2YHNA

The idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
VLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Idol-Ube2D Complex Mediates Sterol-Dependent Degradation of the Ldl Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MYLIP
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yhnA00
3HCTA 1N87A 2MD7B 4BBQA 2YURA 2DX8A 2CKLB 2K4DA 2VPGA 3T7LA 2ECVA 5LKXA 2VPBA 2VJEA 2KREA 3NG2A 2KWOA 5FEYA 4LJNA 1LDJB 4B7YC 1WILA 5I3LA 3PURA 2KWKA 2C2LA 3C5KA 3U5OA 2QIZA 2AN6A 1G25A 4CCGX 1WE9A 2E6RA 2M85A 4YAXA 3RTRB 2JMJA 4WZ2A 4A4BA 4L58A 4YBMA 2KWNA 2CKLA 2YHOA 4I7BA 2K1JA 5C11A 1JM7A 2UZGA 2QJ0A 5H1VA 4FJCA 4B86C 2MT5A 5FB0A 2C2VS 4IC3A 2I50A 5B78A 3O34A 4BHWA 2Y1NA 4GNEA 4PTBA 3O36A 4LLBA 2YSMA 3PHDA 3O33A 3O35A 4PPEA 5D1LB 3LQJA 2D8SA 2F6NA 4W4UA 4S3OB 4A0CD 3LRQA 4I7DA 3N9NA 3LQIA 4LKAA 3ZVYA 5C13A 4AP4A 3V43A 2E6SA 4ZDTA 2FUIA 2NAAA 4FK5A 1WEPA 4FO9A 1MM2A 2L75A 4TKPB 2VNFA 2VPEA 3L1XA 3HCUA 3HCSA 5G05B 2MA6A 2MUMA 1WFKA 2YT5A 4A4CA 2H0DA 1VFYA 1JOCA 5J3XA 4YABA 1X4IA 2CSZA 3C6WA 2F6JA 4AUQB 4QF2A 1Z6UA 2KR4A 5LCWB 4YC9A 3SHBA 1IYMA 5TDWA 5B79A 4YATA 5H9MA 2YU4A 2RSDA 1XWHA 2Y43A 4V3LC 1Z2QA 5KH9A 5LKTA 1BORA 3O70A 2VJFA 4XI1A 1V87A 4WZ3B 1RMDA 4ZQLA 5AITA 1DVPA 1FBVA 2M1RA 4GNGA 4AYCB 2YHNA 2LRIC 4AYCA 5FB1A 4WA6A 2EA6A 2PUYA 4O64A 2ECGA 2LXPC 5D1MB 2QICA 1WGMA 4GB0A 4AVXA 2MNZA 2FSAA 1CHCA 3N9OA 5TBNA 3RPGC 2LDRA 2XEUA 1WESA 4QF3A 2FUUA 3I2DA 2YSJA 4GNFA 1WEMA 1WENA 3M63A 3GL6A 4IC2A 2L43A 4F52B 2YUCA 2YQLA 3KV5A 3U5MA 2G43A 1LDKC 2XB1A 2CT2A 2JMIA 4YBTA 2L0BA 2ECJA 2BAYA 2M6MA 5FERA 2KFTA 3EB5A 3HTKC 1WEQA 5DKAA 3GV4A 2HYED 3KNVA 3N9LA 2Y1MA 5KH7A 4Q6FA 2G45A 2MNYA 2YW8A 4NN2A 2YREA 2HDPA 1X4UA 2EODA 3MHHA 2ECWA 2KU3A 2L80A 1VD4A 2LGGA 5B76A 5B75A 5TRBA 3SOXA 4P5OB 4FIPA 5H1TA 3RPGB 5LKZA 3N9MA 2EGPA 2LN0A 3ASLA 3M99A 4UI9B 3ZPV1 3MHSA 5DINA 3U5PA 3KV6A 4R7EA 1T1HA 2LGVA 5KH3A 2IDAA 1WIMA 4I7CA 5EYAF 4WZ0A 2VP7A 5TDRA 5AIUA 1FP0A 