2YHNA

The idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
VLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Idol-Ube2D Complex Mediates Sterol-Dependent Degradation of the Ldl Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MYLIP
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yhnA00
2PUYA 3HTKC 2KGGA 5H1VA 5H1UA 5G04B 1XWHA 3ZPV1 4A4CA 2VPBA 4I7CA 4MSXA 4YABA 3PURA 2G6QA 4GB0A 2LGKA 2VJEA 1JM7A 3SHBA 1HYIA 2MNZA 2ECGA 2JMJA 4AYCA 5AITA 2CKLA 2MD8C 4ZUXU 2KYUA 5TDWA 2YHOA 3GV4A 3HCUA 2JRJA 5C13A 2CKLB 4YADA 5KH9A 1X4JA 5FERA 2EA6A 3KQIA 2KGIA 1WFKA 2MA5A 4V3LC 2F42A 5D1MB 2YU4A 2ECNA 2FUUA 2ZETC 4AP4A 2MT5A 1JOCA 4WZ2A 2VNFA 2IDAA 5DINA 1Z6UA 2RSDA 2LQ6A 2MA6A 1WEQA 3PUQA 4MVTA 5KH7A 2Y43A 4LJNA 2K16A 2RI7A 2ECTA 1WEWA 4L58A 2C2LA 2I50A 2KWJA 3O35A 2MNYA 2F6JA 3LQIA 3O36A 2QJ0A 4B7YC 2JMIA 4FO9A 3VK6A 3LQJA 5B78A 2ECVA 4P5OB 2L0BA 2JMDA 1Z60A 3L1ZB 5LKXA 2VJEB 1VYXA 2LGVA 3HCSA 3LQHA 1E4UA 2LV9A 2KIZA 2YURA 4I7BA 2ECWA 4NN2A 3SOWA 2YYRA 5B8DA 2KE1A 3FL2A 1JM7B 2E6RA 3MHSA 4GNGA 3EB5A 1LDKC 3U5PA 2K4DA 5FB0A 3ZVZB 3RTRB 3U5MA 1WEOA 1MM3A 1N87A 3ZTGA 1WE9A 2VPGA 2LRIC 4BHWA 2YSMA 4V3KC 1VD4A 2H0DA 5AIUA 4YBMA 2KWKA 4TKPB 1F62A 1V87A 3I2DA 1HYJA 2CSYA 4GNEA 4UI9B 3QZVA 5I3LA 1T1HA 2LDRA 4YAXA 1X4IA 4A4BA 5FB1A 2E6SA 5KH3A 2M85A 3O37A 3V43A 3NG2A 3N9NA 4W4UA 3N9OA 2VJFA 2K1JA 5B79A 4BBQA 3C5KA 4I7DA 5LCWB 2H0DB 1U6GB 5D1KB 3U5OA 4QF3A 1DVPA 1WEMA 4F52B 3KV5A 4PTBA 5TBNA 4ZQLA 4X3GA 4LK9A 4YBTA 3RPGB 1BORA 2M6MA 4UP5A 1FP0A 1WIMA 5H1TA 2VPEA 5C11A 5G05B 4N3WA 4AYCB 4R2YA 3RPGC 4LKAA 3L1XA 4S3OB 2ECJA 2L80A 4AUQB 5LKTA 2MIQA 3M62A 3M63A 3U5NA 2K17A 2KWNA 2M3HA 5G0FA 4A49A 3T6RA 5LKZA 5EYAF 3M99A 4YBSA 1RMDA 2MD7B 1WENA 3KV6A 2KR4A 4FIPA 4YC9A 3GL6A 4CA1A 3O34A 5J3XA 3N9MA 2YT5A 2FUIA 3N9PA 4N4FA 2DX8A 2YSJA 5JG6A 4WA6A 2L43A 2G43A 4B86C 2HYED 3KNVA 1G25A 4FK5A 4WZ0A 3O7AA 5B75A 4FJCA 2KU3A 1Z2QA 4Q6FA 5B77A 4R8PK 2PNXA 5TRBA 4PPEA 3ZPVE 2HDPA 2YW8A 3ZYQA 5D1LB 5LKUA 1K2FA 2QICA 2CT2A 3N9LA 2LXPC 2L5UA 2MUMA 2VP7A 4A0CD 3IHPA 4WZ3B 2LXHC 2YUCA 1FBVA 2YQMA 3DPLR 1X4UA 2FSAA 3C6WA 3MHHA 4UP0A 2ECIA 4C9ZA 2YREA 5B76A 4R7EA 1WILA 3PHDA 3EB6A 2G45A 5FEYA 2EGPA 2L75A 5TDRA 2XEUA 1WEVA 5DKAA 2VPDA 3L11A 2XB1A 4ZDTA 2CSZA 2Y1NA 5TABA 3LRQA 4IC2A 3N9QA 1WEEA 1WEUA 2KFTA 2BAYA 3O70A 2LN0A 4L7XA 2VJFB 3ASLA 4QF2A 1WESA 5H9MA 4XI1A 2C2VS 2OXQC 2UZGA 4CCGX 3SOXA 1WEPA 2F6NA 4GNFA 1ZBDB 4LADB 2KREA 3HCTA 2KWOA 3ZNIA 3ZVYA 4AVXA 2Y1MA 4YATA 2LGGA 2NAAA 3O33A 1VFYA 1LDJB 4O64A 1IYMA 2LGLA 2M1RA 4GNDA 4S3OC 2AN6A 1WGMA 1MM2A 3SOUA 2YHNA 2QIZA 3DQVR 2D8SA 4IC3A 2EODA 3T7LA 4LLBA 1CHCA 2YQLA
