domain bound to inositol 1,3-diphosphate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
QDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Early Endosomal Autoantigen 1
publication title Multivalent endosome targeting by homodimeric EEA1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jocA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jocA02
3N9PA 5B8DA 3LQIA 5J3XA 4I7CA 5TABA 2L80A 4FK5A 5DINA 5H1UA 2Y43A 4MSXA 5H1VA 2G45A 4N4FA 3MHHA 3SOUA 2VPEA 4GNFA 3KV5A 2LGGA 2I50A 4YBSA 2JMJA 2ZETC 2YKOA 3RTRB 4GNDA 4UI9B 5D1LB 2M6MA 2CSYA 5FEYA 1U6GB 2YU4A 1WESA 4F52B 4S3OC 4LKAA 4GNGA 3ZVZB 5C11A 3GV4A 3U5OA 1WEUA 2ECWA 3C6WA 5C13A 4IC2A 2EGPA 3ASLA 2MD8C 4I7DA 3I2DA 2M1RA 4WZ3B 2KWNA 2KGGA 4WA6A 1MM3A 3N9OA 5G05B 2YHOA 2IDAA 3M99A 2RI7A 4QF2A 2E6RA 2YURA 1Z6UA 4L7XA 5G04B 2MA6A 1CHCA 2C2LA 3T6RA 4P5OB 3DPLR 1K2FA 2L0BA 2K16A 4R8PK 5B78A 4ZQLA 4A4BA 4I7BA 1WEMA 2KYUA 2QIZA 4PPEA 2F6NA 2HYED 2MT5A 3L4FA 2NAAA 5KH9A 1E4UA 3MHSA 3KQIA 2VNFA 3EB6A 2L43A 1VD4A 4O64A 4C9ZA 3RPGB 2YHNA 5G0FA 2Y1NA 5LKTA 3O70A 2KE1A 3GL6A 2LRIC 4A4CA 1X4UA 2MA5A 3M63A 2VJFB 1WIMA 2CKLA 4MVTA 4CCGX 2LQ6A 2MIQA 5AIUA 4LLBA 4AYCB 4YBTA 3SOWA 3N9LA 2G43A 4R2YA 2H0DA 5D1MB 1T1HA 4BHWA 1JM7A 2ECNA 1FP0A 2VPGA 1VFYA 2YUCA 3CL3D 3FL2A 4CA1A 4FJCA 2LXPC 5TDWA 2VP7A 2L5UA 3SHBA 5KH3A 2UZGA 1XWHA 3U5MA 2LGLA 3N9QA 3O37A 4Q6FA 5H9MA 3N9MA 1WILA 2VJEB 5JG6A 2FUUA 2K17A 2LGVA 4BBQA 1BORA 2ECVA 5TBNA 2ECTA 5EYAF 2JMIA 5I3LA 2JRJA 5H1TA 2YT5A 2Y1MA 1HYJA 3RPGC 2ECJA 5LKXA 3U5PA 5FB0A 3ZNIA 3BRVB 4AP4A 3L1ZB 1X4IA 1IYMA 4UP5A 5B79A 3EB5A 2LDRA 3EQ2A 3T7LA 2FUIA 4LK9A 1LDKC 1WEWA 2EA6A 1WEQA 2KWJA 2CSZA 2LV9A 2VPBA 1WENA 5B77A 3QZVA 4GB0A 4QF3A 1LDJB 4PTBA 2KFTA 2VPDA 2ECIA 2M3HA 2MUMA 2XEUA 2W6BA 1VYXA 3N9NA 2YW8A 1N87A 3O35A 4V3KC 4YAXA 1V87A 2YQMA 4GNEA 2JMDA 4N3WA 2QICA 5TRBA 2YKQA 4AUQB 2FSAA 1WEOA 4XI1A 3IHPA 4A0CD 2YREA 3SOXA 2RSDA 3HCTA 2K1JA 3O33A 4WZ0A 1ZBDB 3KV6A 3PUQA 2LGKA 2VJFA 3PURA 4LJNA 3PHDA 2E6SA 4AYCA 4B86C 4UP0A 2MD7B 2BAYA 1WEPA 1Z60A 2HDPA 3L1XA 2KWKA 4WZ2A 3V43A 3ZVYA 3BRTB 2LN0A 2ECGA 1WEVA 1RMDA 3HCUA 2L75A 3O7AA 3L11A 2KREA 2YQLA 4ZUXU 1WGMA 3NG2A 2YSMA 2YYRA 2QJ0A 5KH7A 1X4JA 4A49A 4YBMA 2EODA 3O34A 2F6JA 3ZPV1 4R7EA 1WEEA 4AVXA 5D1KB 2MNYA 2C2VS 2OXQC 2KWOA 5LCWB 3HCSA 4ZDTA 4W4UA 2AN6A 4X3GA 5DKAA 5LKUA 5TDRA 2YKPA 2KU3A 2VJEA 3ZYQA 5FERA 2CKLB 1DVPA 1G25A 3C5KA 2D8SA 2F42A 3LQHA 1WE9A 4S3OB 2K4DA 2MNZA 3LQJA 3ZPVE 3HTKC 3KNVA 2H0DB 2KIZA 2LXHC 3LRQA 1F62A 4V3LC 4LADB 4YC9A 1FBVA 2YSJA 1WFKA 1JM7B 5FB1A 3VK6A 2KGIA 5B76A 4NN2A 2KR4A 1HYIA 1Z2QA 4YABA 2PUYA 3O36A 5AITA 1MM2A 2DX8A 5B75A 4IC3A 3DQVR 1JOCA 4FIPA 2PNXA 4L58A 3U5NA 2M85A 2G6QA 3M62A 4B7YC 3ZTGA 2XB1A 4FO9A 4YATA 4YADA 2CT2A 5LKZA 4TKPB
chains in the Genus database with same CATH superfamily
1T6AA 3BCCE 1M1JA 2WVRA 1NVOA 5M1BA 2C0WA 5J3XA 1HGVA 5TABA 4QMAA 4FK5A 2M5AB 4Y99C 2Y43A 2H8PD 4ASVA 3CI9A 2HPCA 4C7NA 1XTGB 1LTGC 4GNFA 3KV5A 2I8DA 2LGGA 1OVVA 1FZCA 3GMAA 2L5GB 2JWDA 3L75G 5FEYA 2O01J 2ZT9B 1S5LH 2IZ1A 1Z56A 4S3OC 4LKAA 3ZVZB 1WEUA 3GHGA 3C6WA 2NPSB 1GDTA 1QVGO 5C13A 3A2AA 3TGUG 1KB9E 4IC2A 2CRRA 3HD7B 4I7DA 1JO5A 3I2DA 2M1RA 1K04A 4WZ3B 4OGQB 4HYTB 2W6JH 1HH0A 2MJZA 4U3FG 1MM3A 1SQPD 2HG5D 3N9OA 1BGYJ 4XA4A 2XOCA 2RI7A 4L76A 1N7LA 1DEEG 4BWNA 1OX3A 1Z6UA 2VRSA 2YO3A 1JMBA 1KORA 2M13A 3LIDA 4A7PA 1NTZJ 5CCHD 1QGKB 3S9OA 3A3YB 3VP8A 1J1DB 5AVQB 4A4BA 1EXIA 4I7BA 2OGUA 3CX5D 1SQVD 3F5HA 4PPEA 2F6NA 2HYED 1QX8A 1IFMA 2MT5A 3L4FA 2SPZA 5KH9A 3AE7C 5EFWB 2QA4P 2L43A 1VD4A 4O64A 4N3YB 3O6QA 3SWKA 1FDOA 1USEA 2YHNA 1L0LG 2YMKA 1OZHA 3AE1C 3GL6A 4A4CA 2P2UA 1AJYA 2V7QH 2CKLA 2Q5UA 4D6TG 4H13B 1JMMA 3H1JD 1SVFA 2J59M 4YBTA 3L73J 1TU3F 3L71G 5E79H 3DWDA 2HODA 1VQ9P 3QH9A 2WMMA 2H0DA 2NPSC 1QEXA 2E74B 3FWNA 3TF5A 1VL2A 2R5BA 3FXDA 4ZNCA 5KAFH 4BHWA 3H1ID 1JM7A 1CI6A 4RESB 4OGQC 1L0NG 1S4XA 3AECC 1OXZA 2AXCA 2J5UA 3CL3D 4CA1A 3RL0D 1OVUA 3AE4C 1PIXA 4I7ZC 4AUWA 2LXPC 5TDWA 1VF5D 3SHBA 3H7HA 5KH3A 2NZ2A 1XWHA 1ZOYC 1SQXG 1L0LK 3Q1MA 2E5YA 1HWTC 5KJ7A 4Q6FA 3D70A 3H25A 2HFED 1HBWA 1KILE 2VJEB 3KYQA 3OW2O 5JG6A 1H0TA 2FUUA 4BBQA 1AA0A 5TBNA 2A06D 5EYAF 2JMIA 2GA1A 2IFNA 5AVRB 2JRJA 3TDKA 2YT5A 2GM4A 1K9MQ 5AVTB 2IYPA 3GW6A 4HKZH 5FB0A 4NPFX 4AP4A 1M90Q 4N6JA 3WU2H 4PD4I 4H13C 1ZW0A 2LDRA 3FJUB 3SFDC 1IJDB 1ZRTE 5KLVJ 3A0BH 1JM0A 3EQ2A 2QM8A 1Q90D 2G8YA 3HE4B 2KLUA 2EA6A 3JC22 3M9HA 1L4AD 1KD1Q 1NAFA 1NTKE 4BXLA 1YHQP 2QJYB 2UWJE 4QF3A 3II6A 1LDJB 1YTZT 1LTJB 2NRGA 1VQPP 2VPDA 1N7SA 4GT1A 1IFDA 2ECIA 1EZVE 3LW5J 2K9JB 3RK3D 2KLVA 1KILA 2YW8A 3B5NA 1X9VA 3AE8C 4M3LA 1OW6A 2FD4A 5APYA 2J58A 1Q82Q 1W2EA 3RBZA 1V87A 3H1LJ 1JY2O 1GL2C 4GNEA 3L70G 3N7NA 2WT7A 2FY8A 2BEZF 1EC5A 1FS0E 3S4RA 3BCCD 1EZVI 1OWAA 2HYNA 2ZT9D 3V5BA 1DH3A 4A0CD 1NTKK 2YXRB 3HTKB 1NU1G 2KI7B 3HD7D 3O33A 3VMZA 4WZ0A 1VDFA 1X0TA 1NH4A 2E43A 5BU8B 4LC1A 1RF0C 1FOSE 4ZMDA 2EXUA 2E42A 2Q6QA 2VJFA 4LJNA 1M57D 1U7MA 3NXSA 3IFMA 3P7KA 1FJPA 2DW3A 1T2KC 2HDPA 2JP3A 4OWFA 1KB9D 2WPVB 1PGPA 2YXQB 3HUSC 1RMDA 1WMKA 4OGEA 1KQFB 2AXTH 3B8EB 5H2FH 3NG2A 2QJPC 2QJYC 4IL6X 1SQPJ 2ZYAA 3IAOA 3KXDA 3E1RA 5KTBA 1SFCA 1EDIA 1LTJC 3S1KA 1FAVA 5B66H 2EODA 3O34A 4R7EA 1NU1K 5KLIB 2JUNA 1LGHB 4TT3H 2E61A 2RMZA 5D1KB 2BCCJ 2KZJA 2IPPA 1U7JA 2KXPB 2KS1A 4PV1D 2B89A 4X3GA 1M56D 4GOFA 4KJMA 5BU5A 1JY2P 3PP5A 3ZYQA 1SQVJ 4MN4C 1GZLA 3G9RA 5AW6B 5FERA 2BCCE 3D6YA 3F89A 1G25A 1BE3J 1FJKA 3MZWB 2D8SA 2F42A 3H32A 3HTKC 1OW7A 1S5LX 2E74D 3CX5E 1SQVE 3P8MC 4LADB 4L73A 1BE3E 3FANA 2R44A 1LT1A 1L2PA 3A7OA 5B76A 4YTPC 3BASA 4B86A 2OYOA 1QLED 1IK9A 2P10A 3O36A 1ZV8A 2AEMA 1W5CE 1NKNA 1IFJA 5AW2B 1H88A 2DX8A 1UIXA 2XZRA 2WSCJ 3T9KA 2POHA 4IC3A 3DQVR 3M9QA 3C8VA 2M85A 3CXHI 2XB1A 2N1TB 4YADA 5SVIA 5LKZA 5CCGC 3VTPC 1K8AQ 1EDJA 1RE4A 3T97B 5KLIC 3LQIA 4LGDE 5CCHA 1RE3C 5H1VA 2G45A 4N4FA 1BCCG 1KB9H 1FBMA 1PGOA 2PFXA 3L74G 1KILD 1LTBC 4PD4D 2KNCA 1OW8A 4YBSA 2I50A 2E75D 2W83C 2YKOA 2O01H 3L72G 2CSYA 2WSEJ 1G1IA 4F52B 4GNGA 1NTMG 3U5OA 2WWWA 3H1KG 1LWUB 2MD8C 1IO4A 1LWUC 1LT9A 1U57A 2CONA 1DIPA 5L8RJ 4WA6A 1NAYA 1M7LA 5G05B 