4L7XA 3ZVZB 2LQ6A 2KWJA 5G0FA 2LGLA 3FL2A 1HYJA 2RI7A 1WEUA 1VYXA 2YYRA 2KYUA 4UP5A 2LGKA 4MSXA 2VPDA 5G04B 5B77A 2G6QA 4N3WA 2KE1A 2KGGA 2OXQC 1JM7B 3EB6A 1F62A 2LXHC 3SOWA 2F42A 3KQIA 4LK9A 1Z60A 1HYIA 4MVTA 2VJFB 4V3KC 3U5NA 4C9ZA 2YQMA 3N9PA 4YBSA 2K17A 5TABA 5D1KB 2JRJA 2MA5A 4X3GA 3ZPVE 2VJEB 2H0DB 4YADA 1E4UA 2LV9A 3T6RA 5H1UA 2ZETC 3ZNIA 3ZTGA 3M62A 3IHPA 5JG6A 4CA1A 1WEOA 3PUQA 5LKUA 3N9QA 1WEEA 2CSYA 4LADB 2KGIA 1X4JA 4R8PK 2KIZA 2ECIA 1MM3A 4UP0A 3SOUA 2ECTA 2MD8C 2L5UA 3L1ZB 2ECNA 3QZVA 1ZBDB 1WEWA 1U6GB 1WEVA 5B8DA 3O37A 3L11A 4R2YA 2M3HA 3ZYQA 2PNXA 4ZUXU 4N4FA 3LQHA 3DQVR 2JMDA 4GNDA 4A49A 3O7AA 3DPLR 2MIQA 1K2FA 2K16A 4S3OC 3VK6A
chains in the Genus database with same CATH superfamily
3HCTA 1N87A 2MD7B 4BBQA 2YURA 2DX8A 2KKYA 2CKLB 2IQJA 2CRWA 2K4DA 2VPGA 3T7LA 2ECVA 5LKXA 2VPBA 2VJEA 2KREA 2EGMA 3NG2A 2KWOA 5FEYA 4LJNA 1LDJB 4B7YC 1WILA 5I3LA 3PURA 2KWKA 2C2LA 3C5KA 3DDTA 3U5OA 2QIZA 2AN6A 1G25A 4CCGX 1WE9A 2E6RA 2M85A 4YAXA 3RTRB 2JMJA 4WZ2A 5SVIB 4A4BA 4L58A 4YBMA 2KWNA 2CKLA 2YHOA 4I7BA 2K1JA 5C11A 1JM7A 2UZGA 2QJ0A 5H1VA 4FJCA 2MT5A 4B86C 5FB0A 2C2VS 4IC3A 2I50A 5B78A 3O34A 4BHWA 2Y1NA 4GNEA 4PTBA 3O36A 4LLBA 2YSMA 3PHDA 3O33A 3O35A 4PPEA 4F1PA 5D1LB 3LQJA 2D8SA 2F6NA 3LJUX 4W4UA 2DSMA 4S3OB 4A0CD 3LRQA 4I7DA 2XOCA 3N9NA 3LQIA 4LKAA 3ZVYA 5C13A 4AP4A 3V43A 2E6SA 4ZDTA 2FUIA 2NAAA 4FK5A 1WEPA 4FO9A 1MM2A 2L75A 4TKPB 2VNFA 2VPEA 3L1XA 2M13A 3HCUA 3LVQE 2RR4A 3HCSA 5G05B 2MA6A 2MUMA 5SVXA 1WFKA 2YT5A 4Z0RA 4A4CA 2H0DA 1VFYA 1JOCA 3FANA 5J3XA 4OGEA 4YABA 1X4IA 2CSZA 2KKXA 3C6WA 2F6JA 4AUQB 4QF2A 1Z6UA 2XP0A 2KR4A 5LCWB 4YC9A 3SHBA 1IYMA 5TDWA 5B79A 3SUBA 4YATA 5H9MA 2YU4A 2RSDA 1XWHA 2Y43A 4V3LC 1Z2QA 5KH9A 5LKTA 1BORA 3O70A 2VJFA 4XI1A 1V87A 4WZ3B 1RMDA 4ZQLA 3FM8C 5AITA 1DVPA 5K3QA 1FBVA 2M1RA 4GNGA 4AYCB 2YHNA 2LRIC 4AYCA 4Z0OA 5FB1A 4H9DA 4O62A 4WA6A 2EA6A 3DWDA 2PUYA 4O64A 2ECGA 2P57A 2LXPC 5D1MB 2QICA 1WGMA 4GB0A 4AVXA 