2YHNA

The idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
VLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MYLIP
publication title The Idol-Ube2D Complex Mediates Sterol-Dependent Degradation of the Ldl Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yhnA00
4GNDA 2M85A 2KGGA 4UP0A 2ZETC 2KR4A 4LKAA 2E6SA 5EYAF 4F52B 1MM3A 1F62A 4QF2A 4YABA 2FSAA 5G05B 2YREA 3U5NA 1WEEA 5TDWA 3ZPVE 2L75A 5H1VA 2L0BA 2F42A 2Y1MA 2C2LA 1WEWA 3O33A 2FUUA 3C6WA 2M6MA 4C9ZA 2I50A 2MD7B 4A4BA 4V3LC 1FBVA 4L58A 2JRJA 2DX8A 4Q6FA 1HYIA 1MM2A 2NAAA 4LLBA 2LGVA 2YSMA 2KWJA 2VJEA 2MA6A 5I3LA 3L1XA 1FP0A 3O70A 3U5PA 3N9MA 3ASLA 3SOWA 2YUCA 4BHWA 2QIZA 3GL6A 3LQJA 4WA6A 2JMJA 4FJCA 5FEYA 3M63A 3KQIA 4ZUXU 1DVPA 4AVXA 2YHOA 4X3GA 4R8PK 3U5MA 2VPBA 5FB0A 2BAYA 1ZBDB 2LN0A 2M1RA 3L11A 2KU3A 2IDAA 2MNYA 3N9NA 3ZYQA 4YAXA 1WEMA 1X4UA 5AIUA 5TABA 1X4JA 2K17A 1T1HA 2K16A 2ECGA 2YURA 5D1KB 2UZGA 5B76A 2KE1A 3M99A 5B8DA 3I2DA 2G6QA 2QICA 1CHCA 2KYUA 2KIZA 1WGMA 3SHBA 3KV5A 3PHDA 4LJNA 3HTKC 1V87A 2EGPA 4N4FA 2LGGA 2CSYA 1WIMA 5C11A 1JM7B 4BBQA 2MIQA 2VPEA 3T6RA 1WILA 2XEUA 2MNZA 2FUIA 5C13A 2KFTA 1Z60A 4O64A 4P5OB 1XWHA 1VYXA 1WEVA 2VJFB 4MVTA 3ZVZB 2LGKA 1JM7A 3ZTGA 3EB5A 2KGIA 3VK6A 4FO9A 4IC3A 4GNEA 4AYCB 3O36A 4WZ0A 3PURA 2YSJA 5J3XA 1U6GB 5B77A 4YBSA 4W4UA 4YC9A 3NG2A 2D8SA 5LKTA 5DINA 2K4DA 5TBNA 2JMDA 1VFYA 2MT5A 2PNXA 3RPGC 2RI7A 3T7LA 2Y43A 3DQVR 3M62A 1Z2QA 2H0DB 2CT2A 2KWOA 3HCSA 4B7YC 3RTRB 1BORA 5D1MB 3ZNIA 4XI1A 2ECVA 2HYED 4PPEA 2YW8A 1WENA 2ECNA 3ZVYA 5D1LB 4CCGX 2LQ6A 3KNVA 2ECJA 5KH9A 3MHHA 3O34A 1VD4A 4WZ3B 4QF3A 5H9MA 2VPGA 2LXHC 4AUQB 4S3OB 5LKZA 2LGLA 2F6NA 2OXQC 5G04B 2G45A 2G43A 4R2YA 1N87A 5G0FA 1K2FA 4FK5A 5TRBA 4A0CD 4LK9A 5B75A 3O35A 3QZVA 2L80A 5LKUA 5KH3A 2ECWA 3N9PA 4ZDTA 4YBTA 2CKLB 4L7XA 2KREA 4AP4A 1WEPA 3N9LA 4MSXA 3LRQA 2E6RA 2PUYA 3EB6A 5JG6A 2QJ0A 2ECIA 4YATA 5H1TA 5B79A 2ECTA 4GNGA 2LDRA 2CKLA 5DKAA 2HDPA 2F6JA 2RSDA 3SOUA 1Z6UA 3ZPV1 3GV4A 3U5OA 2MUMA 1RMDA 1WEOA 4I7CA 4FIPA 4WZ2A 3HCUA 3O7AA 5TDRA 2YHNA 4LADB 4UI9B 4I7DA 2LRIC 2KWNA 2C2VS 4YBMA 3DPLR 2VJFA 4YADA 1JOCA 4TKPB 4UP5A 3O37A 2L43A 4A49A 3V43A 4PTBA 5LKXA 3C5KA 2VJEB 4AYCA 2CSZA 1X4IA 3FL2A 4B86C 3MHSA 2YT5A 3N9OA 4R7EA 4ZQLA 1WESA 2Y1NA 4I7BA 2XB1A 2LV9A 3LQIA 4N3WA 1WE9A 3L1ZB 1IYMA 5FB1A 2VP7A 4GNFA 2VNFA 3LQHA 3RPGB 2M3HA 4V3KC 1G25A 2H0DA 4IC2A 4A4CA 2MA5A 1WEQA 4CA1A 5KH7A 5B78A 1E4UA 5FERA 2LXPC 1WEUA 1LDJB 2MD8C 5H1UA 4S3OC 2VPDA 3HCTA 2L5UA 3PUQA 2YQMA 1HYJA 2EA6A 3KV6A 2KWKA 3N9QA 2YQLA 1WFKA 4GB0A 3IHPA 2JMIA 1LDKC 2EODA 2K1JA 5AITA 2YYRA 3SOXA 5LCWB 2YU4A 2AN6A 4NN2A