2YHOA 4Y99B 1ZRTD 4QF2A 3BATA 1S9KD 1LP1A 3N4XA 3CC7P 1NTKD 2L0BA 3R2PA 4R8PK 2P57A 2L7PA 3HE5A 3JCUH 1EZVD 2P7JA 1FDIA 2IYOA 1NTMK 5SVXA 1E4UA 3KQIA 4AQRD 1A02J 3B4SA 1URQB 3KPEA 3ZDMA 3AE5C 2OTKE 3MTUE 1S72P 3RBXA 5LKTA 3A0HE 3M63A 1FZAA 1WIMA 4W7YA 3BCCJ 2FFDA 3N9LA 1N73A 4JYBA 3V2PA 4R2YA 5D1MB 5TISE 2Q1KA 1QL2A 4Z1MH 2JO1A 1GK4A 2GUSA 5AVWB 3TNUB 4C7RA 1NHLA 2QVAA 2D2CB 5GTIH 1SQBG 4JF7A 1PL5A 4OVNF 4WY4C 1PP9G 4RJTA 4RKUJ 3TGUJ 5AW4B 2LGLA 1L4AA 3CCVP 3L75E 1AV1A 4U3FJ 3AE2C 1WILA 4NPDA 3TGUE 3RK2D 1KYOI 5GTHE 1URQC 2B87A 3Q2YA 2Y1MA 1KFMA 4U3FE 2M5AA 3W67A 1IFIA 2OTLP 3FWLA 2ECJA 5LKXA 1BDDA 3OAKA 4H0LC 3BRVB 4I7ZB 4K3AA 2BCCD 1X4IA 1ZP0C 1PZQA 2FYNC 1PFIA 2OARA 3EB5A 1YI2P 4ASWA 3MUDA 1G2CB 1M1KQ 2FUIA 3PTZA 1BGYG 1WEWA 3HD7A 3B71A 1WEQA 1BE3D 2CSZA 1FZCC 2ZYDA 1WENA 1L0LJ 5B77A 2D2CC 1NTZG 3LW5H 1VQ7P 5AW5B 3BVHA 2N1TD 4D6TJ 2R5DA 2OWAA 1VPCA 2O1KA 2M3HA 2XEUA 4H44C 3SUBA 1VYXA 3I5CA 5AW9B 3N9NA 1L0LE 5B5EE 3AE6C 3RK3C 3O35A 4I2LC 4UB8E 2EGMA 4YAXA 3IR9A 5APUA 4D6TE 1EQ7A 2JMDA 3L71E 2QICA 1Y9BA 2JKVA 2FSAA 3G71P 3C9IA 4XI1A 1QVFO 1OIPA 3P8CE 2IBZG 3H1HG 2RSDA 1L0NE 1SLQA 4NPEA 2QIWA 1S3JA 3L36A 5AVYB 1RHZB 4EIJA 1JCCA 2QEXP 1J2JB 3L73G 1CSBA 1P84E 2LGKA 4PJ0E 3PURA 3PHDA 3GG2A 2M3BA 1SQXE 2A45H 4I1LA 1GL2B 1WEPA 1Z60A 2KWKA 3V43A 3CCJP 4GIFA 3NFQA 4PD4E 2ECGA 2Y9ZA 2K9YA 4XE5B 3GF3A 1P84I 3WUUA 4RO0A 4K35A 4ZUXU 1WGMA 3PLWA 3VMXA 1PV3A 1YJ9P 5KKZC 1GU5A 3CWBG 1L0NK 5AW8B 1X8YA 3U1AA 1X4JA 4A49A 3ZPV1 3KZIH 1VQ4P 1ZN5A 1YTZI 2C2VS 2KZIA 2KWOA 1NTKJ 4W4UA 2YIUB 2AN6A 1LTIC 5AVVB 3CX5H 3M91A 3PH0A 3E1IA 1S9KE 1SQXK 1X79B 2VJEA 1AQTA 1PPJG 1RH5B 3HUSB 3B5NB 2QJKC 2RN0A 1DVPA 3WUTA 1W2BO 2E5TA 3EWKA 1WE9A 2QJPB 2MNZA 5KJ7C 3LQJA 2LXCB 2CPBA 3KNVA 2OYIB 3V2RA 2KIZA 2WT7B 1XTCC 2QSIA 2LXHC 1FBVA 5KLVG 5FB1A 5APXA 2E76B 2K37A 3EFGA 3PRJA 4UB6E 3CCSP 1HF9A 4NN2A 1HYIA 2OTJP 1Z2QA 1JEKA 5AW0B 3UIAA 2ITAA 1DX7A 3HE4A 1GMJA 5B75A 3L70E 1NU1J 3G4SP 1YQ3C 3E2DA 1JOCA 2V7QJ 3ABVC 4L58A 1IC2A 1Y8AA 2NPSD 1DEBA 1NYHA 3CCRP 4YATA 3AEFC 1NU1E 5TJHA 2K9JA 4OGQD 2Q9IA 5AVZB 3H1LG 3VN0A 5B8DA 4I7CA 5DINA 3L75D 3GLMA 4DZOA 5H1UA 1SFCB 2YIUC 1CZQA 3MIWA 3CCMP 4GKGA 1N7SC 2KB7P 4OGCA 5APVA 1MV8A 2WTYA 2JMJA 2WSEH 2ZETC 1MFZA 3TGUD 3PJSK 4Z0OA 3R4YA 1MBMA 3B5NC 3RTRB 2M6MA 1JY2N 1VQ5P 2MKVA 4U3FD 1FU1A 3HTKA 3GV4A 1KTMA 2ECWA 2OYIC 2EGPA 3ASLA 1LTAC 4I6MC 4DCKA 2KWNA 4IFMA 1JNMA 2A45G 2ZXXA 2IDAA 2C0XA 2E76C 2E6RA 1VQ6P 1SS1A 3SWYA 4L7XA 2KKYA 3FAOA 2MA6A 2R32A 1H89A 1SQPG 3DPLR 2Y9YA 4H13D 1GU4A 2PRRA 2FYUG 2K16A 3P32A 5B78A 4GDOA 4LLHA 2FFWA 1BSNA 5AW1B 1WEMA 2Z5HA 1GW3A 2QIZA 3AEGC 1L0LD 1QL1A 3MHSA 2W6AA 2Q3IA 5K5GB 3EB6A 4WVZA 3Q5RA 4C9ZA 3CXHE 4D6TD 4DOJA 3M0DC 3RPGB 1FZEA 1HTLC 1SFCC 3OJAB 5TISH 3L71D 4DJGA 1GTWA 1MKMA 4JPZB 1RF1B 1X4UA 3KHUA 4CCGX 2JJLA 4GOEA 2LQ6A 1RY3A 4AYCB 3P8CD 4LLBA 1GL2D 1L0ND 2L91A 2YVRA 2KIKA 2G43A 3LDYA 2FYUK 3W68A 4N78E 2KNCB 1GW4A 1KC8Q 2Z5IA 1P84D 1T1HA 3H1JG 4JQ0D 1BCCJ 3VYIA 1FP0A 1SQXD 1VFYA 3L72J 2B88A 3FL2A 3MHVA 2H7HA 3H1IG 1BCCE 4FJCA 1NTMJ 3L74E 2XDJA 2L5UA 3Q5PA 3H1KJ 2LR2A 1X22A 4XFJA 1T2KD 3AEAC 2JM3A 3O37A 3USSA 3L72E 5H9MA 3N9MA 2IX7C 1IFNA 1RQUA 1JY3O 1Q2NA 1NTME 3H6PA 2XKMA 4DT0A 1FOSF 2N1TA 2LGVA 3H1KE 2CSVA 4IFDK 1BORA 1JTHB 2ECTA 4IOIH 3AE9C 3T97A 5I3LA 1HYJA 3RPGC 5KAIE 3AEBC 2Q3EA 1AFOA 2A06G 4WY4B 3TSIA 3JSVC 2K88A 3L1ZB 1RF1C 3RL0B 2OYHA 1RE4C 1J1EB 1Q7YQ 3O47A 1VF5B 3SFEC 3U59A 5CCHC 2IQJA 1EDKA 4W7ZA 3VOPA 2XNDH 1LWUA 2PAJA 1SQQG 2LV9A 4UB8H 2XU6A 1R5SA 2B9BA 2RH0A 3QZVA 3M0AA 4GB0A 2QG4A 2LAUA 4H0LB 3V4QA 3E7KA 4BRYB 4EYYQ 2FXPA 2OQQA 3L70D 1M1JB 2FYNB 2C9LY 4V3KC 3LIEA 1ZR2A 2YO2A 1VQNP 1HVVA 2HPCB 4U7JA 1N8RQ 2N9BA 4C7NB 3LVQE 4N3WA 1NU1D 5TRBA 2YKQA 1FZCB 2AEFA 4AUQB 1WEOA 1VQMP 4TLFA 2BASA 2JWAA 1URQA 3LVRE 1FC2C 3I56P 3IHPA 1SQQK 3WMM0 3GHGB 3HRNA 1KQGB 1LTTC 2W8ZA 5CCGD 3L75J 1LNQA 3BCCG 4H44B 4L75A 3IF4A 4PD4H 2AEJA 3KV6A 1KYOE 3TYYA 1KFNA 1SQBE 3PUQA 3VMYA 3RK3B 3RL0C 1J1EC 2B87B 1PP9E 1VF5C 2N9YB 2E6SA 1G1JA 2WSFJ 4UP0A 4YXDC 3L1XA 4WZ2A 1D7MA 3BRTB 1VQOP 3TNUA 1WEVA 2L75A 3CCLP 3O7AA 5CJ4A 3L11A 2YQLA 2FFDC 2ZJSE 1PGJA 1N86A 5APQA 2IDBA 2K3RA 1N73C 3NTNA 2XV5A 5KH7A 4WB4A 1E79H 2M0BA 1KN7A 3GF7A 1M1JC 3M06A 5APSA 1SQBK 4C46A 2RR4A 3PHLA 1IZNB 2R3SA 2FYUD 3O6QB 3HCSA 4ZDTA 1HUCA 2WITA 5DKAA 2NPSA 5TDRA 3VMAA 2KU3A 1BSHA 1KB9I 4JYCA 2CKLB 3O8ZA 1BGYE 2D8UA 2WPQA 2JEEA 1L4AC 3CXHD 3EFFK 4UB6H 3ZPVE 2HODB 5KKZB 2Y0CA 3GHGC 2H0DB 1FZGA 3VP9A 2FBWC 1NTZE 3LRQA 1F62A 3MP7B 4F1PA 4YC9A 3L71J 4HH2A 1JM7B 1CI6B 1LTSC 3FXEA 5APTA 2QRXA 3ITKA 2KGIA 4IFFA 1H8AA 3WUVA 3KQGA 1G2CA 3JCUE 1L0NJ 4N78D 2PUYA 1KZUB 4PV1B 1KV4A 1DCQA 5AITA 3H1HJ 2QJKB 3FM8C 1MM2A 2HR3A 2KSEA 1AQ5A 2I1KA 4FIPA 2ZT9C 2PNXA 2H88C 3MUDC 2G6QA 1S1CX 4B7YC 2IBZE 3H1HE 1SQXJ 1A02F 1BCCD 1H0TB 3HD7C 2WZ7A 1LJ2A 3L74D 3U1CA 1Q81Q 2ZVOB 1VQKP 1NTZK 3N9PA 2GUVA 3M7KA 1YJWP 5CBNA 1OMIA 3L73E 2M8RA 4IL6E 2L80A 2WPSA 3L72D 1USDA 4Y28J 5CMZA 1OFCX 4MSXA 5BVZA 1K73Q 1NTMD 4WY4D 3MHHA 3SOUA 2VPEA 1NGMB 2Z4EA 5DJTB 3H1KD 2IBZI 1AVOA 3KDPB 3SWFA 2KOGA 4GNDA 4UI9B 5D1LB 3CWBJ 5K3QA 3CCEP 1U6GB 2YU4A 1WESA 1J1DC 2MKEA 2XOYA 3KDEC 5C11A 5GTIE 1YIJP 1Y47A 1OVRA 3CWBE 4CPGA 1URQD 2HLOA 4L74A 2KGGA 3M99A 1S5LE 2FXOA 4H0LD 2YURA 1N7SB 2G3AA 2RKLA 4OH8B 3A5TA 1GL2A 1WT6A 5G04B 1KQSO 2ZFCA 1CHCA 2C2LA 4PV1C 2JDIH 4EI2A 3T6RA 2KP8A 1KILB 4P5OB 1K2FA 1SQQD 2E75B 2Y0DA 1PPJE 2H89C 4ZQLA 3CXHH 3FGAD 5CBOA 2KYUA 2JR8A 1NTKG 2E74C 1RF0A 2NAAA 3QWOC 1JB0J 3CLQA 3V6IA 2VNFA 2D2CD 2KYVA 3L70J 5KLVE 1R8EA 5AW7B 1EZVG 4EDFA 4H44D 5G0FA 3G6EP 2Y1NA 3FX0A 2WSCH 3O70A 2KE1A 2LRIC 1R5LA 1FZBA 1SP4A 1NJIQ 2MA5A 2VJFB 3HUSA 4MVTA 1MUUA 2P58A 2MIQA 5AIUA 3SOWA 3MD0A 2QM7A 1ZXGA 1LTJA 2OYIA 1KYOD 1SQBD 4YXWH 4W80A 3LJUX 1PP9D 2ECNA 3H1LE 1N2DC 3MGNA 5KLVK 1NO4A 1E5WA 2VPGA 4WWIA 2R3CA 4JBZA 5E79E 2YUCA 2IFMA 2Q7CA 3M9BA 3RGUA 2YNYA 1KILC 5KAFE 2VP7A 3NMDA 2UZGA 2DJAA 3U5MA 2E75C 2PGDA 1VQ8P 5CJ0A 3N9QA 3CMAP 1UIIA 5KAIH 2KS1B 2PP6A 2H43A 2ZYGA 1S2EA 1NWQA 2K17A 1ZR4A 2ECVA 4H9DA 2B0OE 3H32B 2Y0EA 5H1TA 2CRWA 3M0DA 2FYUJ 3U5PA 