2MNZA 2FSAA 1CHCA 2MKEA 3N9OA 5TBNA 3RPGC 3O47A 2LDRA 2XEUA 1WESA 4QF3A 2FUUA 3I2DA 2YSJA 4GNFA 1WEMA 1WENA 3M63A 3GL6A 4IC2A 2L43A 4F52B 2YUCA 2YQLA 3KV5A 2FFWA 3FJUB 3U5MA 4QQ4A 2G43A 1LDKC 2XB1A 4OGCA 2CONA 2CT2A 2JMIA 4YBTA 2L0BA 2ECJA 5SVIA 2BAYA 2E61A 2M6MA 5FERA 2KFTA 3EB5A 3HTKC 1WEQA 5DKAA 3GV4A 2JUNA 2HYED 3KNVA 3N9LA 2Y1MA 5KH7A 4Q6FA 2G45A 2B0OE 2XOYA 2MNYA 2YW8A 4NN2A 3LVRE 3LDYA 2YREA 2HDPA 1X4UA 2EODA 3MHHA 2ECWA 2XOZA 2KU3A 2L80A 5SVYA 1VD4A 2LGGA 2OWAA 3T9KA 5B76A 5B75A 5TRBA 3JUEA 3SOXA 4P5OB 4FIPA 5H1TA 3RPGB 5LKZA 3N9MA 2EGPA 2LN0A 3ASLA 3M99A 4UI9B 3ZPV1 3MHSA 5DINA 3U5PA 3KV6A 4R7EA 1T1HA 2LGVA 5KH3A 2IDAA 1MBMA 1WIMA 4I7CA 5EYAF 4WZ0A 2VP7A 2L7PA 2D8UA 5TDRA 2JM3A 5AIUA 1FP0A 4L7XA 3ZVZB 2LQ6A 1DCQA 2KWJA 5G0FA 2LGLA 3FL2A 1HYJA 2RI7A 1WEUA 1VYXA 2YYRA 2KYUA 4UP5A 2LGKA 3FEHA 4MSXA 2VPDA 5G04B 5B77A 2G6QA 4N3WA 2KE1A 2KGGA 2OXQC 2YVRA 1JM7B 3KDEC 3EB6A 1F62A 2LXHC 3SOWA 2F42A 3KQIA 4LK9A 1Z60A 1HYIA 4MVTA 2VJFB 2DJAA 4V3KC 3U5NA 4C9ZA 2YQMA 3N9PA 4YBSA 2K17A 5TABA 2EXUA 3FAOA 5D1KB 2JRJA 2MA5A 4X3GA 3ZPVE 2VJEB 2H0DB 4YADA 1E4UA 2LV9A 3T6RA 2LAUA 5H1UA 3E2DA 2ZETC 3Q1DA 3MDBC 3ZNIA 3ZTGA 3M62A 2CSVA 3IHPA 5JG6A 4CA1A 1WEOA 3PUQA 5LKUA 3N9QA 1WEEA 2CSYA 4LADB 2KGIA 1X4JA 4R8PK 2KIZA 2ECIA 1MM3A 4UP0A 3SOUA 2ECTA 2L5UA 2MD8C 3L1ZB 2ECNA 3QZVA 3PLWA 1ZBDB 1WEWA 1U6GB 1WEVA 5B8DA 3O37A 3L11A 4R2YA 2M3HA 2CRRA 3ZYQA 2PNXA 4ZUXU 4N4FA 3LQHA 3DQVR 2JMDA 4GNDA 4A49A 3H7HA 3O7AA 3DPLR 2FD4A 3M7KA 2MIQA 1K2FA 2K16A 4S3OC 3VK6A
chains in the Genus database with same CATH topology
3HCTA 1N87A 2MD7B 4BBQA 2YURA 2DX8A 2CKLB 2K4DA 2VPGA 3T7LA 2ECVA 5LKXA 2VPBA 2VJEA 2KREA 3NG2A 2KWOA 5FEYA 4LJNA 1LDJB 4B7YC 1WILA 5I3LA 3PURA 2KWKA 2C2LA 3C5KA 3U5OA 2QIZA 2AN6A 1G25A 4CCGX 1WE9A 2E6RA 2M85A 4YAXA 3RTRB 2JMJA 4WZ2A 4A4BA 4L58A 4YBMA 2KWNA 2CKLA 2YHOA 4I7BA 2K1JA 5C11A 1JM7A 2UZGA 2QJ0A 5H1VA 4FJCA 4B86C 2MT5A 5FB0A 2C2VS 4IC3A 2I50A 5B78A 