chains in the Genus database with same CATH superfamily
2PUYA 3HTKC 2CRRA 2KGGA 5H1VA 5H1UA 5G04B 1XWHA 3ZPV1 2P57A 4A4CA 2VPBA 4I7CA 4MSXA 4YABA 3PURA 2G6QA 4GB0A 2LGKA 2VJEA 1JM7A 3SHBA 1HYIA 2MNZA 2ECGA 2JMJA 4AYCA 5AITA 2CKLA 2MD8C 4ZUXU 2KYUA 5TDWA 2YHOA 4OGEA 3GV4A 3HCUA 2JRJA 5C13A 2CKLB 4YADA 5KH9A 1X4JA 5FERA 2EA6A 3KQIA 2KGIA 1WFKA 2MA5A 4V3LC 2F42A 2JM3A 5D1MB 2YU4A 2ECNA 2FUUA 2ZETC 4AP4A 2MT5A 1JOCA 5SVXA 4WZ2A 2VNFA 2IDAA 5DINA 1Z6UA 2RSDA 2LQ6A 2MA6A 1WEQA 3PUQA 4MVTA 5KH7A 2Y43A 4LJNA 2K16A 2RI7A 2ECTA 1WEWA 4L58A 2C2LA 2I50A 2KWJA 3O35A 3FAOA 2MNYA 4F1PA 2F6JA 3LQIA 3O36A 2QJ0A 4B7YC 2JMIA 4FO9A 3VK6A 3LQJA 5B78A 2ECVA 2DSMA 4P5OB 2L0BA 2JMDA 1Z60A 3L1ZB 5SVIA 5LKXA 2VJEB 1VYXA 2LGVA 3HCSA 3LQHA 1E4UA 2LV9A 2KIZA 2YURA 4I7BA 2ECWA 4NN2A 3SOWA 3PLWA 2YYRA 5B8DA 2KE1A 3FL2A 1JM7B 2E6RA 3O47A 3MHSA 4Z0RA 4GNGA 3KDEC 3EB5A 5SVIB 1LDKC 3U5PA 5SVYA 2K4DA 5FB0A 3ZVZB 3RTRB 3U5MA 1WEOA 1MM3A 1N87A 3ZTGA 1WE9A 2VPGA 2LRIC 4BHWA 2YSMA 4V3KC 1VD4A 2H0DA 5AIUA 4YBMA 2KWKA 4TKPB 1F62A 1V87A 3I2DA 3MDBC 1HYJA 3SUBA 2CSYA 4GNEA 4UI9B 3QZVA 5I3LA 1T1HA 2LDRA 4YAXA 1X4IA 4A4BA 5FB1A 2E6SA 5KH3A 2M85A 3O37A 3V43A 3NG2A 4O62A 3N9NA 4W4UA 3N9OA 2VJFA 1MBMA 2K1JA 5B79A 2CSVA 3C5KA 4I7DA 5LCWB 4BBQA 2H0DB 1U6GB 5D1KB 3U5OA 4QF3A 1DVPA 3LJUX 1WEMA 2XOCA 4F52B 3KV5A 4PTBA 5TBNA 2E61A 4ZQLA 4X3GA 3FJUB 2CRWA 4LK9A 4YBTA 3RPGB 1BORA 2M6MA 1FP0A 1WIMA 4UP5A 5H1TA 3FEHA 3LDYA 2VPEA 5C11A 5G05B 4N3WA 4AYCB 4R2YA 3RPGC 2KKXA 4LKAA 3L1XA 2RR4A 2DJAA 2ECJA 4S3OB 2L80A 4AUQB 5LKTA 2MIQA 3M62A 3M63A 3U5NA 2K17A 2KWNA 2YVRA 2M3HA 5G0FA 4A49A 3T6RA 5LKZA 5EYAF 3M99A 4YBSA 1RMDA 2MD7B 1WENA 3KV6A 2KR4A 4FIPA 2XOYA 4YC9A 3GL6A 2B0OE 4CA1A 3O34A 5J3XA 3N9MA 2YT5A 2FUIA 3N9PA 4N4FA 2DX8A 2YSJA 2JUNA 5JG6A 2D8UA 4WA6A 2L43A 2G43A 4B86C 2HYED 3KNVA 1G25A 4FK5A 3DWDA 2MKEA 4WZ0A 3O7AA 5B75A 4FJCA 2KU3A 1Z2QA 3JUEA 3E2DA 4Q6FA 5B77A 3Q1DA 4R8PK 2PNXA 5TRBA 4PPEA 3ZPVE 2XP0A 2HDPA 2YW8A 3ZYQA 2FFWA 5D1LB 5LKUA 1K2FA 2QICA 2CT2A 3N9LA 2LXPC 2L5UA 2M13A 2EXUA 2MUMA 2FD4A 2VP7A 2IQJA 4A0CD 3H7HA 3IHPA 4WZ3B 2LXHC 2YUCA 1FBVA 2YQMA 3DPLR 1X4UA 