3K5BA 2BEQD 3ZNIA 2YMYA 4EOTA 2KK7A 1IFPA 3CD6P 1IYMA 1YQ4C 3Q5SA 4UP5A 1BGYD 5B79A 1NOHA 1SQPE 2FYUE 2IZ0A 1CW5A 3T7LA 1EXJA 4YPCA 3CCUP 3A0HH 2BCCG 1NTZD 4LK9A 2ZAEB 1LDKC 1AVYA 5CCGA 2A45I 2WPRA 1EDLA 2KWJA 1Q86Q 3KZIE 2VPBA 3WU2E 5KJ7D 3RK2B 4HB1A 3V2NA 3L35A 2QE7H 1RE3A 4PTBA 1NKZB 1SQVG 2KFTA 3A0BE 1BE3G 2FXMA 2MUMA 5AVSB 5SVIB 4O9BA 2W6BA 1FDMA 1JUNA 1ZLLA 5C39A 2P67A 1N87A 4R4LA 2KKXA 3IN6A 3H1JJ 1SQPK 4ZKPA 2YQMA 5SVYA 1HJBA 2IBZD 3H1HD 1DD4A 1KYOH 5DJUB 1GK6A 2KSJA 2WSSH 1FZFA 1JCDA 3CX5I 1RQVA 3L73D 2ZVNB 3L74J 3H1JE 1PGQA 3H1IJ 2YREA 3G3ZA 3SOXA 2M3EA 2DSMA 3HCTA 2K1JA 3I55P 2XP0A 1BDCA 4GODA 2WQYC 1ZBDB 4QQ4A 1WRGA 1LT9B 1DD3A 1RF1A 3Q1DA 1SQVK 1VQLP 3V2QA 1MZ9A 2WSFH 3H1IE 5GTHH 4AYCA 4B86C 1N7SD 2MD7B 2BAYA 2O1JA 5AVXB 3Q3DA 1LP1B 3CMEP 2LKMA 1T8ZA 3ZVYA 3B5ND 2LN0A 2V4HA 3CWBD 2OYHB 3AE3C 3OA7A 1HGZA 3HCUA 1MFTA 5AVUB 2K1AA 3TK1A 2KREA 3RK2C 3HE5B 2ZXEB 1FE6A 2YSMA 2YYRA 2QJ0A 1YITP 4YBMA 2F6JA 1WEEA 4AVXA 3PLNA 2XOZA 2E76D 1PPJD 1T3UA 2A06E 3V4WA 3CC4P 2MNYA 4WBAA 2OXQC 5LCWB 2AXTE 1HJ0A 1M8OB 1SQQJ 1YJNP 2LXBA 5H2FE 5LKUA 2I1JA 2YKPA 3D6ZA 3CCQP 5B66E 4HJGH 3JUEA 3L37A 4R4MA 5B5EH 5APWA 3AEEC 2W90A 4ZKUA 1JTHA 3C5KA 1SQQE 5KLVD 1ZMEC 3LQHA 2P1JA 2FFDB 4S3OB 2K4DA 1JY3N 1N73B 2O3JA 2C9NY 2FKWB 4V3LC 2N1TC 2YSJA 4Z0RA 1WFKA 1LT9C 4WY4A 1T3JA 3VK6A 5CHXA 2CK3H 1SFCD 2KUBA 1GD2E 4O62A 1YBKA 3DDTA 2KR4A 1KMIZ 4YABA 1KQLA 3FEHA 2FYZA 2CPSA 3SSUA 2XNXA 1P84H 1JY3P 2O01N 3RK3E 4PJ0H 1K05A 2OYHC 3MDBC 2W27A 1SQBJ 3D71A 4IL6H 1L4AB 4KHXA 3H1LD 3RL0g 4KT0J 3U5NA 1PP9J 3CC2P 3AEDC 3C1LA 3M62A 1IK7A 3ZTGA 5AW3B 1YYCA 4FO9A 2CT2A 4BRYA 3CPWO 4TKPB
chains in the Genus database with same CATH topology
2Q9IA 5AVZB 3U1CA 3N9PA 1NTZK 1M1JA 2GUVA 1RE4A 3VN0A 5B8DA 3LQIA 2C0WA 4LGDE 2M8RA 5J3XA 1HGVA 5CCHA 4I7CA 5TABA 2L80A 4FK5A 1RE3C 2WPSA 5DINA 5H1UA 4Y99C 4DZOA 2H8PD 2Y43A 4MSXA 5CMZA 5H1VA 2G45A 1SFCB 4N4FA 5BVZA 1CZQA 3CI9A 3MIWA 2HPCA 4GKGA 1FBMA 1N7SC 4C7NA 1XTGB 1LTGC 2KB7P 1KILD 4WY4D 5APVA 3MHHA 2VPEA 1LTBC 1MV8A 3KV5A 4GNFA 2WTYA 2Z4EA 2LGGA 2I50A 4YBSA 2JMJA 2WSEH 2ZETC 1MFZA 2YKOA 3KDPB 2O01H 1FZCA 3SWFA 3B5NC 2KOGA 2L5GB 3RTRB 4GNDA 4UI9B 5D1LB 2M6MA 2CSYA 5FEYA 1JY2N 1G1IA 1U6GB 2YU4A 1WESA 1Z56A 4F52B 4S3OC 1J1DC 1FU1A 4LKAA 4GNGA 3HTKA 3ZVZB 5C11A 3GV4A 3U5OA 1WEUA 3GHGA 2WWWA 2ECWA 3C6WA 2NPSB 1GDTA 2OYIC 5C13A 3A2AA 4IC2A 2EGPA 1LWUB 3ASLA 2MD8C 3HD7B 1IO4A 4I7DA 1JO5A 1LTAC 3I2DA 1LT9A 2M1RA 1URQD 4I6MC 2HLOA 2KWNA 4WZ3B 4HYTB 2KGGA 1HH0A 2MJZA 4WA6A 1MM3A 1M7LA 2HG5D 4IFMA 3N9OA 1JNMA 2YHOA 5G05B 4Y99B 2A45G 4XA4A 2IDAA 2C0XA 3M99A 2RI7A 4QF2A 2E6RA 1N7LA 3BATA 2YURA 1Z6UA 1N7SB 3A5TA 4OH8B 3SWYA 4L7XA 1GL2A 1WT6A 1S9KD 5G04B 2VRSA 2MA6A 2R32A 2ZFCA 1CHCA 2C2LA 3T6RA 2YO3A 1H89A 3N4XA 2KP8A 3LIDA 1KILB 4P5OB 3DPLR 1K2FA 5CCHD 1GU4A 2L0BA 3R2PA 2K16A 3A3YB 4R8PK 3P32A 3VP8A 5B78A 4ZQLA 1J1DB 5AVQB 4A4BA 4LLHA 4I7BA 3HE5A 5AW1B 1WEMA 2KYUA 2Z5HA 2P7JA 1GW3A 2QIZA 4PPEA 2F6NA 2HYED 1IFMA 2MT5A 1RF0A 1NTMK 3L4FA 2NAAA 1QL1A 5KH9A 1E4UA 3MHSA 3KQIA 3CLQA 2VNFA 2W6AA 4AQRD 2Q3IA 2KYVA 1A02J 3EB6A 1URQB 2L43A 1VD4A 4O64A 4N3YB 3KPEA 4C9ZA 5AW7B 4DOJA 3M0DC 3RPGB 2YHNA 1FZEA 1HTLC 5G0FA 1SFCC 3MTUE 3OJAB 2Y1NA 5LKTA 1GTWA 2WSCH 3PUQA 3O70A 1RF1B 2KE1A 3GL6A 2LRIC 4A4CA 1FZBA 2P2UA 1SP4A 1X4UA 2MA5A 3M63A 2VJFB 3HUSA 1FZAA 1WIMA 2CKLA 2JJLA 2Q5UA 4MVTA 4CCGX 4W7YA 1MUUA 1JMMA 2LQ6A 1RY3A 2MIQA 1SVFA 2J59M 3P8CD 4LLBA 5AIUA 2FFDA 4AYCB 4YBTA 3SOWA 1GL2D 3MD0A 2QM7A 3N9LA 1N73A 4JYBA 3V2PA 2G43A 2HODA 2FYUK 1LTJA 2OYIA 4R2YA 4N78E 2H0DA 2NPSC 5D1MB 1GW4A 1QL2A 2Z5IA 1GK4A 2GUSA 2R5BA 1T1HA 5AVWB 4BHWA 3TNUB 4C7RA 1JM7A 1CI6A 4RESB 2E43A 4W80A 3VYIA 1NHLA 2ECNA 1OXZA 2WZ7A 1N2DC 1FP0A 3MGNA 5KLVK 1NO4A 1E5WA 2VPGA 2R3CA 1VFYA 2YUCA 2IFMA 3CL3D 3FL2A 4CA1A 2H7HA 3RL0D 4JF7A 4FJCA 2Q7CA 3M9BA 4AUWA 2LXPC 2YNYA 1KILC 4WY4C 5TDWA 2XDJA 2VP7A 2L5UA 3SHBA 5KH3A 3NMDA 2UZGA 1XWHA 3U5MA 5AW4B 2LGLA 1L0LK 1L4AA 1T2KD 5CJ0A 3N9QA 3O37A 1HWTC 5KJ7A 4Q6FA 5H9MA 3N9MA 2IX7C 1IFNA 2PP6A 2HFED 1JY3O 2H43A 1HBWA 1WILA 3H6PA 2VJEB 2XKMA 3KYQA 1FOSF 2N1TA 5JG6A 1NWQA 2FUUA 2K17A 2LGVA 4BBQA 4IFDK 1BORA 1ZR4A 2ECVA 5TBNA 3RK2D 1JTHB 2ECTA 3T97A 5EYAF 2JMIA 3H32B 5I3LA 2IFNA 5AVRB 2JRJA 5H1TA 1URQC 2YT5A 3M0DA 2Y1MA 1HYJA 2GM4A 1KFMA 1IFIA 3RPGC 2ECJA 5AVTB 5LKXA 3U5PA 1AFOA 5FB0A 3OAKA 3ZNIA 2YMYA 3BRVB 4EOTA 4AP4A 4WY4B 3TSIA 3L1ZB 1RF1C 3RL0B 2OYHA 1X4IA 1IYMA 4UP5A 4N6JA 1RE4C 1J1EB 5B79A 1NOHA 3U59A 1PFIA 2OARA 3EB5A 2LDRA 5CCHC 1IJDB 1CW5A 4W7ZA 3VOPA 3MUDA 1G2CB 3EQ2A 3T7LA 2QM8A 2FUIA 4LK9A 3HE4B 1LWUA 1LDKC 2PAJA 5CCGA 2A45I 1WEWA 3HD7A 2WPRA 2EA6A 1WEQA 2KWJA 2CSZA 3M9HA 1L4AD 1FZCC 1NAFA 2LV9A 2VPBA 2XU6A 5KJ7D 1WENA 3RK2B 3V2NA 5B77A 3L35A 1RE3A 3QZVA 3M0AA 4GB0A 4QF3A 3II6A 1LDJB 4PTBA 1NKZB 2KFTA 1YTZT 3LW5H 1LTJB 5AW5B 3BVHA 2VPDA 2N1TD 2R5DA 1N7SA 4GT1A 1IFDA 1VPCA 2FXMA 2O1KA 2ECIA 2M3HA 3V4QA 5AVSB 2MUMA 4O9BA 2XEUA 2W6BA 3RK3D 1FDMA 1JUNA 2KLVA 1VYXA 1ZLLA 1M1JB 1KILA 3I5CA 5AW9B 2YW8A 3N9NA 3B5NA 1X9VA 3RK3C 2P67A 1N87A 2C9LY 3O35A 4I2LC 4M3LA 4V3KC 3LIEA 4YAXA 3IR9A 2J58A 5APYA 5APUA 1ZR2A 2YO2A 1W2EA 1V87A 1EQ7A 1SQPK 4ZKPA 2YQMA 1HVVA 2HPCB 1JY2O 1HJBA 2N9BA 4C7NB 1GL2C 4GNEA 2JMDA 3N7NA 2WT7A 4N3WA 2QICA 5TRBA 1GK6A 2KSJA 2YKQA 1FZFA 1FZCB 1JCDA 4AUQB 1OWAA 2FSAA 1WEOA 3C9IA 2HYNA 4XI1A 3V5BA 2BASA 1DH3A 1URQA 3IHPA 3P8CE 1NTKK 2YREA 4A0CD 3G3ZA 1SQQK 3SOXA 3HTKB 3WMM0 2RSDA 3HCTA 3GHGB 3HRNA 2K1JA 1SLQA 1LTTC 5CCGD 3HD7D 3L36A 3O33A 5AVYB 4EIJA 1JCCA 3VMZA 4WZ0A 1ZBDB 3KV6A 3TYYA 1WRGA 1J2JB 1LT9B 1KFNA 1VDFA 1CSBA 1RF1A 1NH4A 1SQVK 5BU8B 4LC1A 1RF0C 3V2QA 3RK3B 1MZ9A 3VMYA 1FOSE 2LGKA 3RL0C 2E42A 2VJFA 2WSFH 3PURA 4LJNA 1J1EC 3NXSA 3PHDA 4AYCA 3IFMA 2E6SA 1G1JA 3P7KA 1FJPA 1N7SD 4UP0A 4B86C 2MD7B 2M3BA 2BAYA 2A45H 2O1JA 4I1LA 1T2KC 5AVXB 1GL2B 1WEPA 1Z60A 2HDPA 3L1XA 2KWKA 4WZ2A 3V43A 2LKMA 4GIFA 1T8ZA 3ZVYA 3BRTB 3NFQA 3B5ND 2LN0A 2ECGA 2OYHB 5DKAA 3OA7A 3HUSC 1HGZA 3TNUA 4XE5B 1RMDA 1WEVA 2L75A 3HCUA 5AVUB 3O7AA 5CJ4A 3TK1A 3L11A 2KREA 2YQLA 4ZUXU 1WGMA 3RK2C 3VMXA 3B8EB 2FFDC 3NG2A 