3O34A 4BHWA 2Y1NA 4GNEA 4PTBA 3O36A 4LLBA 2YSMA 3PHDA 3O33A 3O35A 4PPEA 5D1LB 3LQJA 2D8SA 2F6NA 4W4UA 4S3OB 4A0CD 3LRQA 4I7DA 3N9NA 3LQIA 4LKAA 3ZVYA 5C13A 4AP4A 3V43A 2E6SA 4ZDTA 2FUIA 2NAAA 4FK5A 1WEPA 4FO9A 1MM2A 2L75A 4TKPB 2VNFA 2VPEA 3L1XA 3HCUA 3HCSA 5G05B 2MA6A 2MUMA 1WFKA 2YT5A 4A4CA 2H0DA 1VFYA 1JOCA 5J3XA 4YABA 1X4IA 2CSZA 3C6WA 2F6JA 4AUQB 4QF2A 1Z6UA 2KR4A 5LCWB 4YC9A 3SHBA 1IYMA 5TDWA 5B79A 4YATA 5H9MA 2YU4A 2RSDA 1XWHA 2Y43A 4V3LC 1Z2QA 5KH9A 5LKTA 1BORA 3O70A 2VJFA 4XI1A 1V87A 4WZ3B 1RMDA 4ZQLA 5AITA 1DVPA 1FBVA 2M1RA 4GNGA 4AYCB 2YHNA 2LRIC 4AYCA 5FB1A 4WA6A 2EA6A 2PUYA 4O64A 2ECGA 2LXPC 5D1MB 2QICA 1WGMA 4GB0A 4AVXA 2MNZA 2FSAA 1CHCA 3N9OA 5TBNA 3RPGC 2LDRA 2XEUA 1WESA 4QF3A 2FUUA 3I2DA 2YSJA 4GNFA 1WEMA 1WENA 3M63A 3GL6A 4IC2A 2L43A 4F52B 2YUCA 2YQLA 3KV5A 3U5MA 2G43A 1LDKC 2XB1A 2CT2A 2JMIA 4YBTA 2L0BA 2ECJA 2BAYA 2M6MA 5FERA 2KFTA 3EB5A 3HTKC 1WEQA 5DKAA 3GV4A 2HYED 3KNVA 3N9LA 2Y1MA 5KH7A 4Q6FA 2G45A 2MNYA 2YW8A 4NN2A 2YREA 2HDPA 1X4UA 2EODA 3MHHA 2ECWA 2KU3A 2L80A 1VD4A 2LGGA 5B76A 5B75A 5TRBA 3SOXA 4P5OB 4FIPA 5H1TA 3RPGB 5LKZA 3N9MA 2EGPA 2LN0A 3ASLA 3M99A 4UI9B 3ZPV1 3MHSA 5DINA 3U5PA 3KV6A 4R7EA 1T1HA 2LGVA 5KH3A 2IDAA 1WIMA 4I7CA 5EYAF 4WZ0A 2VP7A 5TDRA 5AIUA 1FP0A 4L7XA 3ZVZB 2LQ6A 2KWJA 5G0FA 2LGLA 3FL2A 1HYJA 2RI7A 1WEUA 1VYXA 2YYRA 2KYUA 4UP5A 2LGKA 4MSXA 2VPDA 5G04B 5B77A 2G6QA 4N3WA 2KE1A 2KGGA 2OXQC 1JM7B 3EB6A 1F62A 2LXHC 3SOWA 2F42A 3KQIA 4LK9A 1Z60A 1HYIA 4MVTA 2VJFB 4V3KC 3U5NA 4C9ZA 2YQMA 3N9PA 4YBSA 2K17A 5TABA 5D1KB 2JRJA 2MA5A 4X3GA 3ZPVE 2VJEB 2H0DB 4YADA 1E4UA 2LV9A 3T6RA 5H1UA 2ZETC 3ZNIA 3ZTGA 3M62A 3IHPA 5JG6A 4CA1A 1WEOA 3PUQA 5LKUA 3N9QA 1WEEA 2CSYA 4LADB 2KGIA 1X4JA 4R8PK 2KIZA 2ECIA 1MM3A 4UP0A 3SOUA 2ECTA 2MD8C 2L5UA 3L1ZB 2ECNA 3QZVA 1ZBDB 1WEWA 1U6GB 1WEVA 5B8DA 3O37A 3L11A 4R2YA 2M3HA 3ZYQA 2PNXA 4ZUXU 4N4FA 3LQHA 3DQVR 2JMDA 4GNDA 4A49A 3O7AA 3DPLR 2MIQA 1K2FA 2K16A 4S3OC 