chains in the Genus database with same CATH superfamily
2IQJA 4GNDA 2M85A 2KGGA 4UP0A 2ZETC 2KR4A 4LKAA 2XOZA 2E6SA 2LAUA 5EYAF 4F52B 1MM3A 1F62A 4QF2A 4YABA 2FSAA 3JUEA 4QQ4A 5G05B 2YREA 3U5NA 1WEEA 5TDWA 3ZPVE 3LVQE 2L75A 5H1VA 2L0BA 4H9DA 2F42A 2B0OE 2C2LA 2Y1MA 1WEWA 3O33A 2FUUA 3C6WA 2M6MA 4C9ZA 2I50A 2MD7B 4A4BA 4V3LC 1FBVA 5SVIB 4L58A 2JRJA 2DX8A 4Q6FA 1HYIA 1MM2A 2CRRA 2NAAA 4LLBA 2LGVA 2YSMA 2KWJA 2VJEA 2MA6A 5I3LA 3L1XA 1FP0A 3FAOA 3O70A 3U5PA 3N9MA 3ASLA 3FEHA 3SOWA 2YUCA 4BHWA 2QIZA 3GL6A 3LQJA 4WA6A 2JMJA 4FJCA 5FEYA 3M63A 3KQIA 4ZUXU 4OGEA 1DCQA 1DVPA 4AVXA 2YHOA 4X3GA 3FM8C 4R8PK 3U5MA 3KDEC 2VPBA 5FB0A 2BAYA 3FANA 1ZBDB 2LN0A 2M1RA 2OWAA 3L11A 2KU3A 4Z0RA 2IDAA 3Q1DA 2MNYA 5K3QA 3N9NA 3ZYQA 4O62A 4YAXA 1WEMA 2D8UA 3MDBC 1X4UA 5AIUA 5TABA 1X4JA 2EGMA 2K17A 1T1HA 3H7HA 2K16A 2ECGA 2YURA 5D1KB 2UZGA 3SUBA 5B76A 2KE1A 3M99A 5B8DA 3I2DA 2M13A 2EXUA 2G6QA 2QICA 3PLWA 1CHCA 2KYUA 2KIZA 1WGMA 3SHBA 3KV5A 3PHDA 4LJNA 3HTKC 1V87A 2EGPA 4N4FA 2LGGA 2CSYA 1WIMA 5C11A 1JM7B 4BBQA 2MIQA 2VPEA 3T6RA 1WILA 2XEUA 2MNZA 2FUIA 5C13A 2KFTA 1Z60A 2JM3A 4O64A 4P5OB 1XWHA 1VYXA 1WEVA 2VJFB 4MVTA 3ZVZB 2KKYA 2LGKA 1JM7A 2YVRA 3ZTGA 3EB5A 2KGIA 3VK6A 4FO9A 4IC3A 5SVXA 4GNEA 2L7PA 4AYCB 3O36A 4WZ0A 3PURA 2YSJA 5J3XA 1U6GB 2P57A 5SVIA 5B77A 3DDTA 4YBSA 4W4UA 4YC9A 3NG2A 2D8SA 2CONA 2E61A 5LKTA 2DSMA 5DINA 2K4DA 5TBNA 2JMDA 1VFYA 2MT5A 2PNXA 3RPGC 2RI7A 3T7LA 2Y43A 3DQVR 3M62A 1Z2QA 2H0DB 2CT2A 2KWOA 3HCSA 4B7YC 3RTRB 1BORA 5D1MB 2KKXA 3ZNIA 4XI1A 2ECVA 2HYED 4PPEA 2YW8A 1WENA 2ECNA 3T9KA 3ZVYA 5D1LB 4CCGX 2LQ6A 3KNVA 2ECJA 5KH9A 3MHHA 3O34A 1VD4A 4WZ3B 4QF3A 5H9MA 2VPGA 2LXHC 4AUQB 4S3OB 5LKZA 1MBMA 2LGLA 2F6NA 2OXQC 5G04B 2G45A 2G43A 4R2YA 1N87A 2XP0A 3M7KA 5G0FA 1K2FA 4FK5A 5TRBA 4A0CD 4LK9A 5B75A 3O35A 3QZVA 2XOCA 2CSVA 2L80A 2JUNA 5LKUA 5KH3A 2ECWA 3N9PA 4ZDTA 4YBTA 2CKLB 4L7XA 2KREA 4AP4A 1WEPA 3N9LA 4MSXA 3LRQA 2E6RA 2PUYA 3EB6A 5JG6A 2QJ0A 2ECIA 4F1PA 4Z0OA 4YATA 5H1TA 5B79A 2ECTA 4GNGA 2LDRA 3E2DA 2CKLA 3DWDA 5DKAA 2HDPA 2F6JA 2RSDA 3SOUA 1Z6UA 3ZPV1 3GV4A 3U5OA 2MUMA 1RMDA 1WEOA 4I7CA 4FIPA 4WZ2A 3HCUA 3O7AA 5TDRA 2YHNA 4LADB 4UI9B 4I7DA 