2YHNA

The idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'VLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MYLIP
publication title The Idol-Ube2D Complex Mediates Sterol-Dependent Degradation of the Ldl Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yhnA00
3HCSA 2LQ6A 5KH9A 4YBMA 4LK9A 4AUQB 4UP0A 2M6MA 2BAYA 5FERA 2FUIA 1WFKA 4AVXA 4N3WA 2PNXA 1WEWA 3HCUA 3HCTA 4MVTA 1MM3A 3C5KA 5B75A 2FSAA 2ECTA 2EODA 2MUMA 2I50A 3FL2A 5H1VA 2LGVA 2ECIA 2C2LA 2Y1NA 4V3LC 2ZETC 1VFYA 4WA6A 3V43A 1VYXA 5FB1A 2KU3A 4LJNA 2KGGA 3HTKC 5J3XA 2CSYA 2MIQA 3RPGC 1LDKC 2XB1A 4A4CA 4FIPA 4QF3A 5G0FA 1LDJB 1F62A 2PUYA 4QF2A 2OXQC 2YURA 2YHNA 3LQJA 3NG2A 2Y43A 2VPGA 2EGPA 2VNFA 5EYAF 4ZQLA 4GNFA 2G6QA 2G43A 5B79A 3ZVYA 3RTRB 3C6WA 5D1KB 4YBSA 1XWHA 3KNVA 2L75A 5H9MA 1K2FA 3O33A 2LN0A 2JRJA 3M99A 2L80A 1JOCA 3SHBA 5AIUA 2E6SA 4LKAA 2F6JA 2EA6A 4XI1A 1N87A 2K16A 3O70A 1WEUA 1Z2QA 2D8SA 4AYCB 5TABA 5H1UA 5B78A 4A4BA 3N9OA 2CKLA 3LQHA 2KR4A 4C9ZA 5LKZA 3ASLA 4WZ2A 2ECWA 2ECGA 2ECVA 5KH3A 4O64A 5C13A 5B76A 1JM7B 3ZTGA 1WESA 1RMDA 2YUCA 2YU4A 4S3OC 3MHHA 3T6RA 4AYCA 1FBVA 3N9QA 1FP0A 3QZVA 4TKPB 1WEQA 3U5OA 3KV6A 4YBTA 5LKXA 3SOXA 3RPGB 2LXPC 4R8PK 2DX8A 4UI9B 1WE9A 2VJEA 1WIMA 4YATA 5LKUA 2FUUA 3GV4A 4YABA 2E6RA 2MA5A 5DKAA 4R7EA 2MNZA 3LQIA 1JM7A 2H0DA 2AN6A 2YQMA 4UP5A 5KH7A 4N4FA 2IDAA 2L5UA 1X4UA 5LCWB 3ZYQA 3IHPA 5TDWA 2RI7A 1WEVA 2F42A 2YHOA 4PTBA 3N9MA 1V87A 2M1RA 4AP4A 1E4UA 4I7DA 3EB6A 2L43A 1U6GB 2VJFB 5C11A 5TRBA 2ECJA 3M63A 1T1HA 2M85A 4FJCA 1MM2A 2YW8A 3EB5A 2CKLB 5B8DA 2KE1A 1Z6UA 4NN2A 4WZ3B 2LGGA 2XEUA 2ECNA 2YT5A 5D1MB 4I7CA 2YSJA 2YYRA 2MD8C 4WZ0A 1WEPA 2YQLA 2KGIA 3PHDA 3ZNIA 4CCGX 2VJFA 3U5PA 2KFTA 1X4JA 5G05B 5D1LB 2LGKA 2QIZA 4GNDA 4FO9A 3LRQA 4GNEA 5B77A 3SOUA 4W4UA 3KV5A 2K17A 3I2DA 4ZUXU 2MT5A 4S3OB 1WEMA 1HYJA 2VJEB 5FB0A 1IYMA 1CHCA 3PUQA 2H0DB 1DVPA 4I7BA 4BBQA 3KQIA 2KWOA 2QJ0A 1Z60A 4LADB 2G45A 1WEOA 3DPLR 5FEYA 2MNYA 4IC2A 4L7XA 4GNGA 5TBNA 2LGLA 5LKTA 3N9LA 4ZDTA 2VPBA 1WEEA 3VK6A 2KIZA 3O7AA 1X4IA 2K4DA 3DQVR 2KREA 1G25A 3ZPVE 4A49A 2JMIA 3M62A 2QICA 2HYED 2M3HA 2LXHC 2UZGA 4YADA 5JG6A 3O35A 2YSMA 2Y1MA 5AITA 3U5NA 3N9NA 3T7LA 2K1JA 2MD7B 1WENA 2CSZA 3ZPV1 2LRIC 4IC3A 4X3GA 4B86C 2JMJA 3N9PA 2LDRA 5TDRA 2CT2A 3L1ZB 4R2YA 2LV9A 3ZVZB 2NAAA 4YAXA 2KWNA 4L58A 2L0BA 4MSXA 1WGMA 2RSDA 4CA1A 2KWKA 5G04B 4Q6FA 4PPEA 5DINA 1BORA 1VD4A 4F52B 5H1TA 2MA6A 2C2VS 4P5OB 4V3KC 2F6NA 2KYUA 1HYIA 4BHWA 3U5MA 2VPDA 2JMDA 3L11A 3O37A 1WILA 4FK5A 1ZBDB 2KWJA 3O34A 2VP7A 2HDPA 3MHSA 2YREA 3GL6A 3PURA 4B7YC 4LLBA 5I3LA 2VPEA 3L1XA 4A0CD 3SOWA 3O36A 4GB0A 4YC9A