2FSAA 3C6WA 3MHHA 4UP0A 2ECIA 4C9ZA 2YREA 5B76A 4R7EA 1DCQA 2OWAA 1WILA 3PHDA 3EB6A 5FEYA 2G45A 2EGPA 2L75A 5TDRA 3FANA 2EGMA 4H9DA 2XEUA 1WEVA 5DKAA 2VPDA 3L11A 2XB1A 4ZDTA 2CSZA 2CONA 2Y1NA 5TABA 3LRQA 4IC2A 3N9QA 1WEEA 3FM8C 1WEUA 2KFTA 2BAYA 3O70A 2LN0A 3M7KA 4L7XA 2VJFB 3ASLA 4QF2A 2LAUA 1WESA 5H9MA 4XI1A 2C2VS 2OXQC 2UZGA 4CCGX 3SOXA 1WEPA 2F6NA 3LVRE 4GNFA 1ZBDB 4LADB 2KREA 3HCTA 2KWOA 3ZNIA 3ZVYA 4AVXA 3T9KA 2Y1MA 4YATA 2LGGA 2NAAA 3O33A 1VFYA 1LDJB 4O64A 1IYMA 2LGLA 2XOZA 2KKYA 2M1RA 4GNDA 4S3OC 4Z0OA 5K3QA 3LVQE 2AN6A 1WGMA 1MM2A 3SOUA 2YHNA 2QIZA 3DQVR 2D8SA 4IC3A 4OGCA 2EODA 3T7LA 4LLBA 1CHCA 4QQ4A 2YQLA 3DDTA 2L7PA
chains in the Genus database with same CATH topology
2PUYA 3HTKC 2KGGA 5H1VA 5H1UA 5G04B 1XWHA 3ZPV1 4A4CA 2VPBA 4I7CA 4MSXA 4YABA 3PURA 2G6QA 4GB0A 2LGKA 2VJEA 1JM7A 3SHBA 1HYIA 2MNZA 2ECGA 2JMJA 4AYCA 5AITA 2CKLA 2MD8C 4ZUXU 2KYUA 5TDWA 2YHOA 3GV4A 3HCUA 2JRJA 5C13A 2CKLB 4YADA 5KH9A 1X4JA 5FERA 2EA6A 3KQIA 2KGIA 1WFKA 2MA5A 4V3LC 2F42A 5D1MB 2YU4A 2ECNA 2FUUA 2ZETC 4AP4A 2MT5A 1JOCA 4WZ2A 2VNFA 2IDAA 5DINA 1Z6UA 2RSDA 2LQ6A 2MA6A 1WEQA 3PUQA 4MVTA 5KH7A 2Y43A 4LJNA 2K16A 2RI7A 2ECTA 1WEWA 4L58A 2C2LA 2I50A 2KWJA 3O35A 2MNYA 2F6JA 3LQIA 3O36A 2QJ0A 4B7YC 2JMIA 4FO9A 3VK6A 3LQJA 5B78A 2ECVA 4P5OB 2L0BA 2JMDA 1Z60A 3L1ZB 5LKXA 2VJEB 1VYXA 2LGVA 3HCSA 3LQHA 1E4UA 2LV9A 2KIZA 2YURA 4I7BA 2ECWA 4NN2A 3SOWA 2YYRA 5B8DA 2KE1A 3FL2A 1JM7B 2E6RA 3MHSA 4GNGA 3EB5A 1LDKC 3U5PA 2K4DA 5FB0A 3ZVZB 3RTRB 3U5MA 1WEOA 1MM3A 1N87A 3ZTGA 1WE9A 2VPGA 2LRIC 4BHWA 2YSMA 4V3KC 1VD4A 2H0DA 5AIUA 4YBMA 2KWKA 4TKPB 1F62A 1V87A 3I2DA 1HYJA 2CSYA 4GNEA 4UI9B 3QZVA 5I3LA 1T1HA 2LDRA 4YAXA 1X4IA 4A4BA 5FB1A 2E6SA 5KH3A 2M85A 3O37A 3V43A 3NG2A 3N9NA 4W4UA 3N9OA 2VJFA 2K1JA 5B79A 4BBQA 3C5KA 4I7DA 5LCWB 2H0DB 1U6GB 5D1KB 3U5OA 4QF3A 1DVPA 1WEMA 4F52B 3KV5A 4PTBA 5TBNA 4ZQLA 4X3GA 4LK9A 4YBTA 3RPGB 1BORA 2M6MA 4UP5A 1FP0A 1WIMA 5H1TA 2VPEA 5C11A 5G05B 4N3WA 4AYCB 4R2YA 3RPGC 4LKAA 3L1XA 4S3OB 2ECJA 2L80A 4AUQB 5LKTA 2MIQA 3M62A 3M63A 3U5NA 2K17A 2KWNA 2M3HA 5G0FA 4A49A 3T6RA 5LKZA 5EYAF 3M99A 4YBSA 1RMDA 2MD7B 1WENA 3KV6A 2KR4A 4FIPA 4YC9A 3GL6A 4CA1A 3O34A 5J3XA 3N9MA 2YT5A 2FUIA 3N9PA 4N4FA 2DX8A 2YSJA 5JG6A 4WA6A 2L43A 2G43A 4B86C 2HYED 3KNVA 1G25A 4FK5A 4WZ0A 3O7AA 5B75A 4FJCA 2KU3A 1Z2QA 4Q6FA 5B77A 4R8PK 2PNXA 5TRBA 4PPEA 3ZPVE 2HDPA 2YW8A 3ZYQA 5D1LB 