2LRIC 2KWNA 2C2VS 4YBMA 3DPLR 2VJFA 4YADA 3LDYA 1JOCA 4TKPB 4UP5A 3O37A 2L43A 4A49A 3V43A 4PTBA 3LJUX 5LKXA 3C5KA 2VJEB 4AYCA 2CSZA 1X4IA 2DJAA 3FJUB 3FL2A 4B86C 3MHSA 2MKEA 2YT5A 3N9OA 4R7EA 4ZQLA 1WESA 2Y1NA 4I7BA 2XB1A 2LV9A 3LQIA 4N3WA 1WE9A 3LVRE 3L1ZB 1IYMA 5FB1A 2VP7A 4GNFA 2VNFA 3LQHA 3RPGB 2M3HA 4V3KC 1G25A 2H0DA 4IC2A 4A4CA 2MA5A 1WEQA 5SVYA 4CA1A 2XOYA 5KH7A 5B78A 1E4UA 5FERA 2CRWA 2LXPC 1WEUA 1LDJB 2MD8C 5H1UA 4OGCA 2VPDA 4S3OC 3HCTA 2FFWA 2L5UA 3PUQA 2FD4A 2YQMA 1HYJA 2EA6A 3KV6A 2KWKA 3N9QA 2YQLA 1WFKA 4GB0A 3IHPA 2JMIA 2RR4A 1LDKC 2EODA 2K1JA 5AITA 2YYRA 3SOXA 5LCWB 3O47A 2YU4A 2AN6A 4NN2A
chains in the Genus database with same CATH topology
4GNDA 2M85A 2KGGA 4UP0A 2ZETC 2KR4A 4LKAA 2E6SA 5EYAF 4F52B 1MM3A 1F62A 4QF2A 4YABA 2FSAA 5G05B 2YREA 3U5NA 1WEEA 5TDWA 3ZPVE 2L75A 5H1VA 2L0BA 2F42A 2Y1MA 2C2LA 1WEWA 3O33A 2FUUA 3C6WA 2M6MA 4C9ZA 2I50A 2MD7B 4A4BA 4V3LC 1FBVA 4L58A 2JRJA 2DX8A 4Q6FA 1HYIA 1MM2A 2NAAA 4LLBA 2LGVA 2YSMA 2KWJA 2VJEA 2MA6A 5I3LA 3L1XA 1FP0A 3O70A 3U5PA 3N9MA 3ASLA 3SOWA 2YUCA 4BHWA 2QIZA 3GL6A 3LQJA 4WA6A 2JMJA 4FJCA 5FEYA 3M63A 3KQIA 4ZUXU 1DVPA 4AVXA 2YHOA 4X3GA 4R8PK 3U5MA 2VPBA 5FB0A 2BAYA 1ZBDB 2LN0A 2M1RA 3L11A 2KU3A 2IDAA 2MNYA 3N9NA 3ZYQA 4YAXA 1WEMA 1X4UA 5AIUA 5TABA 1X4JA 2K17A 1T1HA 2K16A 2ECGA 2YURA 5D1KB 2UZGA 5B76A 2KE1A 3M99A 5B8DA 3I2DA 2G6QA 2QICA 1CHCA 2KYUA 2KIZA 1WGMA 3SHBA 3KV5A 3PHDA 4LJNA 3HTKC 1V87A 2EGPA 4N4FA 2LGGA 2CSYA 1WIMA 5C11A 1JM7B 4BBQA 2MIQA 2VPEA 3T6RA 1WILA 2XEUA 2MNZA 2FUIA 5C13A 2KFTA 1Z60A 4O64A 4P5OB 1XWHA 1VYXA 1WEVA 2VJFB 4MVTA 3ZVZB 2LGKA 1JM7A 3ZTGA 3EB5A 2KGIA 3VK6A 4FO9A 4IC3A 4GNEA 4AYCB 3O36A 4WZ0A 3PURA 2YSJA 5J3XA 1U6GB 5B77A 4YBSA 4W4UA 4YC9A 3NG2A 2D8SA 5LKTA 5DINA 2K4DA 5TBNA 2JMDA 1VFYA 2MT5A 2PNXA 3RPGC 2RI7A 3T7LA 2Y43A 3DQVR 3M62A 1Z2QA 2H0DB 2CT2A 2KWOA 3HCSA 4B7YC 3RTRB 1BORA 5D1MB 3ZNIA 4XI1A 2ECVA 2HYED 4PPEA 2YW8A 1WENA 2ECNA 3ZVYA 5D1LB 4CCGX 2LQ6A 3KNVA 2ECJA 5KH9A 3MHHA 3O34A 1VD4A 4WZ3B 4QF3A 5H9MA 2VPGA 2LXHC 4AUQB 4S3OB 5LKZA 2LGLA 2F6NA 2OXQC 5G04B 2G45A 2G43A 4R2YA 1N87A 5G0FA 1K2FA 4FK5A 5TRBA 4A0CD 4LK9A 5B75A 3O35A 3QZVA 2L80A 5LKUA 5KH3A 2ECWA 3N9PA 4ZDTA 4YBTA 2CKLB 4L7XA 2KREA 4AP4A 1WEPA 3N9LA 4MSXA 3LRQA 2E6RA 2PUYA 3EB6A 5JG6A 2QJ0A 2ECIA 4YATA 5H1TA 5B79A 2ECTA 4GNGA 2LDRA 2CKLA 5DKAA 2HDPA 2F6JA 2RSDA 3SOUA 1Z6UA 3ZPV1 3GV4A 3U5OA 