chains in the Genus database with same CATH superfamily
3HCSA 2LQ6A 2OWAA 5KH9A 4YBMA 4LK9A 4AUQB 4UP0A 4H9DA 2M6MA 4OGEA 2BAYA 5FERA 3H7HA 5SVIA 2FUIA 1WFKA 4AVXA 4N3WA 2PNXA 2M13A 1WEWA 3HCUA 3HCTA 4MVTA 1MM3A 3C5KA 5B75A 4O62A 2JM3A 2FSAA 2ECTA 2EODA 2MUMA 2I50A 3FL2A 5H1VA 2LGVA 2MKEA 2ECIA 2C2LA 2Y1NA 4V3LC 2ZETC 1VFYA 4WA6A 3V43A 1VYXA 5FB1A 5SVXA 2KU3A 3T9KA 4LJNA 2KGGA 3HTKC 5J3XA 2CSYA 2MIQA 3RPGC 1LDKC 2XB1A 4A4CA 4FIPA 3FEHA 4QF3A 5G0FA 1LDJB 1F62A 2PUYA 4QF2A 2CRWA 2OXQC 2YURA 2YHNA 5SVYA 3LQJA 3NG2A 2Y43A 2VPGA 2EGPA 2VNFA 5EYAF 1DCQA 4ZQLA 5K3QA 4GNFA 2G6QA 2G43A 5B79A 3ZVYA 3RTRB 2EXUA 3C6WA 5D1KB 3FANA 4YBSA 1XWHA 3KNVA 2L75A 5H9MA 3E2DA 1K2FA 3O33A 2LAUA 2LN0A 2JRJA 3M99A 2L80A 1JOCA 3SHBA 5AIUA 2E6SA 4LKAA 2F6JA 2EA6A 4XI1A 1N87A 2K16A 3O70A 1WEUA 1Z2QA 2D8SA 4AYCB 5TABA 5H1UA 5B78A 4A4BA 3N9OA 2CKLA 3LQHA 2KR4A 4C9ZA 5LKZA 3ASLA 4WZ2A 2ECWA 2ECGA 2IQJA 2ECVA 5KH3A 2XOZA 4O64A 3KDEC 3LDYA 5C13A 5B76A 1JM7B 3SUBA 3ZTGA 1WESA 1RMDA 2YUCA 2YU4A 4S3OC 3MHHA 3T6RA 4AYCA 3LVQE 1FBVA 3N9QA 1FP0A 3QZVA 4TKPB 1WEQA 2RR4A 2YVRA 3U5OA 3KV6A 4YBTA 5LKXA 3SOXA 3RPGB 2DSMA 2LXPC 2E61A 4R8PK 2DX8A 4UI9B 1WE9A 2VJEA 1WIMA 4YATA 5LKUA 2FUUA 3DWDA 3GV4A 4YABA 2E6RA 2MA5A 2MNZA 4R7EA 3LQIA 5DKAA 1JM7A 2H0DA 2AN6A 2YQMA 4UP5A 5KH7A 4N4FA 2IDAA 2L5UA 1X4UA 4Z0RA 5LCWB 3ZYQA 3IHPA 2CONA 2KKYA 4OGCA 5TDWA 2RI7A 1WEVA 2EGMA 3Q1DA 2F42A 2YHOA 4PTBA 3N9MA 1V87A 2M1RA 4AP4A 2CRRA 1E4UA 4I7DA 3EB6A 2L43A 1U6GB 2VJFB 5C11A 5TRBA 2ECJA 3M63A 1T1HA 2M85A 4FJCA 1MM2A 2YW8A 2FFWA 3EB5A 2CKLB 2KKXA 5B8DA 2XOCA 2KE1A 1Z6UA 4NN2A 4WZ3B 2LGGA 2XEUA 2ECNA 2YT5A 5D1MB 4I7CA 2YSJA 2YYRA 2MD8C 4WZ0A 1WEPA 2YQLA 2KGIA 3PHDA 3ZNIA 4CCGX 2VJFA 3U5PA 2KFTA 1X4JA 5G05B 5D1LB 2LGKA 2QIZA 4GNDA 4FO9A 3MDBC 3LJUX 3LRQA 4GNEA 5B77A 4W4UA 3SOUA 3KV5A 2K17A 3I2DA 2L7PA 4ZUXU 2MT5A 4S3OB 1WEMA 1HYJA 2VJEB 5FB0A 1IYMA 1CHCA 3PUQA 2H0DB 1DVPA 4I7BA 2JUNA 4BBQA 3KQIA 2KWOA 2QJ0A 1Z60A 4LADB 2G45A 1WEOA 2DJAA 3DPLR 5FEYA 2MNYA 4IC2A 4L7XA 4GNGA 5TBNA 2LGLA 5LKTA 3N9LA 4ZDTA 2VPBA 1WEEA 3VK6A 3O47A 2KIZA 3O7AA 1X4IA 2K4DA 3DQVR 2XOYA 2KREA 1G25A 3ZPVE 3FAOA 4A49A 2JMIA 3M62A 