5LKUA 1K2FA 2QICA 2CT2A 3N9LA 2LXPC 2L5UA 2MUMA 2VP7A 4A0CD 3IHPA 4WZ3B 2LXHC 2YUCA 1FBVA 2YQMA 3DPLR 1X4UA 2FSAA 3C6WA 3MHHA 4UP0A 2ECIA 4C9ZA 2YREA 5B76A 4R7EA 1WILA 3PHDA 3EB6A 2G45A 5FEYA 2EGPA 2L75A 5TDRA 2XEUA 1WEVA 5DKAA 2VPDA 3L11A 2XB1A 4ZDTA 2CSZA 2Y1NA 5TABA 3LRQA 4IC2A 3N9QA 1WEEA 1WEUA 2KFTA 2BAYA 3O70A 2LN0A 4L7XA 2VJFB 3ASLA 4QF2A 1WESA 5H9MA 4XI1A 2C2VS 2OXQC 2UZGA 4CCGX 3SOXA 1WEPA 2F6NA 4GNFA 1ZBDB 4LADB 2KREA 3HCTA 2KWOA 3ZNIA 3ZVYA 4AVXA 2Y1MA 4YATA 2LGGA 2NAAA 3O33A 1VFYA 1LDJB 4O64A 1IYMA 2LGLA 2M1RA 4GNDA 4S3OC 2AN6A 1WGMA 1MM2A 3SOUA 2YHNA 2QIZA 3DQVR 2D8SA 4IC3A 2EODA 3T7LA 4LLBA 1CHCA 2YQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUY A;  3HTK C;  2KGG A;  5H1V A;  5H1U A;  5G04 B;  1XWH A;  3ZPV 1;  4A4C A;  2VPB A;  4I7C A;  4MSX A;  4YAB A;  3PUR A;  2G6Q A;  4GB0 A;  2LGK A;  2VJE A;  1JM7 A;  3SHB A;  1HYI A;  2MNZ A;  2ECG A;  2JMJ A;  4AYC A;  5AIT A;  2CKL A;  2MD8 C;  4ZUX U;  2KYU A;  5TDW A;  2YHO A;  3GV4 A;  3HCU A;  2JRJ A;  5C13 A;  2CKL B;  4YAD A;  5KH9 A;  1X4J A;  5FER A;  2EA6 A;  3KQI A;  2KGI A;  1WFK A;  2MA5 A;  4V3L C;  2F42 A;  5D1M B;  2YU4 A;  2ECN A;  2FUU A;  2ZET C;  4AP4 A;  2MT5 A;  1JOC A;  4WZ2 A;  2VNF A;  2IDA A;  5DIN A;  1Z6U A;  2RSD A;  2LQ6 A;  2MA6 A;  1WEQ A;  3PUQ A;  4MVT A;  5KH7 A;  2Y43 A;  4LJN A;  2K16 A;  2RI7 A;  2ECT A;  1WEW A;  4L58 A;  2C2L A;  2I50 A;  2KWJ A;  3O35 A;  2MNY A;  2F6J A;  3LQI A;  3O36 A;  2QJ0 A;  4B7Y C;  2JMI A;  4FO9 A;  3VK6 A;  3LQJ A;  5B78 A;  2ECV A;  4P5O B;  2L0B A;  2JMD A;  1Z60 A;  3L1Z B;  5LKX A;  2VJE B;  1VYX A;  2LGV A;  3HCS A;  3LQH A;  1E4U A;  2LV9 A;  2KIZ A;  2YUR A;  4I7B A;  2ECW A;  4NN2 A;  3SOW A;  2YYR A;  5B8D A;  2KE1 A;  3FL2 A;  1JM7 B;  2E6R A;  3MHS A;  4GNG A;  3EB5 A;  1LDK C;  3U5P A;  2K4D A;  5FB0 A;  3ZVZ B;  3RTR B;  3U5M A;  1WEO A;  1MM3 A;  1N87 A;  3ZTG A;  1WE9 A;  2VPG A;  2LRI C;  4BHW A;  2YSM A;  4V3K C;  1VD4 A;  2H0D A;  5AIU A;  4YBM A;  2KWK A;  4TKP B;  1F62 A;  1V87 A;  3I2D A;  1HYJ A;  2CSY A;  4GNE A;  4UI9 B;  3QZV A;  5I3L A;  1T1H A;  2LDR A;  4YAX A;  1X4I A;  4A4B A;  5FB1 A;  2E6S A;  5KH3 A;  2M85 A;  3O37 A;  3V43 A;  3NG2 A;  3N9N A;  4W4U A;  3N9O A;  2VJF A;  2K1J A;  5B79 A;  4BBQ A;  3C5K A;  4I7D A;  5LCW B;  2H0D B;  1U6G B;  5D1K B;  3U5O A;  4QF3 A;  1DVP A;  1WEM