2MUMA 1RMDA 1WEOA 4I7CA 4FIPA 4WZ2A 3HCUA 3O7AA 5TDRA 2YHNA 4LADB 4UI9B 4I7DA 2LRIC 2KWNA 2C2VS 4YBMA 3DPLR 2VJFA 4YADA 1JOCA 4TKPB 4UP5A 3O37A 2L43A 4A49A 3V43A 4PTBA 5LKXA 3C5KA 2VJEB 4AYCA 2CSZA 1X4IA 3FL2A 4B86C 3MHSA 2YT5A 3N9OA 4R7EA 4ZQLA 1WESA 2Y1NA 4I7BA 2XB1A 2LV9A 3LQIA 4N3WA 1WE9A 3L1ZB 1IYMA 5FB1A 2VP7A 4GNFA 2VNFA 3LQHA 3RPGB 2M3HA 4V3KC 1G25A 2H0DA 4IC2A 4A4CA 2MA5A 1WEQA 4CA1A 5KH7A 5B78A 1E4UA 5FERA 2LXPC 1WEUA 1LDJB 2MD8C 5H1UA 4S3OC 2VPDA 3HCTA 2L5UA 3PUQA 2YQMA 1HYJA 2EA6A 3KV6A 2KWKA 3N9QA 2YQLA 1WFKA 4GB0A 3IHPA 2JMIA 1LDKC 2EODA 2K1JA 5AITA 2YYRA 3SOXA 5LCWB 2YU4A 2AN6A 4NN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GND A;  2M85 A;  2KGG A;  4UP0 A;  2ZET C;  2KR4 A;  4LKA A;  2E6S A;  5EYA F;  4F52 B;  1MM3 A;  1F62 A;  4QF2 A;  4YAB A;  2FSA A;  5G05 B;  2YRE A;  3U5N A;  1WEE A;  5TDW A;  3ZPV E;  2L75 A;  5H1V A;  2L0B A;  2F42 A;  2Y1M A;  2C2L A;  1WEW A;  3O33 A;  2FUU A;  3C6W A;  2M6M A;  4C9Z A;  2I50 A;  2MD7 B;  4A4B A;  4V3L C;  1FBV A;  4L58 A;  2JRJ A;  2DX8 A;  4Q6F A;  1HYI A;  1MM2 A;  2NAA A;  4LLB A;  2LGV A;  2YSM A;  2KWJ A;  2VJE A;  2MA6 A;  5I3L A;  3L1X A;  1FP0 A;  3O70 A;  3U5P A;  3N9M A;  3ASL A;  3SOW A;  2YUC A;  4BHW A;  2QIZ A;  3GL6 A;  3LQJ A;  4WA6 A;  2JMJ A;  4FJC A;  5FEY A;  3M63 A;  3KQI A;  4ZUX U;  1DVP A;  4AVX A;  2YHO A;  4X3G A;  4R8P K;  3U5M A;  2VPB A;  5FB0 A;  2BAY A;  1ZBD B;  2LN0 A;  2M1R A;  3L11 A;  2KU3 A;  2IDA A;  2MNY A;  3N9N A;  3ZYQ A;  4YAX A;  1WEM A;  1X4U A;  5AIU A;  5TAB A;  1X4J A;  2K17 A;  1T1H A;  2K16 A;  2ECG A;  2YUR A;  5D1K B;  2UZG A;  5B76 A;  2KE1 A;  3M99 A;  5B8D A;  3I2D A;  2G6Q A;  2QIC A;  1CHC A;  2KYU A;  2KIZ A;  1WGM A;  3SHB A;  3KV5 A;  3PHD A;  4LJN A;  3HTK C;  1V87 A;  2EGP A;  4N4F A;  2LGG A;  2CSY A;  1WIM A;  5C11 A;  1JM7 B;  4BBQ A;  2MIQ A;  2VPE A;  3T6R A;  1WIL A;  2XEU A;  2MNZ A;  2FUI A;  5C13 A;  2KFT A;  1Z60 A;  4O64 A;  4P5O B;  1XWH A;  1VYX A;  1WEV A;  2VJF B;  4MVT A;  3ZVZ B;  2LGK A;  1JM7 A;  3ZTG A;  3EB5 A;  2KGI A;  3VK6 A;  4FO9 A;  4IC3 A;  4GNE A;  4AYC B;  3O36 A;  4WZ0 A;  3PUR A;  2YSJ A;  5J3X A;  1U6G B;  5B77 A;  4YBS A;  4W4U A;  4YC9 A;  3NG2 A;  2D8S A;  5LKT A;  5DIN A;  2K4D A;  5TBN A;  2JMD A;  1VFY A;  2MT5 A;  2PNX A;  3RPG C;  2RI7 A;  3T7L A;  2Y43 A;  3DQV R;  3M62 A;  1Z2Q