1N86A 5APQA 3HE5B 1N73C 2ZXEB 5KTBA 3NTNA 1SFCA 2YSMA 1GU5A 1LTJC 2XV5A 1L0NK 2QJ0A 2YYRA 5AW8B 5KH7A 4WB4A 1FAVA 1X8YA 3U1AA 1X4JA 4A49A 4YBMA 2EODA 3O34A 2F6JA 3ZPV1 4R7EA 1WEEA 1NU1K 1M1JC 4AVXA 1LGHB 3M06A 5APSA 5D1KB 1SQBK 1ZN5A 4C46A 1T3UA 1YTZI 3V4WA 2MNYA 4WBAA 2C2VS 2KWOA 2OXQC 5LCWB 3HCSA 4ZDTA 4W4UA 2AN6A 1HUCA 1LTIC 5AVVB 2IPPA 4X3GA 2WITA 3M91A 5BU5A 3E1IA 2NPSA 1S9KE 1JY2P 1SQXK 1X79B 2I1JA 2YKPA 3PP5A 5TDRA 5LKUA 2KU3A 2VJEA 3ZYQA 1GZLA 3HUSB 3B5NB 3L37A 4JYCA 5AW6B 5APWA 2CKLB 5FERA 1DVPA 3O8ZA 4ZKUA 1G25A 1JTHA 3C5KA 1FJKA 2WPQA 2D8SA 2P1JA 2FFDB 3H32A 1WE9A 2F42A 2JEEA 1L4AC 3LQHA 4S3OB 2K4DA 1JY3N 1N73B 2MNZA 5KJ7C 3LQJA 2HODB 3ZPVE 3HTKC 2CPBA 3KNVA 3GHGC 2OYIB 3V2RA 2H0DB 2KIZA 1FZGA 2WT7B 2C9NY 1XTCC 2FKWB 3VP9A 3P8MC 2LXHC 3LRQA 1F62A 4V3LC 2N1TC 4LADB 4YC9A 1FBVA 2YSJA 1WFKA 1LT9C 4HH2A 1T3JA 4WY4A 1CI6B 1LTSC 1JM7B 5FB1A 3VK6A 5APTA 5CHXA 3A7OA 5APXA 2KGIA 1SFCD 4IFFA 1H8AA 1GD2E 5B76A 4B86A 3BASA 3KQGA 3EFGA 1IK9A 4NN2A 2KR4A 1HYIA 1G2CA 1Z2QA 4N78D 2PUYA 4YABA 1KQLA 3O36A 1KZUB 1ZV8A 5AW0B 3UIAA 2FYZA 3SOUA 2CPSA 5AITA 2XNXA 1DX7A 3HE4A 1NKNA 1IFJA 1JY3P 5AW2B 1H88A 1MM2A 2XZRA 2DX8A 5B75A 2OYHC 1AQ5A 2W27A 2POHA 1L4AB 4IC3A 2I1KA 4KHXA 3DQVR 1JOCA 4FIPA 3M9QA 2PNXA 4L58A 1IC2A 2NPSD 3U5NA 1DEBA 2M85A 2G6QA 3M62A 4B7YC 3ZTGA 5AW3B 1YYCA 2XB1A 4FO9A 4YATA 2N1TB 1A02F 4YADA 2CT2A 5LKZA 1LWUC 5CCGC 3VTPC 3HD7C 4TKPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9P A;  5B8D A;  3LQI A;  5J3X A;  4I7C A;  5TAB A;  2L80 A;  4FK5 A;  5DIN A;  5H1U A;  2Y43 A;  4MSX A;  5H1V A;  2G45 A;  4N4F A;  3MHH A;  3SOU A;  2VPE A;  4GNF A;  3KV5 A;  2LGG A;  2I50 A;  4YBS A;  2JMJ A;  2ZET C;  2YKO A;  3RTR B;  4GND A;  4UI9 B;  5D1L B;  2M6M A;  2CSY A;  5FEY A;  1U6G B;  2YU4 A;  1WES A;  4F52 B;  4S3O C;  4LKA A;  4GNG A;  3ZVZ B;  5C11 A;  3GV4 A;  3U5O A;  1WEU A;  2ECW A;  3C6W A;  5C13 A;  4IC2 A;  2EGP A;  3ASL A;  2MD8 C;  4I7D A;  3I2D A;  2M1R A;  4WZ3 B;  2KWN A;  2KGG A;  4WA6 A;  1MM3 A;  3N9O A;  5G05 B;  2YHO A;  2IDA A;  3M99 A;  2RI7 A;  4QF2 A;  2E6R A;  2YUR A;  1Z6U A;  4L7X A;  5G04 B;  2MA6 A;  1CHC A;  2C2L A;  3T6R A;  4P5O B;  3DPL R;  1K2F A;  2L0B A;  2K16 A;  4R8P K;  5B78 A;  4ZQL A;  4A4B A;  4I7B A;  1WEM A;  2KYU A;  2QIZ A;  4PPE A;  2F6N A;  2HYE D;  2MT5 A;  3L4F A;  2NAA A;  5KH9 A;  1E4U A;  3MHS A;  3KQI A;  2VNF A;  3EB6 A;  2L43 A;  1VD4 A;  4O64 A;  4C9Z A;  3RPG B;  2YHN A;  5G0F A;  2Y1N A;  5LKT A;  3O70 A;  2KE1 A;  3GL6 A;  2LRI C;  4A4C A;  1X4U A;  2MA5 A;  3M63 A;  2VJF B;  1WIM A;  2CKL A;  4MVT A;  4CCG X;  2LQ6 A;  2MIQ A;  5AIU A;  4LLB A;  4AYC B;  4YBT A;  3SOW A;  3N9L A;  2G43 A;  4R2Y A;  2H0D A;  5D1M B;  1T1H A;  4BHW A;  1JM7 A;  2ECN A;  1FP0 A;  2VPG A;  1VFY A;  2YUC A;  3CL3 D;  3FL2 A;  4CA1 A;  4FJC A;  2LXP C;  5TDW A;  2VP7 A;  2L5U A;  3SHB A;  5KH3 A;  2UZG A;  1XWH A;  3U5M A;  2LGL A;  3N9Q A;  3O37 A;  4Q6F A;  5H9M A;  3N9M A;  1WIL A;  2VJE B;  5JG6 A;  2FUU A;  2K17 A;  2LGV A;  4BBQ A;  1BOR A;  2ECV A;  5TBN A;  2ECT A;  5EYA F;  2JMI A;  5I3L A;  2JRJ A;  5H1T A;  2YT5 A;  2Y1M A;  1HYJ A;  3RPG C;  2ECJ A;  5LKX A;  3U5P A;  5FB0 A;  3ZNI A;  3BRV B;  4AP4 A;  3L1Z B;  1X4I A;  1IYM A;  4UP5 A;  5B79 A;  3EB5 A;  2LDR A;  3EQ2 A;  3T7L A;  2FUI A;  4LK9 A;  1LDK C;  1WEW A;  2EA6 A;  1WEQ A;  2KWJ A;  2CSZ A;  2LV9 A;  2VPB A;  1WEN A;  5B77 A;  3QZV A;  4GB0 A;  4QF3 A;  1LDJ B;  4PTB A;  2KFT A;  2VPD A;  2ECI A;  2M3H A;  2MUM A;  2XEU A;  2W6B A;  1VYX A;  3N9N A;  2YW8 A;  1N87 A;  3O35 A;  4V3K C;  4YAX A;  1V87 A;  2YQM A;  4GNE A;  2JMD A;  4N3W A;  2QIC A;  5TRB A;  2YKQ A;  4AUQ B;  2FSA A;  1WEO A;  4XI1 A;  3IHP A;  4A0C D;  2YRE A;  3SOX A;  2RSD A;  3HCT A;  2K1J A;  3O33 A;  4WZ0 A;  1ZBD B;  3KV6 A;  3PUQ A;  2LGK A;  2VJF A;  3PUR A;  4LJN A;  3PHD A;  2E6S A;  4AYC A;  4B86 C;  4UP0 A;  2MD7 B;  2BAY A;  1WEP A;  1Z60 A;  2HDP A;  3L1X A;  2KWK A;  4WZ2 A;  3V43 A;  3ZVY A;  3BRT B;  2LN0 A;  2ECG A;  1WEV A;  1RMD A;  3HCU A;  2L75 A;  3O7A A;  3L11 A;  2KRE A;  2YQL A;  4ZUX U;  1WGM A;  3NG2 A;  2YSM A;  2YYR A;  2QJ0 A;  5KH7 A;  1X4J A;  4A49 A;  4YBM A;  2EOD A;  3O34 A;  2F6J A;  3ZPV 1;  4R7E A;  1WEE A;  4AVX A;  5D1K B;  2MNY A;  2C2V S;  2OXQ C;  2KWO A;  5LCW B;  3HCS A;  4ZDT A;  4W4U A;  2AN6 A;  4X3G A;  5DKA A;  5LKU A;  5TDR A;  2YKP A;  2KU3 A;  2VJE A;  3ZYQ A;  5FER A;  2CKL B;  1DVP A;  1G25 A;  3C5K A;  2D8S A;  2F42 A;  3LQH A;  1WE9 A;  4S3O B;  2K4D A;  2MNZ A;  3LQJ A;  3ZPV E;  3HTK C;  3KNV A;  2H0D B;  2KIZ A;  2LXH C;  3LRQ A;  1F62 A;  4V3L C;  4LAD B;  4YC9 A;  1FBV A;  2YSJ A;  1WFK A;  1JM7 B;  5FB1 A;  3VK6 A;  2KGI A;  5B76 A;  4NN2 A;  2KR4 A;  1HYI A;  1Z2Q A;  4YAB A;  2PUY A;  3O36 A;  5AIT A;  1MM2 A;  2DX8 A;  5B75 A;  4IC3 A;  3DQV R;  1JOC A;  4FIP A;  2PNX A;  4L58 A;  3U5N A;  2M85 A;  2G6Q A;  3M62 A;  4B7Y C;  3ZTG A;  2XB1 A;  4FO9 A;  4YAT A;  4YAD A;  2CT2 A;  5LKZ A;  4TKP B; 
#chains in the Genus database with same CATH topology
 1T6A A;  3BCC E;  1M1J A;  2WVR A;  1NVO A;  5M1B A;  2C0W A;  5J3X A;  1HGV A;  5TAB A;  4QMA A;  4FK5 A;  2M5A B;  4Y99 C;  2Y43 A;  2H8P D;  4ASV A;  3CI9 A;  2HPC A;  4C7N A;  1XTG B;  1LTG C;  4GNF A;  3KV5 A;  2I8D A;  2LGG A;  1OVV A;  1FZC A;  3GMA A;  2L5G B;  2JWD A;  3L75 G;  5FEY A;  2O01 J;  2ZT9 B;  1S5L H;  2IZ1 A;  1Z56 A;  4S3O C;  4LKA A;  3ZVZ B;  1WEU A;  3GHG A;  3C6W A;  2NPS B;  1GDT A;  1QVG O;  5C13 A;  3A2A A;  3TGU G;  1KB9 E;  4IC2 A;  2CRR A;  3HD7 B;  4I7D A;  1JO5 A;  3I2D A;  2M1R A;  1K04 A;  4WZ3 B;  4OGQ B;  4HYT B;  2W6J H;  1HH0 A;  2MJZ A;  4U3F G;  1MM3 A;  1SQP D;  2HG5 D;  3N9O A;  1BGY J;  4XA4 A;  2XOC A;  2RI7 A;  4L76 A;  1N7L A;  1DEE G;  4BWN A;  1OX3 A;  1Z6U A;  2VRS A;  2YO3 A;  1JMB A;  1KOR A;  2M13 A;  3LID A;  4A7P A;  1NTZ J;  5CCH D;  1QGK B;  3S9O A;  3A3Y B;  3VP8 A;  1J1D B;  5AVQ B;  4A4B A;  1EXI A;  4I7B A;  2OGU A;  3CX5 D;  1SQV D;  3F5H A;  4PPE