3VK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCT A;  1N87 A;  2MD7 B;  4BBQ A;  2YUR A;  2DX8 A;  2CKL B;  2K4D A;  2VPG A;  3T7L A;  2ECV A;  5LKX A;  2VPB A;  2VJE A;  2KRE A;  3NG2 A;  2KWO A;  5FEY A;  4LJN A;  1LDJ B;  4B7Y C;  1WIL A;  5I3L A;  3PUR A;  2KWK A;  2C2L A;  3C5K A;  3U5O A;  2QIZ A;  2AN6 A;  1G25 A;  4CCG X;  1WE9 A;  2E6R A;  2M85 A;  4YAX A;  3RTR B;  2JMJ A;  4WZ2 A;  4A4B A;  4L58 A;  4YBM A;  2KWN A;  2CKL A;  2YHO A;  4I7B A;  2K1J A;  5C11 A;  1JM7 A;  2UZG A;  2QJ0 A;  5H1V A;  4FJC A;  4B86 C;  2MT5 A;  5FB0 A;  2C2V S;  4IC3 A;  2I50 A;  5B78 A;  3O34 A;  4BHW A;  2Y1N A;  4GNE A;  4PTB A;  3O36 A;  4LLB A;  2YSM A;  3PHD A;  3O33 A;  3O35 A;  4PPE A;  5D1L B;  3LQJ A;  2D8S A;  2F6N A;  4W4U A;  4S3O B;  4A0C D;  3LRQ A;  4I7D A;  3N9N A;  3LQI A;  4LKA A;  3ZVY A;  5C13 A;  4AP4 A;  3V43 A;  2E6S A;  4ZDT A;  2FUI A;  2NAA A;  4FK5 A;  1WEP A;  4FO9 A;  1MM2 A;  2L75 A;  4TKP B;  2VNF A;  2VPE A;  3L1X A;  3HCU A;  3HCS A;  5G05 B;  2MA6 A;  2MUM A;  1WFK A;  2YT5 A;  4A4C A;  2H0D A;  1VFY A;  1JOC A;  5J3X A;  4YAB A;  1X4I A;  2CSZ A;  3C6W A;  2F6J A;  4AUQ B;  4QF2 A;  1Z6U A;  2KR4 A;  5LCW B;  4YC9 A;  3SHB A;  1IYM A;  5TDW A;  5B79 A;  4YAT A;  5H9M A;  2YU4 A;  2RSD A;  1XWH A;  2Y43 A;  4V3L C;  1Z2Q A;  5KH9 A;  5LKT A;  1BOR A;  3O70 A;  2VJF A;  4XI1 A;  1V87 A;  4WZ3 B;  1RMD A;  4ZQL A;  5AIT A;  1DVP A;  1FBV A;  2M1R A;  4GNG A;  4AYC B;  2YHN A;  2LRI C;  4AYC A;  5FB1 A;  4WA6 A;  2EA6 A;  2PUY A;  4O64 A;  2ECG A;  2LXP C;  5D1M B;  2QIC A;  1WGM A;  4GB0 A;  4AVX A;  2MNZ A;  2FSA A;  1CHC A;  3N9O A;  5TBN A;  3RPG C;  2LDR A;  2XEU A;  1WES A;  4QF3 A;  2FUU A;  3I2D A;  2YSJ A;  4GNF A;  1WEM A;  1WEN A;  3M63 A;  3GL6 A;  4IC2 A;  2L43 A;  4F52 B;  2YUC A;  2YQL A;  3KV5 A;  3U5M A;  2G43 A;  1LDK C;  2XB1 A;  2CT2 A;  2JMI A;  4YBT A;  2L0B A;  2ECJ A;  2BAY A;  2M6M A;  5FER A;  2KFT A;  3EB5 A;  