2QICA 2HYED 2D8UA 2M3HA 2LXHC 2UZGA 4YADA 2B0OE 5JG6A 2CSVA 3O35A 3DDTA 2YSMA 2Y1MA 5AITA 3FM8C 3U5NA 3N9NA 3T7LA 2K1JA 2MD7B 1WENA 2CSZA 3ZPV1 1MBMA 2LRIC 4IC3A 4X3GA 4B86C 2JMJA 4QQ4A 3N9PA 2FD4A 2LDRA 5TDRA 2CT2A 3L1ZB 4Z0OA 4R2YA 2LV9A 3ZVZB 4F1PA 2NAAA 4YAXA 2KWNA 4L58A 2L0BA 4MSXA 1WGMA 2RSDA 4CA1A 2KWKA 5G04B 4Q6FA 3JUEA 4PPEA 5DINA 1BORA 1VD4A 4F52B 5H1TA 2MA6A 2P57A 2C2VS 4P5OB 4V3KC 2F6NA 2KYUA 1HYIA 4BHWA 3U5MA 2VPDA 2JMDA 3L11A 3O37A 1WILA 4FK5A 1ZBDB 3LVRE 2KWJA 3O34A 3M7KA 2VP7A 2HDPA 3MHSA 3PLWA 3FJUB 5SVIB 2YREA 3GL6A 3PURA 2XP0A 4B7YC 4LLBA 5I3LA 2VPEA 3L1XA 4A0CD 3SOWA 3O36A 4GB0A 4YC9A
chains in the Genus database with same CATH topology
3HCSA 2LQ6A 5KH9A 4YBMA 4LK9A 4AUQB 4UP0A 2M6MA 2BAYA 5FERA 2FUIA 1WFKA 4AVXA 4N3WA 2PNXA 1WEWA 3HCUA 3HCTA 4MVTA 1MM3A 3C5KA 5B75A 2FSAA 2ECTA 2EODA 2MUMA 2I50A 3FL2A 5H1VA 2LGVA 2ECIA 2C2LA 2Y1NA 4V3LC 2ZETC 1VFYA 4WA6A 3V43A 1VYXA 5FB1A 2KU3A 4LJNA 2KGGA 3HTKC 5J3XA 2CSYA 2MIQA 3RPGC 1LDKC 2XB1A 4A4CA 4FIPA 4QF3A 5G0FA 1LDJB 1F62A 2PUYA 4QF2A 2OXQC 2YURA 2YHNA 3LQJA 3NG2A 2Y43A 2VPGA 2EGPA 2VNFA 5EYAF 4ZQLA 4GNFA 2G6QA 2G43A 5B79A 3ZVYA 3RTRB 3C6WA 5D1KB 4YBSA 1XWHA 3KNVA 2L75A 5H9MA 1K2FA 3O33A 2LN0A 2JRJA 3M99A 2L80A 1JOCA 3SHBA 5AIUA 2E6SA 4LKAA 2F6JA 2EA6A 4XI1A 1N87A 2K16A 3O70A 1WEUA 1Z2QA 2D8SA 4AYCB 5TABA 5H1UA 5B78A 4A4BA 3N9OA 2CKLA 3LQHA 2KR4A 4C9ZA 5LKZA 3ASLA 4WZ2A 2ECWA 2ECGA 2ECVA 5KH3A 4O64A 5C13A 5B76A 1JM7B 3ZTGA 1WESA 1RMDA 2YUCA 2YU4A 4S3OC 3MHHA 3T6RA 4AYCA 1FBVA 3N9QA 1FP0A 3QZVA 4TKPB 1WEQA 3U5OA 3KV6A 4YBTA 5LKXA 3SOXA 3RPGB 2LXPC 4R8PK 2DX8A 4UI9B 1WE9A 2VJEA 1WIMA 4YATA 5LKUA 2FUUA 3GV4A 4YABA 2E6RA 2MA5A 5DKAA 4R7EA 2MNZA 3LQIA 1JM7A 2H0DA 2AN6A 2YQMA 4UP5A 5KH7A 4N4FA 2IDAA 2L5UA 1X4UA 5LCWB 3ZYQA 3IHPA 5TDWA 2RI7A 1WEVA 2F42A 2YHOA 4PTBA 3N9MA 1V87A 2M1RA 4AP4A 1E4UA 4I7DA 3EB6A 2L43A 1U6GB 2VJFB 5C11A 5TRBA 2ECJA 3M63A 1T1HA 2M85A 4FJCA 1MM2A 2YW8A 3EB5A 2CKLB 5B8DA 2KE1A 1Z6UA 4NN2A 4WZ3B 2LGGA 2XEUA 2ECNA 2YT5A 5D1MB 4I7CA 2YSJA 2YYRA 2MD8C 4WZ0A 1WEPA 2YQLA 2KGIA 3PHDA 3ZNIA 4CCGX 2VJFA 3U5PA 2KFTA 1X4JA 5G05B 5D1LB 2LGKA 2QIZA 4GNDA 4FO9A 3LRQA 4GNEA 5B77A 3SOUA 4W4UA 3KV5A 2K17A 3I2DA 4ZUXU 2MT5A 4S3OB 1WEMA 1HYJA 2VJEB 5FB0A 1IYMA 1CHCA 3PUQA 2H0DB 1DVPA 4I7BA 4BBQA 3KQIA 2KWOA 2QJ0A 1Z60A 4LADB 2G45A 1WEOA 3DPLR 5FEYA 2MNYA 4IC2A 4L7XA 4GNGA 5TBNA 2LGLA 