A;  4F52 B;  3KV5 A;  4PTB A;  5TBN A;  4ZQL A;  4X3G A;  4LK9 A;  4YBT A;  3RPG B;  1BOR A;  2M6M A;  4UP5 A;  1FP0 A;  1WIM A;  5H1T A;  2VPE A;  5C11 A;  5G05 B;  4N3W A;  4AYC B;  4R2Y A;  3RPG C;  4LKA A;  3L1X A;  4S3O B;  2ECJ A;  2L80 A;  4AUQ B;  5LKT A;  2MIQ A;  3M62 A;  3M63 A;  3U5N A;  2K17 A;  2KWN A;  2M3H A;  5G0F A;  4A49 A;  3T6R A;  5LKZ A;  5EYA F;  3M99 A;  4YBS A;  1RMD A;  2MD7 B;  1WEN A;  3KV6 A;  2KR4 A;  4FIP A;  4YC9 A;  3GL6 A;  4CA1 A;  3O34 A;  5J3X A;  3N9M A;  2YT5 A;  2FUI A;  3N9P A;  4N4F A;  2DX8 A;  2YSJ A;  5JG6 A;  4WA6 A;  2L43 A;  2G43 A;  4B86 C;  2HYE D;  3KNV A;  1G25 A;  4FK5 A;  4WZ0 A;  3O7A A;  5B75 A;  4FJC A;  2KU3 A;  1Z2Q A;  4Q6F A;  5B77 A;  4R8P K;  2PNX A;  5TRB A;  4PPE A;  3ZPV E;  2HDP A;  2YW8 A;  3ZYQ A;  5D1L B;  5LKU A;  1K2F A;  2QIC A;  2CT2 A;  3N9L A;  2LXP C;  2L5U A;  2MUM A;  2VP7 A;  4A0C D;  3IHP A;  4WZ3 B;  2LXH C;  2YUC A;  1FBV A;  2YQM A;  3DPL R;  1X4U A;  2FSA A;  3C6W A;  3MHH A;  4UP0 A;  2ECI A;  4C9Z A;  2YRE A;  5B76 A;  4R7E A;  1WIL A;  3PHD A;  3EB6 A;  2G45 A;  5FEY A;  2EGP A;  2L75 A;  5TDR A;  2XEU A;  1WEV A;  5DKA A;  2VPD A;  3L11 A;  2XB1 A;  4ZDT A;  2CSZ A;  2Y1N A;  5TAB A;  3LRQ A;  4IC2 A;  3N9Q A;  1WEE A;  1WEU A;  2KFT A;  2BAY A;  3O70 A;  2LN0 A;  4L7X A;  2VJF B;  3ASL A;  4QF2 A;  1WES A;  5H9M A;  4XI1 A;  2C2V S;  2OXQ C;  2UZG A;  4CCG X;  3SOX A;  1WEP A;  2F6N A;  4GNF A;  1ZBD B;  4LAD B;  2KRE A;  3HCT A;  2KWO A;  3ZNI A;  3ZVY A;  4AVX A;  2Y1M A;  4YAT A;  2LGG A;  2NAA A;  3O33 A;  1VFY A;  1LDJ B;  4O64 A;  1IYM A;  2LGL A;  2M1R A;  4GND A;  4S3O C;  2AN6 A;  1WGM A;  1MM2 A;  3SOU A;  2YHN A;  2QIZ A;  3DQV R;  2D8S A;  4IC3 A;  2EOD A;  3T7L A;  4LLB A;  1CHC A;  2YQL A; 
#chains in the Genus database with same CATH topology
 2PUY A;  3HTK C;  2CRR A;  2KGG A;  5H1V A;  5H1U A;  5G04 B;  1XWH A;  3ZPV 1;  2P57 A;  4A4C A;  2VPB A;  4I7C A;  4MSX A;  4YAB A;  3PUR A;  2G6Q A;  4GB0 A;  2LGK A;  2VJE A;  1JM7 A;  3SHB A;  1HYI A;  2MNZ A;  2ECG A;  2JMJ A;  4AYC A;  5AIT A;  2CKL A;  2MD8 C;  4ZUX U;  2KYU A;  5TDW A;  2YHO A;  4OGE A;  3GV4 A;  3HCU A;  2JRJ A;  5C13 A;  2CKL B;  4YAD A;  5KH9 A;  1X4J A;  5FER A;  2EA6 A;  3KQI A;  2KGI A;  1WFK A;  2MA5 A;  4V3L C;  2F42 A;  2JM3 A;  5D1M B;  2YU4 A;  2ECN A;  2FUU A;  2ZET C;  