A;  2F6N A;  2HYE D;  1QX8 A;  1IFM A;  2MT5 A;  3L4F A;  2SPZ A;  5KH9 A;  3AE7 C;  5EFW B;  2QA4 P;  2L43 A;  1VD4 A;  4O64 A;  4N3Y B;  3O6Q A;  3SWK A;  1FDO A;  1USE A;  2YHN A;  1L0L G;  2YMK A;  1OZH A;  3AE1 C;  3GL6 A;  4A4C A;  2P2U A;  1AJY A;  2V7Q H;  2CKL A;  2Q5U A;  4D6T G;  4H13 B;  1JMM A;  3H1J D;  1SVF A;  2J59 M;  4YBT A;  3L73 J;  1TU3 F;  3L71 G;  5E79 H;  3DWD A;  2HOD A;  1VQ9 P;  3QH9 A;  2WMM A;  2H0D A;  2NPS C;  1QEX A;  2E74 B;  3FWN A;  3TF5 A;  1VL2 A;  2R5B A;  3FXD A;  4ZNC A;  5KAF H;  4BHW A;  3H1I D;  1JM7 A;  1CI6 A;  4RES B;  4OGQ C;  1L0N G;  1S4X A;  3AEC C;  1OXZ A;  2AXC A;  2J5U A;  3CL3 D;  4CA1 A;  3RL0 D;  1OVU A;  3AE4 C;  1PIX A;  4I7Z C;  4AUW A;  2LXP C;  5TDW A;  1VF5 D;  3SHB A;  3H7H A;  5KH3 A;  2NZ2 A;  1XWH A;  1ZOY C;  1SQX G;  1L0L K;  3Q1M A;  2E5Y A;  1HWT C;  5KJ7 A;  4Q6F A;  3D70 A;  3H25 A;  2HFE D;  1HBW A;  1KIL E;  2VJE B;  3KYQ A;  3OW2 O;  5JG6 A;  1H0T A;  2FUU A;  4BBQ A;  1AA0 A;  5TBN A;  2A06 D;  5EYA F;  2JMI A;  2GA1 A;  2IFN A;  5AVR B;  2JRJ A;  3TDK A;  2YT5 A;  2GM4 A;  1K9M Q;  5AVT B;  2IYP A;  3GW6 A;  4HKZ H;  5FB0 A;  4NPF X;  4AP4 A;  1M90 Q;  4N6J A;  3WU2 H;  4PD4 I;  4H13 C;  1ZW0 A;  2LDR A;  3FJU B;  3SFD C;  1IJD B;  1ZRT E;  5KLV J;  3A0B H;  1JM0 A;  3EQ2 A;  2QM8 A;  1Q90 D;  2G8Y A;  3HE4 B;  2KLU A;  2EA6 A;  3JC2 2;  3M9H A;  1L4A D;  1KD1 Q;  1NAF A;  1NTK E;  4BXL A;  1YHQ P;  2QJY B;  2UWJ E;  4QF3 A;  3II6 A;  1LDJ B;  1YTZ T;  1LTJ B;  2NRG A;  1VQP P;  2VPD A;  1N7S A;  4GT1 A;  1IFD A;  2ECI A;  1EZV E;  3LW5 J;  2K9J B;  3RK3 D;  2KLV A;  1KIL A;  2YW8 A;  3B5N A;  1X9V A;  3AE8 C;  4M3L A;  1OW6 A;  2FD4 A;  5APY A;  2J58 A;  1Q82 Q;  1W2E A;  3RBZ A;  1V87 A;  3H1L J;  1JY2 O;  1GL2 C;  4GNE A;  3L70 G;  3N7N A;  2WT7 A;  2FY8 A;  2BEZ F;  1EC5 A;  1FS0 E;  3S4R A;  3BCC D;  1EZV I;  1OWA A;  2HYN A;  2ZT9 D;  3V5B A;  1DH3 A;  4A0C D;  1NTK K;  2YXR B;  3HTK B;  1NU1 G;  2KI7 B;  3HD7 D;  3O33 A;  3VMZ A;  4WZ0 A;  1VDF A;  1X0T A;  1NH4 A;  2E43 A;  5BU8 B;  4LC1 A;  1RF0 C;  1FOS E;  4ZMD A;  2EXU A;  2E42 A;  2Q6Q A;  2VJF A;  4LJN A;  1M57 D;  1U7M A;  3NXS A;  3IFM A;  3P7K A;  1FJP A;  2DW3 A;  1T2K C;  2HDP A;  2JP3 A;  4OWF A;  1KB9 D;  2WPV B;  1PGP A;  2YXQ B;  3HUS C;  1RMD A;  1WMK A;  4OGE A;  1KQF B;  2AXT H;  3B8E B;  5H2F H;  3NG2 A;  2QJP C;  2QJY C;  4IL6 X;  1SQP J;  2ZYA A;  3IAO A;  3KXD A;  3E1R A;  5KTB A;  1SFC A;  1EDI A;  1LTJ C;  3S1K A;  1FAV A;  5B66 H;  2EOD A;  3O34 A;  4R7E A;  1NU1 K;  5KLI B;  2JUN A;  1LGH B;  4TT3 H;  2E61 A;  2RMZ A;  5D1K B;  2BCC J;  2KZJ A;  2IPP A;  1U7J A;  2KXP B;  2KS1 A;  4PV1 D;  2B89 A;  4X3G A;  1M56 D;  4GOF A;  4KJM A;  5BU5 A;  1JY2 P;  3PP5 A;  3ZYQ A;  1SQV J;  4MN4 C;  1GZL A;  3G9R A;  5AW6 B;  5FER A;  2BCC E;  3D6Y A;  3F89 A;  1G25 A;  1BE3 J;  1FJK A;  3MZW B;  2D8S A;  2F42 A;  3H32 A;  3HTK C;  1OW7 A;  1S5L X;  2E74 D;  3CX5 E;  1SQV E;  3P8M C;  4LAD B;  4L73 A;  1BE3 E;  3FAN A;  2R44 A;  1LT1 A;  1L2P A;  3A7O A;  5B76 A;  4YTP C;  3BAS A;  4B86 A;  2OYO A;  1QLE D;  1IK9 A;  2P10 A;  3O36 A;  1ZV8 A;  2AEM A;  1W5C E;  1NKN A;  1IFJ A;  5AW2 B;  1H88 A;  2DX8 A;  1UIX A;  2XZR A;  2WSC J;  3T9K A;  2POH A;  4IC3 A;  3DQV R;  3M9Q A;  3C8V A;  2M85 A;  3CXH I;  2XB1 A;  2N1T B;  4YAD A;  5SVI A;  5LKZ A;  5CCG C;  3VTP C;  1K8A Q;  1EDJ A;  1RE4 A;  3T97 B;  5KLI C;  3LQI A;  4LGD E;  5CCH A;  1RE3 C;  5H1V A;  2G45 A;  4N4F A;  1BCC G;  1KB9 H;  1FBM A;  1PGO A;  2PFX A;  3L74 G;  1KIL D;  1LTB C;  4PD4 D;  2KNC A;  1OW8 A;  4YBS A;  2I50 A;  2E75 D;  2W83 C;  2YKO A;  2O01 H;  3L72 G;  2CSY A;  2WSE J;  1G1I A;  4F52 B;  4GNG A;  1NTM G;  3U5O A;  2WWW A;  3H1K G;  1LWU B;  2MD8 C;  1IO4 A;  1LWU C;  1LT9 A;  1U57 A;  2CON A;  1DIP A;  5L8R J;  4WA6 A;  1NAY A;  1M7L A;  5G05 B;  2YHO A;  4Y99 B;  1ZRT D;  4QF2 A;  3BAT A;  1S9K D;  1LP1 A;  3N4X A;  3CC7 P;  1NTK D;  2L0B A;  3R2P A;  4R8P K;  2P57 A;  2L7P A;  3HE5 A;  3JCU H;  1EZV D;  2P7J A;  1FDI A;  2IYO A;  1NTM K;  5SVX A;  1E4U A;  3KQI A;  4AQR D;  1A02 J;  3B4S A;  1URQ B;  3KPE A;  3ZDM A;  3AE5 C;  2OTK E;  3MTU E;  1S72 P;  3RBX A;  5LKT A;  3A0H E;  3M63 A;  1FZA A;  1WIM A;  4W7Y A;  3BCC J;  2FFD A;  3N9L A;  1N73 A;  4JYB A;  3V2P A;  4R2Y A;  5D1M B;  5TIS E;  2Q1K A;  1QL2 A;  4Z1M H;  2JO1 A;  1GK4 A;  2GUS A;  5AVW B;  3TNU B;  4C7R A;  1NHL A;  2QVA A;  2D2C B;  5GTI H;  1SQB G;  4JF7 A;  1PL5 A;  4OVN F;  4WY4 C;  1PP9 G;  4RJT A;  4RKU J;  3TGU J;  5AW4 B;  2LGL A;  1L4A A;  3CCV P;  3L75 E;  1AV1 A;  4U3F J;  3AE2 C;  1WIL A;  4NPD A;  3TGU E;  3RK2 D;  1KYO I;  5GTH E;  1URQ C;  2B87 A;  3Q2Y A;  2Y1M A;  1KFM A;  4U3F E;  2M5A A;  3W67 A;  1IFI A;  2OTL P;  3FWL A;  2ECJ A;  5LKX A;  1BDD A;  3OAK A;  4H0L C;  3BRV B;  4I7Z B;  4K3A A;  2BCC D;  1X4I A;  1ZP0 C;  1PZQ A;  2FYN C;  1PFI A;  2OAR A;  3EB5 A;  1YI2 P;  4ASW A;  3MUD A;  1G2C B;  1M1K Q;  2FUI A;  3PTZ A;  1BGY G;  1WEW A;  3HD7 A;  3B71 A;  1WEQ A;  1BE3 D;  2CSZ A;  1FZC C;  2ZYD A;  1WEN A;  1L0L J;  5B77 A;  2D2C C;  1NTZ G;  3LW5 H;  1VQ7 P;  5AW5 B;  3BVH A;  2N1T D;  4D6T J;  2R5D A;  2OWA A;  1VPC A;  2O1K A;  2M3H A;  2XEU A;  4H44 C;  3SUB A;  1VYX A;  3I5C A;  5AW9 B;  3N9N A;  1L0L E;  5B5E E;  3AE6 C;  3RK3 C;  3O35 A;  4I2L C;  4UB8 E;  2EGM A;  4YAX A;  3IR9 A;  5APU A;  4D6T E;  1EQ7 A;  2JMD A;  3L71 E;  2QIC A;  1Y9B A;  2JKV A;  2FSA A;  3G71 P;  3C9I A;  4XI1 A;  1QVF O;  1OIP A;  3P8C E;  2IBZ G;  3H1H G;  2RSD A;  1L0N E;  1SLQ A;  4NPE A;  2QIW A;  1S3J A;  3L36 A;  5AVY B;  1RHZ B;  4EIJ A;  1JCC A;  2QEX P;  1J2J B;  3L73 G;  1CSB A;  1P84 E;  2LGK A;  4PJ0 E;  3PUR A;  3PHD A;  3GG2 A;  2M3B A;  1SQX E;  2A45 H;  4I1L A;  1GL2 B;  1WEP A;  1Z60 A;  2KWK A;  3V43 A;  3CCJ P;  4GIF A;  3NFQ A;  4PD4 E;  2ECG A;  2Y9Z A;  2K9Y A;  4XE5 B;  3GF3 A;  1P84 I;  3WUU A;  4RO0 A;  4K35 A;  4ZUX U;  1WGM A;  3PLW A;  3VMX A;  1PV3 A;  1YJ9 P;  5KKZ C;  