A;  2H0D B;  2CT2 A;  2KWO A;  3HCS A;  4B7Y C;  3RTR B;  1BOR A;  5D1M B;  3ZNI A;  4XI1 A;  2ECV A;  2HYE D;  4PPE A;  2YW8 A;  1WEN A;  2ECN A;  3ZVY A;  5D1L B;  4CCG X;  2LQ6 A;  3KNV A;  2ECJ A;  5KH9 A;  3MHH A;  3O34 A;  1VD4 A;  4WZ3 B;  4QF3 A;  5H9M A;  2VPG A;  2LXH C;  4AUQ B;  4S3O B;  5LKZ A;  2LGL A;  2F6N A;  2OXQ C;  5G04 B;  2G45 A;  2G43 A;  4R2Y A;  1N87 A;  5G0F A;  1K2F A;  4FK5 A;  5TRB A;  4A0C D;  4LK9 A;  5B75 A;  3O35 A;  3QZV A;  2L80 A;  5LKU A;  5KH3 A;  2ECW A;  3N9P A;  4ZDT A;  4YBT A;  2CKL B;  4L7X A;  2KRE A;  4AP4 A;  1WEP A;  3N9L A;  4MSX A;  3LRQ A;  2E6R A;  2PUY A;  3EB6 A;  5JG6 A;  2QJ0 A;  2ECI A;  4YAT A;  5H1T A;  5B79 A;  2ECT A;  4GNG A;  2LDR A;  2CKL A;  5DKA A;  2HDP A;  2F6J A;  2RSD A;  3SOU A;  1Z6U A;  3ZPV 1;  3GV4 A;  3U5O A;  2MUM A;  1RMD A;  1WEO A;  4I7C A;  4FIP A;  4WZ2 A;  3HCU A;  3O7A A;  5TDR A;  2YHN A;  4LAD B;  4UI9 B;  4I7D A;  2LRI C;  2KWN A;  2C2V S;  4YBM A;  3DPL R;  2VJF A;  4YAD A;  1JOC A;  4TKP B;  4UP5 A;  3O37 A;  2L43 A;  4A49 A;  3V43 A;  4PTB A;  5LKX A;  3C5K A;  2VJE B;  4AYC A;  2CSZ A;  1X4I A;  3FL2 A;  4B86 C;  3MHS A;  2YT5 A;  3N9O A;  4R7E A;  4ZQL A;  1WES A;  2Y1N A;  4I7B A;  2XB1 A;  2LV9 A;  3LQI A;  4N3W A;  1WE9 A;  3L1Z B;  1IYM A;  5FB1 A;  2VP7 A;  4GNF A;  2VNF A;  3LQH A;  3RPG B;  2M3H A;  4V3K C;  1G25 A;  2H0D A;  4IC2 A;  4A4C A;  2MA5 A;  1WEQ A;  4CA1 A;  5KH7 A;  5B78 A;  1E4U A;  5FER A;  2LXP C;  1WEU A;  1LDJ B;  2MD8 C;  5H1U A;  4S3O C;  2VPD A;  3HCT A;  2L5U A;  3PUQ A;  2YQM A;  1HYJ A;  2EA6 A;  3KV6 A;  2KWK A;  3N9Q A;  2YQL A;  1WFK A;  4GB0 A;  3IHP A;  2JMI A;  1LDK C;  2EOD A;  2K1J A;  5AIT A;  2YYR A;  3SOX A;  5LCW B;  2YU4 A;  2AN6 A;  4NN2 A; 
#chains in the Genus database with same CATH topology
 2IQJ A;  4GND A;  2M85 A;  2KGG A;  4UP0 A;  2ZET C;  2KR4 A;  4LKA A;  2XOZ A;  2E6S A;  2LAU A;  5EYA F;  4F52 B;  1MM3 A;  1F62 A;  4QF2 A;  4YAB A;  2FSA A;  3JUE A;  4QQ4 A;  5G05 B;  2YRE A;  3U5N A;  1WEE A;  5TDW A;  3ZPV E;  3LVQ E;  2L75 A;  5H1V A;  2L0B A;  4H9D A;  2F42 A;  2B0O E;  2C2L A;  2Y1M A;  1WEW A;  3O33 A;  2FUU A;  3C6W A;  2M6M A;  4C9Z A;  2I50 A;  2MD7 B;  4A4B A;  4V3L C;  1FBV A;  5SVI B;  4L58 A;  2JRJ A;  2DX8 A;  4Q6F A;  1HYI A;  1MM2 A;  2CRR A;  2NAA A;  4LLB A;  2LGV A;  2YSM A;  2KWJ A;  2VJE A;  2MA6 A;  5I3L A;  3L1X A;  1FP0 A;  3FAO A;  3O70 A;  3U5P A;  3N9M A;  3ASL A;  3FEH A;  3SOW A;  2YUC A;  4BHW A;  2QIZ A;  3GL6 A;  3LQJ A;  4WA6 A;  2JMJ A;  4FJC A;  5FEY A;  3M63 A;  3KQI A;  4ZUX U;  4OGE A;  1DCQ A;  1DVP A;  4AVX A;  2YHO A;  4X3G A;  3FM8 C;  4R8P K;  3U5M A;  3KDE C;  2VPB A;  5FB0 A;  2BAY A;  3FAN A;  1ZBD B;  2LN0 A;  2M1R A;  2OWA A;  3L11 A;  2KU3 A;  4Z0R A;  2IDA A;  3Q1D A;  2MNY A;  5K3Q A;  3N9N A;  3ZYQ A;  4O62 A;  4YAX A;  1WEM A;  2D8U A;  3MDB C;  1X4U A;  5AIU A;  5TAB A;  1X4J A;  2EGM A;  2K17 A;  1T1H A;  3H7H A;  2K16 A;  2ECG A;  2YUR A;  5D1K B;  2UZG A;  3SUB A;  5B76 A;  2KE1 A;  3M99 A;  5B8D A;  3I2D A;  2M13 A;  2EXU A;  2G6Q A;  2QIC A;  3PLW A;  1CHC A;  2KYU A;  2KIZ A;  1WGM A;  3SHB A;  3KV5 A;  3PHD A;  4LJN A;  3HTK C;  1V87 A;  2EGP A;  4N4F A;  2LGG A;  2CSY A;  1WIM A;  5C11 A;  1JM7 B;  4BBQ A;  2MIQ A;  2VPE A;  3T6R A;  1WIL A;  2XEU A;  2MNZ A;  2FUI A;  5C13 A;  2KFT A;  1Z60 A;  2JM3 A;  4O64 A;  4P5O B;  1XWH A;  1VYX A;  1WEV A;  2VJF B;  4MVT A;  3ZVZ B;  2KKY A;  2LGK A;  1JM7 A;  2YVR A;  3ZTG A;  3EB5 A;  2KGI A;  3VK6 A;  4FO9 A;  4IC3 A;  5SVX A;  4GNE A;  2L7P A;  4AYC B;  3O36 A;  4WZ0 A;  3PUR A;  2YSJ A;  5J3X A;  1U6G B;  2P57 A;  5SVI A;  5B77 A;  3DDT A;  4YBS A;  4W4U A;  4YC9 A;  3NG2 A;  2D8S A;  2CON A;  2E61 A;  5LKT A;  2DSM A;  5DIN A;  2K4D A;  5TBN A;  2JMD A;  1VFY A;  2MT5 A;  2PNX A;  3RPG C;  2RI7 A;  3T7L A;  2Y43 A;  3DQV R;  3M62 A;  1Z2Q A;  2H0D B;  2CT2 A;  2KWO A;  3HCS A;  4B7Y C;  3RTR B;  1BOR A;  5D1M B;  2KKX A;  3ZNI A;  4XI1 A;  2ECV A;  2HYE D;  4PPE A;  2YW8 A;  1WEN A;  2ECN A;  3T9K A;  3ZVY A;  5D1L B;  4CCG X;  2LQ6 A;  3KNV A;  2ECJ A;  5KH9 A;  3MHH A;  3O34 A;  1VD4 A;  4WZ3 B;  4QF3 A;  5H9M A;  2VPG A;  2LXH C;  4AUQ B;  4S3O B;  5LKZ A;  1MBM A;  2LGL A;  2F6N A;  2OXQ C;  5G04 B;  2G45 A;  2G43 A;  4R2Y A;  1N87 A;  2XP0 A;  3M7K A;  5G0F A;  1K2F A;  4FK5 A;  5TRB A;  4A0C D;  4LK9 A;  5B75 A;  3O35 A;  3QZV A;  2XOC A;  2CSV A;  2L80 A;  2JUN A;  5LKU A;  5KH3 A;  2ECW A;  3N9P A;  4ZDT A;  4YBT A;  2CKL B;  4L7X A;  2KRE A;  4AP4 A;  1WEP A;  3N9L A;  4MSX A;  3LRQ A;  2E6R A;  2PUY A;  3EB6 A;  5JG6 A;  2QJ0 A;  2ECI A;  4F1P A;  4Z0O A;  4YAT A;  5H1T A;  5B79 A;  2ECT A;  4GNG A;  2LDR A;  3E2D A;  2CKL