5LKTA 3N9LA 4ZDTA 2VPBA 1WEEA 3VK6A 2KIZA 3O7AA 1X4IA 2K4DA 3DQVR 2KREA 1G25A 3ZPVE 4A49A 2JMIA 3M62A 2QICA 2HYED 2M3HA 2LXHC 2UZGA 4YADA 5JG6A 3O35A 2YSMA 2Y1MA 5AITA 3U5NA 3N9NA 3T7LA 2K1JA 2MD7B 1WENA 2CSZA 3ZPV1 2LRIC 4IC3A 4X3GA 4B86C 2JMJA 3N9PA 2LDRA 5TDRA 2CT2A 3L1ZB 4R2YA 2LV9A 3ZVZB 2NAAA 4YAXA 2KWNA 4L58A 2L0BA 4MSXA 1WGMA 2RSDA 4CA1A 2KWKA 5G04B 4Q6FA 4PPEA 5DINA 1BORA 1VD4A 4F52B 5H1TA 2MA6A 2C2VS 4P5OB 4V3KC 2F6NA 2KYUA 1HYIA 4BHWA 3U5MA 2VPDA 2JMDA 3L11A 3O37A 1WILA 4FK5A 1ZBDB 2KWJA 3O34A 2VP7A 2HDPA 3MHSA 2YREA 3GL6A 3PURA 4B7YC 4LLBA 5I3LA 2VPEA 3L1XA 4A0CD 3SOWA 3O36A 4GB0A 4YC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCS A;  2LQ6 A;  5KH9 A;  4YBM A;  4LK9 A;  4AUQ B;  4UP0 A;  2M6M A;  2BAY A;  5FER A;  2FUI A;  1WFK A;  4AVX A;  4N3W A;  2PNX A;  1WEW A;  3HCU A;  3HCT A;  4MVT A;  1MM3 A;  3C5K A;  5B75 A;  2FSA A;  2ECT A;  2EOD A;  2MUM A;  2I50 A;  3FL2 A;  5H1V A;  2LGV A;  2ECI A;  2C2L A;  2Y1N A;  4V3L C;  2ZET C;  1VFY A;  4WA6 A;  3V43 A;  1VYX A;  5FB1 A;  2KU3 A;  4LJN A;  2KGG A;  3HTK C;  5J3X A;  2CSY A;  2MIQ A;  3RPG C;  1LDK C;  2XB1 A;  4A4C A;  4FIP A;  4QF3 A;  5G0F A;  1LDJ B;  1F62 A;  2PUY A;  4QF2 A;  2OXQ C;  2YUR A;  2YHN A;  3LQJ A;  3NG2 A;  2Y43 A;  2VPG A;  2EGP A;  2VNF A;  5EYA F;  4ZQL A;  4GNF A;  2G6Q A;  2G43 A;  5B79 A;  3ZVY A;  3RTR B;  3C6W A;  5D1K B;  4YBS A;  1XWH A;  3KNV A;  2L75 A;  5H9M A;  1K2F A;  3O33 A;  2LN0 A;  2JRJ A;  3M99 A;  2L80 A;  1JOC A;  3SHB A;  5AIU A;  2E6S A;  4LKA A;  2F6J A;  2EA6 A;  4XI1 A;  1N87 A;  2K16 A;  3O70 A;  1WEU A;  1Z2Q A;  2D8S A;  4AYC B;  5TAB A;  5H1U A;  5B78 A;  4A4B A;  3N9O A;  2CKL A;  3LQH A;  2KR4 A;  4C9Z A;  5LKZ A;  3ASL A;  4WZ2 A;  2ECW A;  2ECG A;  2ECV A;  5KH3 A;  4O64 A;  5C13 A;  5B76 A;  1JM7 B;  3ZTG A;  1WES A;  1RMD A;  2YUC A;  2YU4 A;  4S3O C;  3MHH A;  3T6R A;  4AYC A;  1FBV A;  3N9Q A;  1FP0 A;  3QZV A;  4TKP B;  1WEQ A;  3U5O A;  3KV6 A;  4YBT A;  5LKX A;  3SOX A;  3RPG B;  2LXP C;  4R8P K;  2DX8 A;  4UI9 B;  1WE9 A;  2VJE A;  1WIM A;  4YAT A;  5LKU A;  2FUU A;  3GV4 A;  4YAB A;  2E6R A;  2MA5 A;  5DKA A;  4R7E A;  2MNZ A;  3LQI A;  1JM7 A;  2H0D A;  2AN6 A;  2YQM A;  4UP5 A;  5KH7 A;  4N4F A;  2IDA A;  2L5U A;  1X4U A;  5LCW B;  3ZYQ A;  3IHP A;  5TDW A;  2RI7 A;  1WEV A;  2F42 A;  2YHO A;  4PTB A;  3N9M