1GU5 A;  3CWB G;  1L0N K;  5AW8 B;  1X8Y A;  3U1A A;  1X4J A;  4A49 A;  3ZPV 1;  3KZI H;  1VQ4 P;  1ZN5 A;  1YTZ I;  2C2V S;  2KZI A;  2KWO A;  1NTK J;  4W4U A;  2YIU B;  2AN6 A;  1LTI C;  5AVV B;  3CX5 H;  3M91 A;  3PH0 A;  3E1I A;  1S9K E;  1SQX K;  1X79 B;  2VJE A;  1AQT A;  1PPJ G;  1RH5 B;  3HUS B;  3B5N B;  2QJK C;  2RN0 A;  1DVP A;  3WUT A;  1W2B O;  2E5T A;  3EWK A;  1WE9 A;  2QJP B;  2MNZ A;  5KJ7 C;  3LQJ A;  2LXC B;  2CPB A;  3KNV A;  2OYI B;  3V2R A;  2KIZ A;  2WT7 B;  1XTC C;  2QSI A;  2LXH C;  1FBV A;  5KLV G;  5FB1 A;  5APX A;  2E76 B;  2K37 A;  3EFG A;  3PRJ A;  4UB6 E;  3CCS P;  1HF9 A;  4NN2 A;  1HYI A;  2OTJ P;  1Z2Q A;  1JEK A;  5AW0 B;  3UIA A;  2ITA A;  1DX7 A;  3HE4 A;  1GMJ A;  5B75 A;  3L70 E;  1NU1 J;  3G4S P;  1YQ3 C;  3E2D A;  1JOC A;  2V7Q J;  3ABV C;  4L58 A;  1IC2 A;  1Y8A A;  2NPS D;  1DEB A;  1NYH A;  3CCR P;  4YAT A;  3AEF C;  1NU1 E;  5TJH A;  2K9J A;  4OGQ D;  2Q9I A;  5AVZ B;  3H1L G;  3VN0 A;  5B8D A;  4I7C A;  5DIN A;  3L75 D;  3GLM A;  4DZO A;  5H1U A;  1SFC B;  2YIU C;  1CZQ A;  3MIW A;  3CCM P;  4GKG A;  1N7S C;  2KB7 P;  4OGC A;  5APV A;  1MV8 A;  2WTY A;  2JMJ A;  2WSE H;  2ZET C;  1MFZ A;  3TGU D;  3PJS K;  4Z0O A;  3R4Y A;  1MBM A;  3B5N C;  3RTR B;  2M6M A;  1JY2 N;  1VQ5 P;  2MKV A;  4U3F D;  1FU1 A;  3HTK A;  3GV4 A;  1KTM A;  2ECW A;  2OYI C;  2EGP A;  3ASL A;  1LTA C;  4I6M C;  4DCK A;  2KWN A;  4IFM A;  1JNM A;  2A45 G;  2ZXX A;  2IDA A;  2C0X A;  2E76 C;  2E6R A;  1VQ6 P;  1SS1 A;  3SWY A;  4L7X A;  2KKY A;  3FAO A;  2MA6 A;  2R32 A;  1H89 A;  1SQP G;  3DPL R;  2Y9Y A;  4H13 D;  1GU4 A;  2PRR A;  2FYU G;  2K16 A;  3P32 A;  5B78 A;  4GDO A;  4LLH A;  2FFW A;  1BSN A;  5AW1 B;  1WEM A;  2Z5H A;  1GW3 A;  2QIZ A;  3AEG C;  1L0L D;  1QL1 A;  3MHS A;  2W6A A;  2Q3I A;  5K5G B;  3EB6 A;  4WVZ A;  3Q5R A;  4C9Z A;  3CXH E;  4D6T D;  4DOJ A;  3M0D C;  3RPG B;  1FZE A;  1HTL C;  1SFC C;  3OJA B;  5TIS H;  3L71 D;  4DJG A;  1GTW A;  1MKM A;  4JPZ B;  1RF1 B;  1X4U A;  3KHU A;  4CCG X;  2JJL A;  4GOE A;  2LQ6 A;  1RY3 A;  4AYC B;  3P8C D;  4LLB A;  1GL2 D;  1L0N D;  2L91 A;  2YVR A;  2KIK A;  2G43 A;  3LDY A;  2FYU K;  3W68 A;  4N78 E;  2KNC B;  1GW4 A;  1KC8 Q;  2Z5I A;  1P84 D;  1T1H A;  3H1J G;  4JQ0 D;  1BCC J;  3VYI A;  1FP0 A;  1SQX D;  1VFY A;  3L72 J;  2B88 A;  3FL2 A;  3MHV A;  2H7H A;  3H1I G;  1BCC E;  4FJC A;  1NTM J;  3L74 E;  2XDJ A;  2L5U A;  3Q5P A;  3H1K J;  2LR2 A;  1X22 A;  4XFJ A;  1T2K D;  3AEA C;  2JM3 A;  3O37 A;  3USS A;  3L72 E;  5H9M A;  3N9M A;  2IX7 C;  1IFN A;  1RQU A;  1JY3 O;  1Q2N A;  1NTM E;  3H6P A;  2XKM A;  4DT0 A;  1FOS F;  2N1T A;  2LGV A;  3H1K E;  2CSV A;  4IFD K;  1BOR A;  1JTH B;  2ECT A;  4IOI H;  3AE9 C;  3T97 A;  5I3L A;  1HYJ A;  3RPG C;  5KAI E;  3AEB C;  2Q3E A;  1AFO A;  2A06 G;  4WY4 B;  3TSI A;  3JSV C;  2K88 A;  3L1Z B;  1RF1 C;  3RL0 B;  2OYH A;  1RE4 C;  1J1E B;  1Q7Y Q;  3O47 A;  1VF5 B;  3SFE C;  3U59 A;  5CCH C;  2IQJ A;  1EDK A;  4W7Z A;  3VOP A;  2XND H;  1LWU A;  2PAJ A;  1SQQ G;  2LV9 A;  4UB8 H;  2XU6 A;  1R5S A;  2B9B A;  2RH0 A;  3QZV A;  3M0A A;  4GB0 A;  2QG4 A;  2LAU A;  4H0L B;  3V4Q A;  3E7K A;  4BRY B;  4EYY Q;  2FXP A;  2OQQ A;  3L70 D;  1M1J B;  2FYN B;  2C9L Y;  4V3K C;  3LIE A;  1ZR2 A;  2YO2 A;  1VQN P;  1HVV A;  2HPC B;  4U7J A;  1N8R Q;  2N9B A;  4C7N B;  3LVQ E;  4N3W A;  1NU1 D;  5TRB A;  2YKQ A;  1FZC B;  2AEF A;  4AUQ B;  1WEO A;  1VQM P;  4TLF A;  2BAS A;  2JWA A;  1URQ A;  3LVR E;  1FC2 C;  3I56 P;  3IHP A;  1SQQ K;  3WMM 0;  3GHG B;  3HRN A;  1KQG B;  1LTT C;  2W8Z A;  5CCG D;  3L75 J;  1LNQ A;  3BCC G;  4H44 B;  4L75 A;  3IF4 A;  4PD4 H;  2AEJ A;  3KV6 A;  1KYO E;  3TYY A;  1KFN A;  1SQB E;  3PUQ A;  3VMY A;  3RK3 B;  3RL0 C;  1J1E C;  2B87 B;  1PP9 E;  1VF5 C;  2N9Y B;  2E6S A;  1G1J A;  2WSF J;  4UP0 A;  4YXD C;  3L1X A;  4WZ2 A;  1D7M A;  3BRT B;  1VQO P;  3TNU A;  1WEV A;  2L75 A;  3CCL P;  3O7A A;  5CJ4 A;  3L11 A;  2YQL A;  2FFD C;  2ZJS E;  1PGJ A;  1N86 A;  5APQ A;  2IDB A;  2K3R A;  1N73 C;  3NTN A;  2XV5 A;  5KH7 A;  4WB4 A;  1E79 H;  2M0B A;  1KN7 A;  3GF7 A;  1M1J C;  3M06 A;  5APS A;  1SQB K;  4C46 A;  2RR4 A;  3PHL A;  1IZN B;  2R3S A;  2FYU D;  3O6Q B;  3HCS A;  4ZDT A;  1HUC A;  2WIT A;  5DKA A;  2NPS A;  5TDR A;  3VMA A;  2KU3 A;  1BSH A;  1KB9 I;  4JYC A;  2CKL B;  3O8Z A;  1BGY E;  2D8U A;  2WPQ A;  2JEE A;  1L4A C;  3CXH D;  3EFF K;  4UB6 H;  3ZPV E;  2HOD B;  5KKZ B;  2Y0C A;  3GHG C;  2H0D B;  1FZG A;  3VP9 A;  2FBW C;  1NTZ E;  3LRQ A;  1F62 A;  3MP7 B;  4F1P A;  4YC9 A;  3L71 J;  4HH2 A;  1JM7 B;  1CI6 B;  1LTS C;  3FXE A;  5APT A;  2QRX A;  3ITK A;  2KGI A;  4IFF A;  1H8A A;  3WUV A;  3KQG A;  1G2C A;  3JCU E;  1L0N J;  4N78 D;  2PUY A;  1KZU B;  4PV1 B;  1KV4 A;  1DCQ A;  5AIT A;  3H1H J;  2QJK B;  3FM8 C;  1MM2 A;  2HR3 A;  2KSE A;  1AQ5 A;  2I1K A;  4FIP A;  2ZT9 C;  2PNX A;  2H88 C;  3MUD C;  2G6Q A;  1S1C X;  4B7Y C;  2IBZ E;  3H1H E;  1SQX J;  1A02 F;  1BCC D;  1H0T B;  3HD7 C;  2WZ7 A;  1LJ2 A;  3L74 D;  3U1C A;  1Q81 Q;  2ZVO B;  1VQK P;  1NTZ K;  3N9P A;  2GUV A;  3M7K A;  1YJW P;  5CBN A;  1OMI A;  3L73 E;  2M8R A;  4IL6 E;  2L80 A;  2WPS A;  3L72 D;  1USD A;  4Y28 J;  5CMZ A;  1OFC X;  4MSX A;  5BVZ A;  1K73 Q;  1NTM D;  4WY4 D;  3MHH A;  3SOU A;  2VPE A;  1NGM B;  2Z4E A;  5DJT B;  3H1K D;  2IBZ I;  1AVO A;  3KDP B;  3SWF A;  2KOG A;  4GND A;  4UI9 B;  5D1L B;  3CWB J;  5K3Q A;  3CCE P;  1U6G B;  2YU4 A;  1WES A;  1J1D C;  2MKE A;  2XOY A;  3KDE C;  5C11 A;  5GTI E;  1YIJ P;  1Y47 A;  1OVR A;  3CWB E;  4CPG A;  1URQ D;  2HLO A;  4L74 A;  2KGG A;  3M99 A;  1S5L E;  2FXO A;  4H0L D;  2YUR A;  1N7S B;  2G3A A;  2RKL A;  4OH8 B;  3A5T A;  1GL2 A;  1WT6 A;  5G04 B;  1KQS O;  2ZFC A;  1CHC A;  2C2L A;  4PV1 C;  2JDI H;  4EI2 A;  3T6R A;  2KP8 A;  1KIL B;  4P5O B;  1K2F A;  1SQQ D;  2E75 B;  2Y0D A;  1PPJ E;  2H89 C;  4ZQL A;  3CXH H;  3FGA D;  5CBO A;  2KYU A;  2JR8 A;  1NTK G;  2E74 C;  1RF0 A;  2NAA A;  3QWO C;  1JB0 J;  3CLQ A;  3V6I A;  