A;  3DWD A;  5DKA A;  2HDP A;  2F6J A;  2RSD A;  3SOU A;  1Z6U A;  3ZPV 1;  3GV4 A;  3U5O A;  2MUM A;  1RMD A;  1WEO A;  4I7C A;  4FIP A;  4WZ2 A;  3HCU A;  3O7A A;  5TDR A;  2YHN A;  4LAD B;  4UI9 B;  4I7D A;  2LRI C;  2KWN A;  2C2V S;  4YBM A;  3DPL R;  2VJF A;  4YAD A;  3LDY A;  1JOC A;  4TKP B;  4UP5 A;  3O37 A;  2L43 A;  4A49 A;  3V43 A;  4PTB A;  3LJU X;  5LKX A;  3C5K A;  2VJE B;  4AYC A;  2CSZ A;  1X4I A;  2DJA A;  3FJU B;  3FL2 A;  4B86 C;  3MHS A;  2MKE A;  2YT5 A;  3N9O A;  4R7E A;  4ZQL A;  1WES A;  2Y1N A;  4I7B A;  2XB1 A;  2LV9 A;  3LQI A;  4N3W A;  1WE9 A;  3LVR E;  3L1Z B;  1IYM A;  5FB1 A;  2VP7 A;  4GNF A;  2VNF A;  3LQH A;  3RPG B;  2M3H A;  4V3K C;  1G25 A;  2H0D A;  4IC2 A;  4A4C A;  2MA5 A;  1WEQ A;  5SVY A;  4CA1 A;  2XOY A;  5KH7 A;  5B78 A;  1E4U A;  5FER A;  2CRW A;  2LXP C;  1WEU A;  1LDJ B;  2MD8 C;  5H1U A;  4OGC A;  2VPD A;  4S3O C;  3HCT A;  2FFW A;  2L5U A;  3PUQ A;  2FD4 A;  2YQM A;  1HYJ A;  2EA6 A;  3KV6 A;  2KWK A;  3N9Q A;  2YQL A;  1WFK A;  4GB0 A;  3IHP A;  2JMI A;  2RR4 A;  1LDK C;  2EOD A;  2K1J A;  5AIT A;  2YYR A;  3SOX A;  5LCW B;  3O47 A;  2YU4 A;  2AN6 A;  4NN2 A; 
#chains in the Genus database with same CATH homology
 4GND A;  2M85 A;  2KGG A;  4UP0 A;  2ZET C;  2KR4 A;  4LKA A;  2E6S A;  5EYA F;  4F52 B;  1MM3 A;  1F62 A;  4QF2 A;  4YAB A;  2FSA A;  5G05 B;  2YRE A;  3U5N A;  1WEE A;  5TDW A;  3ZPV E;  2L75 A;  5H1V A;  2L0B A;  2F42 A;  2Y1M A;  2C2L A;  1WEW A;  3O33 A;  2FUU A;  3C6W A;  2M6M A;  4C9Z A;  2I50 A;  2MD7 B;  4A4B A;  4V3L C;  1FBV A;  4L58 A;  2JRJ A;  2DX8 A;  4Q6F A;  1HYI A;  1MM2 A;  2NAA A;  4LLB A;  2LGV A;  2YSM A;  2KWJ A;  2VJE A;  2MA6 A;  5I3L A;  3L1X A;  1FP0 A;  3O70 A;  3U5P A;  3N9M A;  3ASL A;  3SOW A;  2YUC A;  4BHW A;  2QIZ A;  3GL6 A;  3LQJ A;  4WA6 A;  2JMJ A;  4FJC A;  5FEY A;  3M63 A;  3KQI A;  4ZUX U;  1DVP A;  4AVX A;  2YHO A;  4X3G A;  4R8P K;  3U5M A;  2VPB A;  5FB0 A;  2BAY A;  1ZBD B;  2LN0 A;  2M1R A;  3L11 A;  2KU3 A;  2IDA A;  2MNY A;  3N9N A;  3ZYQ A;  4YAX A;  1WEM A;  1X4U A;  5AIU A;  5TAB A;  1X4J A;  2K17 A;  1T1H A;  2K16 A;  2ECG A;  2YUR A;  5D1K B;  2UZG A;  5B76 A;  2KE1 A;  3M99 A;  5B8D A;  3I2D A;  2G6Q A;  2QIC A;  1CHC A;  2KYU A;  2KIZ A;  1WGM A;  3SHB A;  3KV5 A;  3PHD A;  4LJN A;  3HTK C;  1V87 A;  2EGP A;  4N4F A;  2LGG A;  2CSY