A;  1V87 A;  2M1R A;  4AP4 A;  1E4U A;  4I7D A;  3EB6 A;  2L43 A;  1U6G B;  2VJF B;  5C11 A;  5TRB A;  2ECJ A;  3M63 A;  1T1H A;  2M85 A;  4FJC A;  1MM2 A;  2YW8 A;  3EB5 A;  2CKL B;  5B8D A;  2KE1 A;  1Z6U A;  4NN2 A;  4WZ3 B;  2LGG A;  2XEU A;  2ECN A;  2YT5 A;  5D1M B;  4I7C A;  2YSJ A;  2YYR A;  2MD8 C;  4WZ0 A;  1WEP A;  2YQL A;  2KGI A;  3PHD A;  3ZNI A;  4CCG X;  2VJF A;  3U5P A;  2KFT A;  1X4J A;  5G05 B;  5D1L B;  2LGK A;  2QIZ A;  4GND A;  4FO9 A;  3LRQ A;  4GNE A;  5B77 A;  3SOU A;  4W4U A;  3KV5 A;  2K17 A;  3I2D A;  4ZUX U;  2MT5 A;  4S3O B;  1WEM A;  1HYJ A;  2VJE B;  5FB0 A;  1IYM A;  1CHC A;  3PUQ A;  2H0D B;  1DVP A;  4I7B A;  4BBQ A;  3KQI A;  2KWO A;  2QJ0 A;  1Z60 A;  4LAD B;  2G45 A;  1WEO A;  3DPL R;  5FEY A;  2MNY A;  4IC2 A;  4L7X A;  4GNG A;  5TBN A;  2LGL A;  5LKT A;  3N9L A;  4ZDT A;  2VPB A;  1WEE A;  3VK6 A;  2KIZ A;  3O7A A;  1X4I A;  2K4D A;  3DQV R;  2KRE A;  1G25 A;  3ZPV E;  4A49 A;  2JMI A;  3M62 A;  2QIC A;  2HYE D;  2M3H A;  2LXH C;  2UZG A;  4YAD A;  5JG6 A;  3O35 A;  2YSM A;  2Y1M A;  5AIT A;  3U5N A;  3N9N A;  3T7L A;  2K1J A;  2MD7 B;  1WEN A;  2CSZ A;  3ZPV 1;  2LRI C;  4IC3 A;  4X3G A;  4B86 C;  2JMJ A;  3N9P A;  2LDR A;  5TDR A;  2CT2 A;  3L1Z B;  4R2Y A;  2LV9 A;  3ZVZ B;  2NAA A;  4YAX A;  2KWN A;  4L58 A;  2L0B A;  4MSX A;  1WGM A;  2RSD A;  4CA1 A;  2KWK A;  5G04 B;  4Q6F A;  4PPE A;  5DIN A;  1BOR A;  1VD4 A;  4F52 B;  5H1T A;  2MA6 A;  2C2V S;  4P5O B;  4V3K C;  2F6N A;  2KYU A;  1HYI A;  4BHW A;  3U5M A;  2VPD A;  2JMD A;  3L11 A;  3O37 A;  1WIL A;  4FK5 A;  1ZBD B;  2KWJ A;  3O34 A;  2VP7 A;  2HDP A;  3MHS A;  2YRE A;  3GL6 A;  3PUR A;  4B7Y C;  4LLB A;  5I3L A;  2VPE A;  3L1X A;  4A0C D;  3SOW A;  3O36 A;  4GB0 A;  4YC9 A; 
#chains in the Genus database with same CATH topology
 3HCS A;  2LQ6 A;  2OWA A;  5KH9 A;  4YBM A;  4LK9 A;  4AUQ B;  4UP0 A;  4H9D A;  2M6M A;  4OGE A;  2BAY A;  5FER A;  3H7H A;  5SVI A;  2FUI A;  1WFK A;  4AVX A;  4N3W A;  2PNX A;  2M13 A;  1WEW A;  3HCU A;  3HCT A;  4MVT A;  1MM3 A;  3C5K A;  5B75 A;  4O62 A;  2JM3 A;  2FSA A;  2ECT A;  2EOD A;  2MUM A;  2I50 A;  3FL2 A;  5H1V A;  2LGV A;  2MKE A;  2ECI A;  2C2L A;  2Y1N A;  4V3L C;  2ZET C;  1VFY A;  4WA6 A;  3V43 A;  1VYX A;  5FB1 A;  5SVX A;  2KU3 A;  3T9K A;  4LJN A;  2KGG A;  3HTK C;  5J3X A;  2CSY A;  2MIQ A;  3RPG