2VNF A;  2D2C D;  2KYV A;  3L70 J;  5KLV E;  1R8E A;  5AW7 B;  1EZV G;  4EDF A;  4H44 D;  5G0F A;  3G6E P;  2Y1N A;  3FX0 A;  2WSC H;  3O70 A;  2KE1 A;  2LRI C;  1R5L A;  1FZB A;  1SP4 A;  1NJI Q;  2MA5 A;  2VJF B;  3HUS A;  4MVT A;  1MUU A;  2P58 A;  2MIQ A;  5AIU A;  3SOW A;  3MD0 A;  2QM7 A;  1ZXG A;  1LTJ A;  2OYI A;  1KYO D;  1SQB D;  4YXW H;  4W80 A;  3LJU X;  1PP9 D;  2ECN A;  3H1L E;  1N2D C;  3MGN A;  5KLV K;  1NO4 A;  1E5W A;  2VPG A;  4WWI A;  2R3C A;  4JBZ A;  5E79 E;  2YUC A;  2IFM A;  2Q7C A;  3M9B A;  3RGU A;  2YNY A;  1KIL C;  5KAF E;  2VP7 A;  3NMD A;  2UZG A;  2DJA A;  3U5M A;  2E75 C;  2PGD A;  1VQ8 P;  5CJ0 A;  3N9Q A;  3CMA P;  1UII A;  5KAI H;  2KS1 B;  2PP6 A;  2H43 A;  2ZYG A;  1S2E A;  1NWQ A;  2K17 A;  1ZR4 A;  2ECV A;  4H9D A;  2B0O E;  3H32 B;  2Y0E A;  5H1T A;  2CRW A;  3M0D A;  2FYU J;  3U5P A;  3K5B A;  2BEQ D;  3ZNI A;  2YMY A;  4EOT A;  2KK7 A;  1IFP A;  3CD6 P;  1IYM A;  1YQ4 C;  3Q5S A;  4UP5 A;  1BGY D;  5B79 A;  1NOH A;  1SQP E;  2FYU E;  2IZ0 A;  1CW5 A;  3T7L A;  1EXJ A;  4YPC A;  3CCU P;  3A0H H;  2BCC G;  1NTZ D;  4LK9 A;  2ZAE B;  1LDK C;  1AVY A;  5CCG A;  2A45 I;  2WPR A;  1EDL A;  2KWJ A;  1Q86 Q;  3KZI E;  2VPB A;  3WU2 E;  5KJ7 D;  3RK2 B;  4HB1 A;  3V2N A;  3L35 A;  2QE7 H;  1RE3 A;  4PTB A;  1NKZ B;  1SQV G;  2KFT A;  3A0B E;  1BE3 G;  2FXM A;  2MUM A;  5AVS B;  5SVI B;  4O9B A;  2W6B A;  1FDM A;  1JUN A;  1ZLL A;  5C39 A;  2P67 A;  1N87 A;  4R4L A;  2KKX A;  3IN6 A;  3H1J J;  1SQP K;  4ZKP A;  2YQM A;  5SVY A;  1HJB A;  2IBZ D;  3H1H D;  1DD4 A;  1KYO H;  5DJU B;  1GK6 A;  2KSJ A;  2WSS H;  1FZF A;  1JCD A;  3CX5 I;  1RQV A;  3L73 D;  2ZVN B;  3L74 J;  3H1J E;  1PGQ A;  3H1I J;  2YRE A;  3G3Z A;  3SOX A;  2M3E A;  2DSM A;  3HCT A;  2K1J A;  3I55 P;  2XP0 A;  1BDC A;  4GOD A;  2WQY C;  1ZBD B;  4QQ4 A;  1WRG A;  1LT9 B;  1DD3 A;  1RF1 A;  3Q1D A;  1SQV K;  1VQL P;  3V2Q A;  1MZ9 A;  2WSF H;  3H1I E;  5GTH H;  4AYC A;  4B86 C;  1N7S D;  2MD7 B;  2BAY A;  2O1J A;  5AVX B;  3Q3D A;  1LP1 B;  3CME P;  2LKM A;  1T8Z A;  3ZVY A;  3B5N D;  2LN0 A;  2V4H A;  3CWB D;  2OYH B;  3AE3 C;  3OA7 A;  1HGZ A;  3HCU A;  1MFT A;  5AVU B;  2K1A A;  3TK1 A;  2KRE A;  3RK2 C;  3HE5 B;  2ZXE B;  1FE6 A;  2YSM A;  2YYR A;  2QJ0 A;  1YIT P;  4YBM A;  2F6J A;  1WEE A;  4AVX A;  3PLN A;  2XOZ A;  2E76 D;  1PPJ D;  1T3U A;  2A06 E;  3V4W A;  3CC4 P;  2MNY A;  4WBA A;  2OXQ C;  5LCW B;  2AXT E;  1HJ0 A;  1M8O B;  1SQQ J;  1YJN P;  2LXB A;  5H2F E;  5LKU A;  2I1J A;  2YKP A;  3D6Z A;  3CCQ P;  5B66 E;  4HJG H;  3JUE A;  3L37 A;  4R4M A;  5B5E H;  5APW A;  3AEE C;  2W90 A;  4ZKU A;  1JTH A;  3C5K A;  1SQQ E;  5KLV D;  1ZME C;  3LQH A;  2P1J A;  2FFD B;  4S3O B;  2K4D A;  1JY3 N;  1N73 B;  2O3J A;  2C9N Y;  2FKW B;  4V3L C;  2N1T C;  2YSJ A;  4Z0R A;  1WFK A;  1LT9 C;  4WY4 A;  1T3J A;  3VK6 A;  5CHX A;  2CK3 H;  1SFC D;  2KUB A;  1GD2 E;  4O62 A;  1YBK A;  3DDT A;  2KR4 A;  1KMI Z;  4YAB A;  1KQL A;  3FEH A;  2FYZ A;  2CPS A;  3SSU A;  2XNX A;  1P84 H;  1JY3 P;  2O01 N;  3RK3 E;  4PJ0 H;  1K05 A;  2OYH C;  3MDB C;  2W27 A;  1SQB J;  3D71 A;  4IL6 H;  1L4A B;  4KHX A;  3H1L D;  3RL0 g;  4KT0 J;  3U5N A;  1PP9 J;  3CC2 P;  3AED C;  3C1L A;  3M62 A;  1IK7 A;  3ZTG A;  5AW3 B;  1YYC A;  4FO9 A;  2CT2 A;  4BRY A;  3CPW O;  4TKP B; 
#chains in the Genus database with same CATH homology
 2Q9I A;  5AVZ B;  3U1C A;  3N9P A;  1NTZ K;  1M1J A;  2GUV A;  1RE4 A;  3VN0 A;  5B8D A;  3LQI A;  2C0W A;  4LGD E;  2M8R A;  5J3X A;  1HGV A;  5CCH A;  4I7C A;  5TAB A;  2L80 A;  4FK5 A;  1RE3 C;  2WPS A;  5DIN A;  5H1U A;  4Y99 C;  4DZO A;  2H8P D;  2Y43 A;  4MSX A;  5CMZ A;  5H1V A;  2G45 A;  1SFC B;  4N4F A;  5BVZ A;  1CZQ A;  3CI9 A;  3MIW A;  2HPC A;  4GKG A;  1FBM A;  1N7S C;  4C7N A;  1XTG B;  1LTG C;  2KB7 P;  1KIL D;  4WY4 D;  5APV A;  3MHH A;  2VPE A;  1LTB C;  1MV8 A;  3KV5 A;  4GNF A;  2WTY A;  2Z4E A;  2LGG A;  2I50 A;  4YBS A;  2JMJ A;  2WSE H;  2ZET C;  1MFZ A;  2YKO A;  3KDP B;  2O01 H;  1FZC A;  3SWF A;  3B5N C;  2KOG A;  2L5G B;  3RTR B;  4GND A;  4UI9 B;  5D1L B;  2M6M A;  2CSY A;  5FEY A;  1JY2 N;  1G1I A;  1U6G B;  2YU4 A;  1WES A;  1Z56 A;  4F52 B;  4S3O C;  1J1D C;  1FU1 A;  4LKA A;  4GNG A;  3HTK A;  3ZVZ B;  5C11 A;  3GV4 A;  3U5O A;  1WEU A;  3GHG A;  2WWW A;  2ECW A;  3C6W A;  2NPS B;  1GDT A;  2OYI C;  5C13 A;  3A2A A;  4IC2 A;  2EGP A;  1LWU B;  3ASL A;  2MD8 C;  3HD7 B;  1IO4 A;  4I7D A;  1JO5 A;  1LTA C;  3I2D A;  1LT9 A;  2M1R A;  1URQ D;  4I6M C;  2HLO A;  2KWN A;  4WZ3 B;  4HYT B;  2KGG A;  1HH0 A;  2MJZ A;  4WA6 A;  1MM3 A;  1M7L A;  2HG5 D;  4IFM A;  3N9O A;  1JNM A;  2YHO A;  5G05 B;  4Y99 B;  2A45 G;  4XA4 A;  2IDA A;  2C0X A;  3M99 A;  2RI7 A;  4QF2 A;  2E6R A;  1N7L A;  3BAT A;  2YUR A;  1Z6U A;  1N7S B;  3A5T A;  4OH8 B;  3SWY A;  4L7X A;  1GL2 A;  1WT6 A;  1S9K D;  5G04 B;  2VRS A;  2MA6 A;  2R32 A;  2ZFC A;  1CHC A;  2C2L A;  3T6R A;  2YO3 A;  1H89 A;  3N4X A;  2KP8 A;  3LID A;  1KIL B;  4P5O B;  3DPL R;  1K2F A;  5CCH D;  1GU4 A;  2L0B A;  3R2P A;  2K16 A;  3A3Y B;  4R8P K;  3P32 A;  3VP8 A;  5B78 A;  4ZQL A;  1J1D B;  5AVQ B;  4A4B A;  4LLH A;  4I7B A;  3HE5 A;  5AW1 B;  1WEM A;  2KYU A;  2Z5H A;  2P7J A;  1GW3 A;  2QIZ A;  4PPE A;  2F6N A;  2HYE D;  1IFM A;  2MT5 A;  1RF0 A;  1NTM K;  3L4F A;  2NAA A;  1QL1 A;  5KH9 A;  1E4U A;  3MHS A;  3KQI A;  3CLQ A;  2VNF A;  2W6A A;  4AQR D;  2Q3I A;  2KYV A;  1A02 J;  3EB6 A;  1URQ B;  2L43 A;  1VD4 A;  4O64 A;  4N3Y B;  3KPE A;  4C9Z A;  5AW7 B;  4DOJ A;  3M0D C;  3RPG B;  2YHN A;  1FZE A;  1HTL C;  5G0F A;  1SFC C;  3MTU E;  3OJA B;  2Y1N A;  5LKT A;  1GTW A;  2WSC H;  3PUQ A;  3O70 A;  1RF1 B;  2KE1 A;  3GL6 A;  2LRI C;  4A4C A;  1FZB A;  2P2U A;  1SP4 A;  1X4U A;  2MA5 A;  3M63 A;  2VJF B;  3HUS A;  1FZA A;  1WIM A;  2CKL A;  2JJL A;  2Q5U A;  4MVT A;  4CCG X;  4W7Y A;  1MUU A;  1JMM A;  2LQ6 A;  1RY3 A;  2MIQ A;  1SVF A;  2J59 M;  3P8C D;  4LLB A;  5AIU A;  2FFD A;  4AYC B;  4YBT A;  3SOW A;  1GL2 D;  3MD0 A;  2QM7 