4AP4 A;  2MT5 A;  1JOC A;  5SVX A;  4WZ2 A;  2VNF A;  2IDA A;  5DIN A;  1Z6U A;  2RSD A;  2LQ6 A;  2MA6 A;  1WEQ A;  3PUQ A;  4MVT A;  5KH7 A;  2Y43 A;  4LJN A;  2K16 A;  2RI7 A;  2ECT A;  1WEW A;  4L58 A;  2C2L A;  2I50 A;  2KWJ A;  3O35 A;  3FAO A;  2MNY A;  4F1P A;  2F6J A;  3LQI A;  3O36 A;  2QJ0 A;  4B7Y C;  2JMI A;  4FO9 A;  3VK6 A;  3LQJ A;  5B78 A;  2ECV A;  2DSM A;  4P5O B;  2L0B A;  2JMD A;  1Z60 A;  3L1Z B;  5SVI A;  5LKX A;  2VJE B;  1VYX A;  2LGV A;  3HCS A;  3LQH A;  1E4U A;  2LV9 A;  2KIZ A;  2YUR A;  4I7B A;  2ECW A;  4NN2 A;  3SOW A;  3PLW A;  2YYR A;  5B8D A;  2KE1 A;  3FL2 A;  1JM7 B;  2E6R A;  3O47 A;  3MHS A;  4Z0R A;  4GNG A;  3KDE C;  3EB5 A;  5SVI B;  1LDK C;  3U5P A;  5SVY A;  2K4D A;  5FB0 A;  3ZVZ B;  3RTR B;  3U5M A;  1WEO A;  1MM3 A;  1N87 A;  3ZTG A;  1WE9 A;  2VPG A;  2LRI C;  4BHW A;  2YSM A;  4V3K C;  1VD4 A;  2H0D A;  5AIU A;  4YBM A;  2KWK A;  4TKP B;  1F62 A;  1V87 A;  3I2D A;  3MDB C;  1HYJ A;  3SUB A;  2CSY A;  4GNE A;  4UI9 B;  3QZV A;  5I3L A;  1T1H A;  2LDR A;  4YAX A;  1X4I A;  4A4B A;  5FB1 A;  2E6S A;  5KH3 A;  2M85 A;  3O37 A;  3V43 A;  3NG2 A;  4O62 A;  3N9N A;  4W4U A;  3N9O A;  2VJF A;  1MBM A;  2K1J A;  5B79 A;  2CSV A;  3C5K A;  4I7D A;  5LCW B;  4BBQ A;  2H0D B;  1U6G B;  5D1K B;  3U5O A;  4QF3 A;  1DVP A;  3LJU X;  1WEM A;  2XOC A;  4F52 B;  3KV5 A;  4PTB A;  5TBN A;  2E61 A;  4ZQL A;  4X3G A;  3FJU B;  2CRW A;  4LK9 A;  4YBT A;  3RPG B;  1BOR A;  2M6M A;  1FP0 A;  1WIM A;  4UP5 A;  5H1T A;  3FEH A;  3LDY A;  2VPE A;  5C11 A;  5G05 B;  4N3W A;  4AYC B;  4R2Y A;  3RPG C;  2KKX A;  4LKA A;  3L1X A;  2RR4 A;  2DJA A;  2ECJ A;  4S3O B;  2L80 A;  4AUQ B;  5LKT A;  2MIQ A;  3M62 A;  3M63 A;  3U5N A;  2K17 A;  2KWN A;  2YVR A;  2M3H A;  5G0F A;  4A49 A;  3T6R A;  5LKZ A;  5EYA F;  3M99 A;  4YBS A;  1RMD A;  2MD7 B;  1WEN A;  3KV6 A;  2KR4 A;  4FIP A;  2XOY A;  4YC9 A;  3GL6 A;  2B0O E;  4CA1 A;  3O34 A;  5J3X A;  3N9M A;  2YT5 A;  2FUI A;  3N9P A;  4N4F A;  2DX8 A;  2YSJ A;  2JUN A;  5JG6 A;  2D8U A;  4WA6 A;  2L43 A;  2G43 A;  4B86 C;  2HYE D;  3KNV A;  1G25 A;  4FK5 A;  3DWD A;  2MKE A;  4WZ0 A;  3O7A A;  5B75 A;  4FJC A;  2KU3 A;  1Z2Q A;  3JUE A;  3E2D A;  4Q6F A;  5B77 A;  3Q1D A;  4R8P K;  2PNX A;  5TRB A;  4PPE A;  3ZPV E;  2XP0 A;  2HDP A;  2YW8 A;  3ZYQ A;  2FFW A;  5D1L B;  5LKU A;  1K2F A;  2QIC A;  2CT2 A;  3N9L A;  2LXP C;  2L5U A;  2M13 A;  2EXU A;  2MUM A;  2FD4 A;  2VP7 A;  2IQJ A;  4A0C D;  3H7H A;  3IHP A;  4WZ3 B;  2LXH C;  2YUC A;  1FBV A;  2YQM A;  3DPL R;  1X4U A;  2FSA A;  3C6W A;  3MHH A;  4UP0 A;  2ECI A;  4C9Z A;  2YRE A;  5B76 A;  4R7E A;  1DCQ A;  2OWA A;  1WIL A;  3PHD A;  3EB6 A;  5FEY A;  2G45 A;  2EGP A;  2L75 A;  5TDR A;  3FAN A;  2EGM A;  4H9D A;  2XEU A;  1WEV A;  5DKA A;  2VPD A;  3L11 A;  2XB1 A;  4ZDT A;  2CSZ A;  2CON A;  2Y1N A;  5TAB A;  3LRQ A;  4IC2 A;  3N9Q A;  1WEE A;  3FM8 C;  1WEU A;  2KFT A;  2BAY A;  3O70 A;  2LN0 A;  3M7K A;  4L7X A;  2VJF B;  3ASL A;  4QF2 A;  2LAU A;  1WES A;  5H9M A;  4XI1 A;  2C2V S;  2OXQ C;  2UZG A;  4CCG X;  3SOX A;  1WEP A;  2F6N A;  3LVR E;  4GNF A;  1ZBD B;  4LAD B;  2KRE A;  3HCT A;  2KWO A;  3ZNI A;  3ZVY A;  4AVX A;  3T9K A;  2Y1M A;  4YAT A;  2LGG A;  2NAA A;  3O33 A;  1VFY A;  1LDJ B;  4O64 A;  1IYM A;  2LGL A;  2XOZ A;  2KKY A;  2M1R A;  4GND A;  4S3O C;  4Z0O A;  5K3Q A;  3LVQ E;  2AN6 A;  1WGM A;  1MM2 A;  3SOU A;  2YHN A;  2QIZ A;  3DQV R;  2D8S A;  4IC3 A;  4OGC A;  2EOD A;  3T7L A;  4LLB A;  1CHC A;  4QQ4 A;  2YQL A;  3DDT A;  2L7P A; 
#chains in the Genus database with same CATH homology
 2PUY A;  3HTK C;  2KGG A;  5H1V A;  5H1U A;  5G04 B;  1XWH A;  3ZPV 1;  4A4C A;  2VPB A;  4I7C A;  4MSX A;  4YAB A;  3PUR A;  2G6Q A;  4GB0 A;  2LGK A;  2VJE A;  1JM7 A;  3SHB A;  1HYI A;  2MNZ A;  2ECG A;  2JMJ A;  4AYC A;  5AIT A;  2CKL A;  2MD8 C;  4ZUX U;  2KYU A;  5TDW A;  2YHO A;  3GV4 A;  3HCU A;  2JRJ A;  5C13 A;  2CKL B;  4YAD A;  5KH9 A;  1X4J A;  5FER A;  2EA6 A;  3KQI A;  2KGI A;  1WFK A;  2MA5 A;  4V3L C;  2F42 A;  5D1M B;  2YU4 A;  2ECN A;  2FUU A;  2ZET C;  4AP4 A;  2MT5 A;  1JOC A;  4WZ2 A;  2VNF A;  2IDA A;  5DIN A;  1Z6U A;  2RSD A;  2LQ6 A;  2MA6 A;  1WEQ A;  3PUQ A;  4MVT A;  5KH7 A;  2Y43 A;  4LJN A;  2K16 A;  2RI7 A;  2ECT A;  1WEW A;  4L58 A;  2C2L A;  2I50 A;  2KWJ A;  3O35 A;  2MNY A;  2F6J A;  3LQI A;  3O36 A;  2QJ0 A;  4B7Y C;  2JMI A;  4FO9 A;  3VK6 A;  3LQJ A;  5B78 A;  2ECV A;  4P5O B;  2L0B A;  2JMD A;  1Z60 A;  3L1Z B;  5LKX A;  2VJE B;  1VYX A;  2LGV A;  3HCS A;  3LQH A;  1E4U A;  2LV9 A;  2KIZ A;  2YUR A;  4I7B A;  2ECW A;  4NN2 A;  3SOW A;  2YYR A;  5B8D A;  2KE1 A;  3FL2 A;  1JM7 B;  2E6R A;  3MHS A;  4GNG A;  3EB5 A;  1LDK C;  3U5P A;  2K4D A;  