C;  1LDK C;  2XB1 A;  4A4C A;  4FIP A;  3FEH A;  4QF3 A;  5G0F A;  1LDJ B;  1F62 A;  2PUY A;  4QF2 A;  2CRW A;  2OXQ C;  2YUR A;  2YHN A;  5SVY A;  3LQJ A;  3NG2 A;  2Y43 A;  2VPG A;  2EGP A;  2VNF A;  5EYA F;  1DCQ A;  4ZQL A;  5K3Q A;  4GNF A;  2G6Q A;  2G43 A;  5B79 A;  3ZVY A;  3RTR B;  2EXU A;  3C6W A;  5D1K B;  3FAN A;  4YBS A;  1XWH A;  3KNV A;  2L75 A;  5H9M A;  3E2D A;  1K2F A;  3O33 A;  2LAU A;  2LN0 A;  2JRJ A;  3M99 A;  2L80 A;  1JOC A;  3SHB A;  5AIU A;  2E6S A;  4LKA A;  2F6J A;  2EA6 A;  4XI1 A;  1N87 A;  2K16 A;  3O70 A;  1WEU A;  1Z2Q A;  2D8S A;  4AYC B;  5TAB A;  5H1U A;  5B78 A;  4A4B A;  3N9O A;  2CKL A;  3LQH A;  2KR4 A;  4C9Z A;  5LKZ A;  3ASL A;  4WZ2 A;  2ECW A;  2ECG A;  2IQJ A;  2ECV A;  5KH3 A;  2XOZ A;  4O64 A;  3KDE C;  3LDY A;  5C13 A;  5B76 A;  1JM7 B;  3SUB A;  3ZTG A;  1WES A;  1RMD A;  2YUC A;  2YU4 A;  4S3O C;  3MHH A;  3T6R A;  4AYC A;  3LVQ E;  1FBV A;  3N9Q A;  1FP0 A;  3QZV A;  4TKP B;  1WEQ A;  2RR4 A;  2YVR A;  3U5O A;  3KV6 A;  4YBT A;  5LKX A;  3SOX A;  3RPG B;  2DSM A;  2LXP C;  2E61 A;  4R8P K;  2DX8 A;  4UI9 B;  1WE9 A;  2VJE A;  1WIM A;  4YAT A;  5LKU A;  2FUU A;  3DWD A;  3GV4 A;  4YAB A;  2E6R A;  2MA5 A;  2MNZ A;  4R7E A;  3LQI A;  5DKA A;  1JM7 A;  2H0D A;  2AN6 A;  2YQM A;  4UP5 A;  5KH7 A;  4N4F A;  2IDA A;  2L5U A;  1X4U A;  4Z0R A;  5LCW B;  3ZYQ A;  3IHP A;  2CON A;  2KKY A;  4OGC A;  5TDW A;  2RI7 A;  1WEV A;  2EGM A;  3Q1D A;  2F42 A;  2YHO A;  4PTB A;  3N9M A;  1V87 A;  2M1R A;  4AP4 A;  2CRR A;  1E4U A;  4I7D A;  3EB6 A;  2L43 A;  1U6G B;  2VJF B;  5C11 A;  5TRB A;  2ECJ A;  3M63 A;  1T1H A;  2M85 A;  4FJC A;  1MM2 A;  2YW8 A;  2FFW A;  3EB5 A;  2CKL B;  2KKX A;  5B8D A;  2XOC A;  2KE1 A;  1Z6U A;  4NN2 A;  4WZ3 B;  2LGG A;  2XEU A;  2ECN A;  2YT5 A;  5D1M B;  4I7C A;  2YSJ A;  2YYR A;  2MD8 C;  4WZ0 A;  1WEP A;  2YQL A;  2KGI A;  3PHD A;  3ZNI A;  4CCG X;  2VJF A;  3U5P A;  2KFT A;  1X4J A;  5G05 B;  5D1L B;  2LGK A;  2QIZ A;  4GND A;  4FO9 A;  3MDB C;  3LJU X;  3LRQ A;  4GNE A;  5B77 A;  4W4U A;  3SOU A;  3KV5 A;  2K17 A;  3I2D A;  2L7P A;  4ZUX U;  2MT5 A;  4S3O B;  1WEM A;  1HYJ A;  2VJE B;  5FB0 A;  1IYM A;  1CHC A;  3PUQ A;  2H0D B;  1DVP A;  4I7B A;  2JUN A;  4BBQ A;  3KQI A;  2KWO A;  2QJ0 A;  1Z60 A;  4LAD B;  2G45 A;  1WEO A;  2DJA A;  3DPL R;  5FEY A;  2MNY A;  4IC2 A;  4L7X