A;  3N9L A;  1N73 A;  4JYB A;  3V2P A;  2G43 A;  2HOD A;  2FYU K;  1LTJ A;  2OYI A;  4R2Y A;  4N78 E;  2H0D A;  2NPS C;  5D1M B;  1GW4 A;  1QL2 A;  2Z5I A;  1GK4 A;  2GUS A;  2R5B A;  1T1H A;  5AVW B;  4BHW A;  3TNU B;  4C7R A;  1JM7 A;  1CI6 A;  4RES B;  2E43 A;  4W80 A;  3VYI A;  1NHL A;  2ECN A;  1OXZ A;  2WZ7 A;  1N2D C;  1FP0 A;  3MGN A;  5KLV K;  1NO4 A;  1E5W A;  2VPG A;  2R3C A;  1VFY A;  2YUC A;  2IFM A;  3CL3 D;  3FL2 A;  4CA1 A;  2H7H A;  3RL0 D;  4JF7 A;  4FJC A;  2Q7C A;  3M9B A;  4AUW A;  2LXP C;  2YNY A;  1KIL C;  4WY4 C;  5TDW A;  2XDJ A;  2VP7 A;  2L5U A;  3SHB A;  5KH3 A;  3NMD A;  2UZG A;  1XWH A;  3U5M A;  5AW4 B;  2LGL A;  1L0L K;  1L4A A;  1T2K D;  5CJ0 A;  3N9Q A;  3O37 A;  1HWT C;  5KJ7 A;  4Q6F A;  5H9M A;  3N9M A;  2IX7 C;  1IFN A;  2PP6 A;  2HFE D;  1JY3 O;  2H43 A;  1HBW A;  1WIL A;  3H6P A;  2VJE B;  2XKM A;  3KYQ A;  1FOS F;  2N1T A;  5JG6 A;  1NWQ A;  2FUU A;  2K17 A;  2LGV A;  4BBQ A;  4IFD K;  1BOR A;  1ZR4 A;  2ECV A;  5TBN A;  3RK2 D;  1JTH B;  2ECT A;  3T97 A;  5EYA F;  2JMI A;  3H32 B;  5I3L A;  2IFN A;  5AVR B;  2JRJ A;  5H1T A;  1URQ C;  2YT5 A;  3M0D A;  2Y1M A;  1HYJ A;  2GM4 A;  1KFM A;  1IFI A;  3RPG C;  2ECJ A;  5AVT B;  5LKX A;  3U5P A;  1AFO A;  5FB0 A;  3OAK A;  3ZNI A;  2YMY A;  3BRV B;  4EOT A;  4AP4 A;  4WY4 B;  3TSI A;  3L1Z B;  1RF1 C;  3RL0 B;  2OYH A;  1X4I A;  1IYM A;  4UP5 A;  4N6J A;  1RE4 C;  1J1E B;  5B79 A;  1NOH A;  3U59 A;  1PFI A;  2OAR A;  3EB5 A;  2LDR A;  5CCH C;  1IJD B;  1CW5 A;  4W7Z A;  3VOP A;  3MUD A;  1G2C B;  3EQ2 A;  3T7L A;  2QM8 A;  2FUI A;  4LK9 A;  3HE4 B;  1LWU A;  1LDK C;  2PAJ A;  5CCG A;  2A45 I;  1WEW A;  3HD7 A;  2WPR A;  2EA6 A;  1WEQ A;  2KWJ A;  2CSZ A;  3M9H A;  1L4A D;  1FZC C;  1NAF A;  2LV9 A;  2VPB A;  2XU6 A;  5KJ7 D;  1WEN A;  3RK2 B;  3V2N A;  5B77 A;  3L35 A;  1RE3 A;  3QZV A;  3M0A A;  4GB0 A;  4QF3 A;  3II6 A;  1LDJ B;  4PTB A;  1NKZ B;  2KFT A;  1YTZ T;  3LW5 H;  1LTJ B;  5AW5 B;  3BVH A;  2VPD A;  2N1T D;  2R5D A;  1N7S A;  4GT1 A;  1IFD A;  1VPC A;  2FXM A;  2O1K A;  2ECI A;  2M3H A;  3V4Q A;  5AVS B;  2MUM A;  4O9B A;  2XEU A;  2W6B A;  3RK3 D;  1FDM A;  1JUN A;  2KLV A;  1VYX A;  1ZLL A;  1M1J B;  1KIL A;  3I5C A;  5AW9 B;  2YW8 A;  3N9N A;  3B5N A;  1X9V A;  3RK3 C;  2P67 A;  1N87 A;  2C9L Y;  3O35 A;  4I2L C;  4M3L A;  4V3K C;  3LIE A;  4YAX A;  3IR9 A;  2J58 A;  5APY A;  5APU A;  1ZR2 A;  2YO2 A;  1W2E A;  1V87 A;  1EQ7 A;  1SQP K;  4ZKP A;  2YQM A;  1HVV A;  2HPC B;  1JY2 O;  1HJB A;  2N9B A;  4C7N B;  1GL2 C;  4GNE A;  2JMD A;  3N7N A;  2WT7 A;  4N3W A;  2QIC A;  5TRB A;  1GK6 A;  2KSJ A;  2YKQ A;  1FZF A;  1FZC B;  1JCD A;  4AUQ B;  1OWA A;  2FSA A;  1WEO A;  3C9I A;  2HYN A;  4XI1 A;  3V5B A;  2BAS A;  1DH3 A;  1URQ A;  3IHP A;  3P8C E;  1NTK K;  2YRE A;  4A0C D;  3G3Z A;  1SQQ K;  3SOX A;  3HTK B;  3WMM 0;  2RSD A;  3HCT A;  3GHG B;  3HRN A;  2K1J A;  1SLQ A;  1LTT C;  5CCG D;  3HD7 D;  3L36 A;  3O33 A;  5AVY B;  4EIJ A;  1JCC A;  3VMZ A;  4WZ0 A;  1ZBD B;  3KV6 A;  3TYY A;  1WRG A;  1J2J B;  1LT9 B;  1KFN A;  1VDF A;  1CSB A;  1RF1 A;  1NH4 A;  1SQV K;  5BU8 B;  4LC1 A;  1RF0 C;  3V2Q A;  3RK3 B;  1MZ9 A;  3VMY A;  1FOS E;  2LGK A;  3RL0 C;  2E42 A;  2VJF A;  2WSF H;  3PUR A;  4LJN A;  1J1E C;  3NXS A;  3PHD A;  4AYC A;  3IFM A;  2E6S A;  1G1J A;  3P7K A;  1FJP A;  1N7S D;  4UP0 A;  4B86 C;  2MD7 B;  2M3B A;  2BAY A;  2A45 H;  2O1J A;  4I1L A;  1T2K C;  5AVX B;  1GL2 B;  1WEP A;  1Z60 A;  2HDP A;  3L1X A;  2KWK A;  4WZ2 A;  3V43 A;  2LKM A;  4GIF A;  1T8Z A;  3ZVY A;  3BRT B;  3NFQ A;  3B5N D;  2LN0 A;  2ECG A;  2OYH B;  5DKA A;  3OA7 A;  3HUS C;  1HGZ A;  3TNU A;  4XE5 B;  1RMD A;  1WEV A;  2L75 A;  3HCU A;  5AVU B;  3O7A A;  5CJ4 A;  3TK1 A;  3L11 A;  2KRE A;  2YQL A;  4ZUX U;  1WGM A;  3RK2 C;  3VMX A;  3B8E B;  2FFD C;  3NG2 A;  1N86 A;  5APQ A;  3HE5 B;  1N73 C;  2ZXE B;  5KTB A;  3NTN A;  1SFC A;  2YSM A;  1GU5 A;  1LTJ C;  2XV5 A;  1L0N K;  2QJ0 A;  2YYR A;  5AW8 B;  5KH7 A;  4WB4 A;  1FAV A;  1X8Y A;  3U1A A;  1X4J A;  4A49 A;  4YBM A;  2EOD A;  3O34 A;  2F6J A;  3ZPV 1;  4R7E A;  1WEE A;  1NU1 K;  1M1J C;  4AVX A;  1LGH B;  3M06 A;  5APS A;  5D1K B;  1SQB K;  1ZN5 A;  4C46 A;  1T3U A;  1YTZ I;  3V4W A;  2MNY A;  4WBA A;  2C2V S;  2KWO A;  2OXQ C;  5LCW B;  3HCS A;  4ZDT A;  4W4U A;  2AN6 A;  1HUC A;  1LTI C;  5AVV B;  2IPP A;  4X3G A;  2WIT A;  3M91 A;  5BU5 A;  3E1I A;  2NPS A;  1S9K E;  1JY2 P;  1SQX K;  1X79 B;  2I1J A;  2YKP A;  3PP5 A;  5TDR A;  5LKU A;  2KU3 A;  2VJE A;  3ZYQ A;  1GZL A;  3HUS B;  3B5N B;  3L37 A;  4JYC A;  5AW6 B;  5APW A;  2CKL B;  5FER A;  1DVP A;  3O8Z A;  4ZKU A;  1G25 A;  1JTH A;  3C5K A;  1FJK A;  2WPQ A;  2D8S A;  2P1J A;  2FFD B;  3H32 A;  1WE9 A;  2F42 A;  2JEE A;  1L4A C;  3LQH A;  4S3O B;  2K4D A;  1JY3 N;  1N73 B;  2MNZ A;  5KJ7 C;  3LQJ A;  2HOD B;  3ZPV E;  3HTK C;  2CPB A;  3KNV A;  3GHG C;  2OYI B;  3V2R A;  2H0D B;  2KIZ A;  1FZG A;  2WT7 B;  2C9N Y;  1XTC C;  2FKW B;  3VP9 A;  3P8M C;  2LXH C;  3LRQ A;  1F62 A;  4V3L C;  2N1T C;  4LAD B;  4YC9 A;  1FBV A;  2YSJ A;  1WFK A;  1LT9 C;  4HH2 A;  1T3J A;  4WY4 A;  1CI6 B;  1LTS C;  1JM7 B;  5FB1 A;  3VK6 A;  5APT A;  5CHX A;  3A7O A;  5APX A;  2KGI A;  1SFC D;  4IFF A;  1H8A A;  1GD2 E;  5B76 A;  4B86 A;  3BAS A;  3KQG A;  3EFG A;  1IK9 A;  4NN2 A;  2KR4 A;  1HYI A;  1G2C A;  1Z2Q A;  4N78 D;  2PUY A;  4YAB A;  1KQL A;  3O36 A;  1KZU B;  1ZV8 A;  5AW0 B;  3UIA A;  2FYZ A;  3SOU A;  2CPS A;  5AIT A;  2XNX A;  1DX7 A;  3HE4 A;  1NKN A;  1IFJ A;  1JY3 P;  5AW2 B;  1H88 A;  1MM2 A;  2XZR A;  2DX8 A;  5B75 A;  2OYH C;  1AQ5 A;  2W27 A;  2POH A;  1L4A B;  4IC3 A;  2I1K A;  4KHX A;  3DQV R;  1JOC A;  4FIP A;  3M9Q A;  2PNX A;  4L58 A;  1IC2 A;  2NPS D;  3U5N A;  1DEB A;  2M85 A;  2G6Q A;  3M62 A;  4B7Y C;  3ZTG A;  5AW3 B;  1YYC A;  2XB1 A;  4FO9 A;  4YAT A;  2N1T B;  1A02 F;  4YAD A;  2CT2 A;  5LKZ A;  1LWU C;  5CCG C;  3VTP C;  3HD7 C;  4TKP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...