5FB0 A;  3ZVZ B;  3RTR B;  3U5M A;  1WEO A;  1MM3 A;  1N87 A;  3ZTG A;  1WE9 A;  2VPG A;  2LRI C;  4BHW A;  2YSM A;  4V3K C;  1VD4 A;  2H0D A;  5AIU A;  4YBM A;  2KWK A;  4TKP B;  1F62 A;  1V87 A;  3I2D A;  1HYJ A;  2CSY A;  4GNE A;  4UI9 B;  3QZV A;  5I3L A;  1T1H A;  2LDR A;  4YAX A;  1X4I A;  4A4B A;  5FB1 A;  2E6S A;  5KH3 A;  2M85 A;  3O37 A;  3V43 A;  3NG2 A;  3N9N A;  4W4U A;  3N9O A;  2VJF A;  2K1J A;  5B79 A;  4BBQ A;  3C5K A;  4I7D A;  5LCW B;  2H0D B;  1U6G B;  5D1K B;  3U5O A;  4QF3 A;  1DVP A;  1WEM A;  4F52 B;  3KV5 A;  4PTB A;  5TBN A;  4ZQL A;  4X3G A;  4LK9 A;  4YBT A;  3RPG B;  1BOR A;  2M6M A;  4UP5 A;  1FP0 A;  1WIM A;  5H1T A;  2VPE A;  5C11 A;  5G05 B;  4N3W A;  4AYC B;  4R2Y A;  3RPG C;  4LKA A;  3L1X A;  4S3O B;  2ECJ A;  2L80 A;  4AUQ B;  5LKT A;  2MIQ A;  3M62 A;  3M63 A;  3U5N A;  2K17 A;  2KWN A;  2M3H A;  5G0F A;  4A49 A;  3T6R A;  5LKZ A;  5EYA F;  3M99 A;  4YBS A;  1RMD A;  2MD7 B;  1WEN A;  3KV6 A;  2KR4 A;  4FIP A;  4YC9 A;  3GL6 A;  4CA1 A;  3O34 A;  5J3X A;  3N9M A;  2YT5 A;  2FUI A;  3N9P A;  4N4F A;  2DX8 A;  2YSJ A;  5JG6 A;  4WA6 A;  2L43 A;  2G43 A;  4B86 C;  2HYE D;  3KNV A;  1G25 A;  4FK5 A;  4WZ0 A;  3O7A A;  5B75 A;  4FJC A;  2KU3 A;  1Z2Q A;  4Q6F A;  5B77 A;  4R8P K;  2PNX A;  5TRB A;  4PPE A;  3ZPV E;  2HDP A;  2YW8 A;  3ZYQ A;  5D1L B;  5LKU A;  1K2F A;  2QIC A;  2CT2 A;  3N9L A;  2LXP C;  2L5U A;  2MUM A;  2VP7 A;  4A0C D;  3IHP A;  4WZ3 B;  2LXH C;  2YUC A;  1FBV A;  2YQM A;  3DPL R;  1X4U A;  2FSA A;  3C6W A;  3MHH A;  4UP0 A;  2ECI A;  4C9Z A;  2YRE A;  5B76 A;  4R7E A;  1WIL A;  3PHD A;  3EB6 A;  2G45 A;  5FEY A;  2EGP A;  2L75 A;  5TDR A;  2XEU A;  1WEV A;  5DKA A;  2VPD A;  3L11 A;  2XB1 A;  4ZDT A;  2CSZ A;  2Y1N A;  5TAB A;  3LRQ A;  4IC2 A;  3N9Q A;  1WEE A;  1WEU A;  2KFT A;  2BAY A;  3O70 A;  2LN0 A;  4L7X A;  2VJF B;  3ASL A;  4QF2 A;  1WES A;  5H9M A;  4XI1 A;  2C2V S;  2OXQ C;  2UZG A;  4CCG X;  3SOX A;  1WEP A;  2F6N A;  4GNF A;  1ZBD B;  4LAD B;  2KRE A;  3HCT A;  2KWO A;  3ZNI A;  3ZVY A;  4AVX A;  2Y1M A;  4YAT A;  2LGG A;  2NAA A;  3O33 A;  1VFY A;  1LDJ B;  4O64 A;  1IYM A;  2LGL A;  2M1R A;  4GND A;  4S3O C;  2AN6 A;  1WGM A;  1MM2 A;  3SOU A;  2YHN A;  2QIZ A;  3DQV R;  2D8S A;  4IC3 A;  2EOD A;  3T7L A;  4LLB A;  1CHC A;  2YQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...