A;  4GNG A;  5TBN A;  2LGL A;  5LKT A;  3N9L A;  4ZDT A;  2VPB A;  1WEE A;  3VK6 A;  3O47 A;  2KIZ A;  3O7A A;  1X4I A;  2K4D A;  3DQV R;  2XOY A;  2KRE A;  1G25 A;  3ZPV E;  3FAO A;  4A49 A;  2JMI A;  3M62 A;  2QIC A;  2HYE D;  2D8U A;  2M3H A;  2LXH C;  2UZG A;  4YAD A;  2B0O E;  5JG6 A;  2CSV A;  3O35 A;  3DDT A;  2YSM A;  2Y1M A;  5AIT A;  3FM8 C;  3U5N A;  3N9N A;  3T7L A;  2K1J A;  2MD7 B;  1WEN A;  2CSZ A;  3ZPV 1;  1MBM A;  2LRI C;  4IC3 A;  4X3G A;  4B86 C;  2JMJ A;  4QQ4 A;  3N9P A;  2FD4 A;  2LDR A;  5TDR A;  2CT2 A;  3L1Z B;  4Z0O A;  4R2Y A;  2LV9 A;  3ZVZ B;  4F1P A;  2NAA A;  4YAX A;  2KWN A;  4L58 A;  2L0B A;  4MSX A;  1WGM A;  2RSD A;  4CA1 A;  2KWK A;  5G04 B;  4Q6F A;  3JUE A;  4PPE A;  5DIN A;  1BOR A;  1VD4 A;  4F52 B;  5H1T A;  2MA6 A;  2P57 A;  2C2V S;  4P5O B;  4V3K C;  2F6N A;  2KYU A;  1HYI A;  4BHW A;  3U5M A;  2VPD A;  2JMD A;  3L11 A;  3O37 A;  1WIL A;  4FK5 A;  1ZBD B;  3LVR E;  2KWJ A;  3O34 A;  3M7K A;  2VP7 A;  2HDP A;  3MHS A;  3PLW A;  3FJU B;  5SVI B;  2YRE A;  3GL6 A;  3PUR A;  2XP0 A;  4B7Y C;  4LLB A;  5I3L A;  2VPE A;  3L1X A;  4A0C D;  3SOW A;  3O36 A;  4GB0 A;  4YC9 A; 
#chains in the Genus database with same CATH homology
 3HCS A;  2LQ6 A;  5KH9 A;  4YBM A;  4LK9 A;  4AUQ B;  4UP0 A;  2M6M A;  2BAY A;  5FER A;  2FUI A;  1WFK A;  4AVX A;  4N3W A;  2PNX A;  1WEW A;  3HCU A;  3HCT A;  4MVT A;  1MM3 A;  3C5K A;  5B75 A;  2FSA A;  2ECT A;  2EOD A;  2MUM A;  2I50 A;  3FL2 A;  5H1V A;  2LGV A;  2ECI A;  2C2L A;  2Y1N A;  4V3L C;  2ZET C;  1VFY A;  4WA6 A;  3V43 A;  1VYX A;  5FB1 A;  2KU3 A;  4LJN A;  2KGG A;  3HTK C;  5J3X A;  2CSY A;  2MIQ A;  3RPG C;  1LDK C;  2XB1 A;  4A4C A;  4FIP A;  4QF3 A;  5G0F A;  1LDJ B;  1F62 A;  2PUY A;  4QF2 A;  2OXQ C;  2YUR A;  2YHN A;  3LQJ A;  3NG2 A;  2Y43 A;  2VPG A;  2EGP A;  2VNF A;  5EYA F;  4ZQL A;  4GNF A;  2G6Q A;  2G43 A;  5B79 A;  3ZVY A;  3RTR B;  3C6W A;  5D1K B;  4YBS A;  1XWH A;  3KNV A;  2L75 A;  5H9M A;  1K2F A;  3O33 A;  2LN0 A;  2JRJ A;  3M99 A;  2L80 A;  1JOC A;  3SHB A;  5AIU A;  2E6S A;  4LKA A;  2F6J A;  2EA6 A;  4XI1 A;  1N87 A;  2K16 A;  3O70 A;  1WEU A;  1Z2Q A;  2D8S A;  4AYC B;  5TAB A;  5H1U A;  5B78 A;  4A4B A;  3N9O A;  2CKL A;  3LQH A;  2KR4 A;  4C9Z A;  5LKZ A;  3ASL A;  4WZ2 A;  2ECW A;  2ECG A;  2ECV A;  5KH3 A;  4O64 A;  5C13 A;  5B76 A;  1JM7 