A;  1WIM A;  5C11 A;  1JM7 B;  4BBQ A;  2MIQ A;  2VPE A;  3T6R A;  1WIL A;  2XEU A;  2MNZ A;  2FUI A;  5C13 A;  2KFT A;  1Z60 A;  4O64 A;  4P5O B;  1XWH A;  1VYX A;  1WEV A;  2VJF B;  4MVT A;  3ZVZ B;  2LGK A;  1JM7 A;  3ZTG A;  3EB5 A;  2KGI A;  3VK6 A;  4FO9 A;  4IC3 A;  4GNE A;  4AYC B;  3O36 A;  4WZ0 A;  3PUR A;  2YSJ A;  5J3X A;  1U6G B;  5B77 A;  4YBS A;  4W4U A;  4YC9 A;  3NG2 A;  2D8S A;  5LKT A;  5DIN A;  2K4D A;  5TBN A;  2JMD A;  1VFY A;  2MT5 A;  2PNX A;  3RPG C;  2RI7 A;  3T7L A;  2Y43 A;  3DQV R;  3M62 A;  1Z2Q A;  2H0D B;  2CT2 A;  2KWO A;  3HCS A;  4B7Y C;  3RTR B;  1BOR A;  5D1M B;  3ZNI A;  4XI1 A;  2ECV A;  2HYE D;  4PPE A;  2YW8 A;  1WEN A;  2ECN A;  3ZVY A;  5D1L B;  4CCG X;  2LQ6 A;  3KNV A;  2ECJ A;  5KH9 A;  3MHH A;  3O34 A;  1VD4 A;  4WZ3 B;  4QF3 A;  5H9M A;  2VPG A;  2LXH C;  4AUQ B;  4S3O B;  5LKZ A;  2LGL A;  2F6N A;  2OXQ C;  5G04 B;  2G45 A;  2G43 A;  4R2Y A;  1N87 A;  5G0F A;  1K2F A;  4FK5 A;  5TRB A;  4A0C D;  4LK9 A;  5B75 A;  3O35 A;  3QZV A;  2L80 A;  5LKU A;  5KH3 A;  2ECW A;  3N9P A;  4ZDT A;  4YBT A;  2CKL B;  4L7X A;  2KRE A;  4AP4 A;  1WEP A;  3N9L A;  4MSX A;  3LRQ A;  2E6R A;  2PUY A;  3EB6 A;  5JG6 A;  2QJ0 A;  2ECI A;  4YAT A;  5H1T A;  5B79 A;  2ECT A;  4GNG A;  2LDR A;  2CKL A;  5DKA A;  2HDP A;  2F6J A;  2RSD A;  3SOU A;  1Z6U A;  3ZPV 1;  3GV4 A;  3U5O A;  2MUM A;  1RMD A;  1WEO A;  4I7C A;  4FIP A;  4WZ2 A;  3HCU A;  3O7A A;  5TDR A;  2YHN A;  4LAD B;  4UI9 B;  4I7D A;  2LRI C;  2KWN A;  2C2V S;  4YBM A;  3DPL R;  2VJF A;  4YAD A;  1JOC A;  4TKP B;  4UP5 A;  3O37 A;  2L43 A;  4A49 A;  3V43 A;  4PTB A;  5LKX A;  3C5K A;  2VJE B;  4AYC A;  2CSZ A;  1X4I A;  3FL2 A;  4B86 C;  3MHS A;  2YT5 A;  3N9O A;  4R7E A;  4ZQL A;  1WES A;  2Y1N A;  4I7B A;  2XB1 A;  2LV9 A;  3LQI A;  4N3W A;  1WE9 A;  3L1Z B;  1IYM A;  5FB1 A;  2VP7 A;  4GNF A;  2VNF A;  3LQH A;  3RPG B;  2M3H A;  4V3K C;  1G25 A;  2H0D A;  4IC2 A;  4A4C A;  2MA5 A;  1WEQ A;  4CA1 A;  5KH7 A;  5B78 A;  1E4U A;  5FER A;  2LXP C;  1WEU A;  1LDJ B;  2MD8 C;  5H1U A;  4S3O C;  2VPD A;  3HCT A;  2L5U A;  3PUQ A;  2YQM A;  1HYJ A;  2EA6 A;  3KV6 A;  2KWK A;  3N9Q A;  2YQL A;  1WFK A;  4GB0 A;  3IHP A;  2JMI A;  1LDK C;  2EOD A;  2K1J A;  5AIT A;  2YYR A;  3SOX A;  5LCW B;  2YU4 A;  2AN6 A;  4NN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...