B;  3ZTG A;  1WES A;  1RMD A;  2YUC A;  2YU4 A;  4S3O C;  3MHH A;  3T6R A;  4AYC A;  1FBV A;  3N9Q A;  1FP0 A;  3QZV A;  4TKP B;  1WEQ A;  3U5O A;  3KV6 A;  4YBT A;  5LKX A;  3SOX A;  3RPG B;  2LXP C;  4R8P K;  2DX8 A;  4UI9 B;  1WE9 A;  2VJE A;  1WIM A;  4YAT A;  5LKU A;  2FUU A;  3GV4 A;  4YAB A;  2E6R A;  2MA5 A;  5DKA A;  4R7E A;  2MNZ A;  3LQI A;  1JM7 A;  2H0D A;  2AN6 A;  2YQM A;  4UP5 A;  5KH7 A;  4N4F A;  2IDA A;  2L5U A;  1X4U A;  5LCW B;  3ZYQ A;  3IHP A;  5TDW A;  2RI7 A;  1WEV A;  2F42 A;  2YHO A;  4PTB A;  3N9M A;  1V87 A;  2M1R A;  4AP4 A;  1E4U A;  4I7D A;  3EB6 A;  2L43 A;  1U6G B;  2VJF B;  5C11 A;  5TRB A;  2ECJ A;  3M63 A;  1T1H A;  2M85 A;  4FJC A;  1MM2 A;  2YW8 A;  3EB5 A;  2CKL B;  5B8D A;  2KE1 A;  1Z6U A;  4NN2 A;  4WZ3 B;  2LGG A;  2XEU A;  2ECN A;  2YT5 A;  5D1M B;  4I7C A;  2YSJ A;  2YYR A;  2MD8 C;  4WZ0 A;  1WEP A;  2YQL A;  2KGI A;  3PHD A;  3ZNI A;  4CCG X;  2VJF A;  3U5P A;  2KFT A;  1X4J A;  5G05 B;  5D1L B;  2LGK A;  2QIZ A;  4GND A;  4FO9 A;  3LRQ A;  4GNE A;  5B77 A;  3SOU A;  4W4U A;  3KV5 A;  2K17 A;  3I2D A;  4ZUX U;  2MT5 A;  4S3O B;  1WEM A;  1HYJ A;  2VJE B;  5FB0 A;  1IYM A;  1CHC A;  3PUQ A;  2H0D B;  1DVP A;  4I7B A;  4BBQ A;  3KQI A;  2KWO A;  2QJ0 A;  1Z60 A;  4LAD B;  2G45 A;  1WEO A;  3DPL R;  5FEY A;  2MNY A;  4IC2 A;  4L7X A;  4GNG A;  5TBN A;  2LGL A;  5LKT A;  3N9L A;  4ZDT A;  2VPB A;  1WEE A;  3VK6 A;  2KIZ A;  3O7A A;  1X4I A;  2K4D A;  3DQV R;  2KRE A;  1G25 A;  3ZPV E;  4A49 A;  2JMI A;  3M62 A;  2QIC A;  2HYE D;  2M3H A;  2LXH C;  2UZG A;  4YAD A;  5JG6 A;  3O35 A;  2YSM A;  2Y1M A;  5AIT A;  3U5N A;  3N9N A;  3T7L A;  2K1J A;  2MD7 B;  1WEN A;  2CSZ A;  3ZPV 1;  2LRI C;  4IC3 A;  4X3G A;  4B86 C;  2JMJ A;  3N9P A;  2LDR A;  5TDR A;  2CT2 A;  3L1Z B;  4R2Y A;  2LV9 A;  3ZVZ B;  2NAA A;  4YAX A;  2KWN A;  4L58 A;  2L0B A;  4MSX A;  1WGM A;  2RSD A;  4CA1 A;  2KWK A;  5G04 B;  4Q6F A;  4PPE A;  5DIN A;  1BOR A;  1VD4 A;  4F52 B;  5H1T A;  2MA6 A;  2C2V S;  4P5O B;  4V3K C;  2F6N A;  2KYU A;  1HYI A;  4BHW A;  3U5M A;  2VPD A;  2JMD A;  3L11 A;  3O37 A;  1WIL A;  4FK5 A;  1ZBD B;  2KWJ A;  3O34 A;  2VP7 A;  2HDP A;  3MHS A;  2YRE A;  3GL6 A;  3PUR A;  4B7Y C;  4LLB A;  5I3L A;  2VPE A;  3L1X A;  4A0C D;  3SOW A;  3O36 A;  4GB0 A;  4YC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...