3HTK C;  1WEQ A;  5DKA A;  3GV4 A;  2HYE D;  3KNV A;  3N9L A;  2Y1M A;  5KH7 A;  4Q6F A;  2G45 A;  2MNY A;  2YW8 A;  4NN2 A;  2YRE A;  2HDP A;  1X4U A;  2EOD A;  3MHH A;  2ECW A;  2KU3 A;  2L80 A;  1VD4 A;  2LGG A;  5B76 A;  5B75 A;  5TRB A;  3SOX A;  4P5O B;  4FIP A;  5H1T A;  3RPG B;  5LKZ A;  3N9M A;  2EGP A;  2LN0 A;  3ASL A;  3M99 A;  4UI9 B;  3ZPV 1;  3MHS A;  5DIN A;  3U5P A;  3KV6 A;  4R7E A;  1T1H A;  2LGV A;  5KH3 A;  2IDA A;  1WIM A;  4I7C A;  5EYA F;  4WZ0 A;  2VP7 A;  5TDR A;  5AIU A;  1FP0 A;  4L7X A;  3ZVZ B;  2LQ6 A;  2KWJ A;  5G0F A;  2LGL A;  3FL2 A;  1HYJ A;  2RI7 A;  1WEU A;  1VYX A;  2YYR A;  2KYU A;  4UP5 A;  2LGK A;  4MSX A;  2VPD A;  5G04 B;  5B77 A;  2G6Q A;  4N3W A;  2KE1 A;  2KGG A;  2OXQ C;  1JM7 B;  3EB6 A;  1F62 A;  2LXH C;  3SOW A;  2F42 A;  3KQI A;  4LK9 A;  1Z60 A;  1HYI A;  4MVT A;  2VJF B;  4V3K C;  3U5N A;  4C9Z A;  2YQM A;  3N9P A;  4YBS A;  2K17 A;  5TAB A;  5D1K B;  2JRJ A;  2MA5 A;  4X3G A;  3ZPV E;  2VJE B;  2H0D B;  4YAD A;  1E4U A;  2LV9 A;  3T6R A;  5H1U A;  2ZET C;  3ZNI A;  3ZTG A;  3M62 A;  3IHP A;  5JG6 A;  4CA1 A;  1WEO A;  3PUQ A;  5LKU A;  3N9Q A;  1WEE A;  2CSY A;  4LAD B;  2KGI A;  1X4J A;  4R8P K;  2KIZ A;  2ECI A;  1MM3 A;  4UP0 A;  3SOU A;  2ECT A;  2MD8 C;  2L5U A;  3L1Z B;  2ECN A;  3QZV A;  1ZBD B;  1WEW A;  1U6G B;  1WEV A;  5B8D A;  3O37 A;  3L11 A;  4R2Y A;  2M3H A;  3ZYQ A;  2PNX A;  4ZUX U;  4N4F A;  3LQH A;  3DQV R;  2JMD A;  4GND A;  4A49 A;  3O7A A;  3DPL R;  2MIQ A;  1K2F A;  2K16 A;  4S3O C;  3VK6 A; 
#chains in the Genus database with same CATH topology
 3HCT A;  1N87 A;  2MD7 B;  4BBQ A;  2YUR A;  2DX8 A;  2KKY A;  2CKL B;  2IQJ A;  2CRW A;  2K4D A;  2VPG A;  3T7L A;  2ECV A;  5LKX A;  2VPB A;  2VJE A;  2KRE A;  2EGM A;  3NG2 A;  2KWO A;  5FEY A;  4LJN A;  1LDJ B;  4B7Y C;  1WIL A;  5I3L A;  3PUR A;  2KWK A;  2C2L A;  3C5K A;  3DDT A;  3U5O A;  2QIZ A;  2AN6 A;  1G25 A;  4CCG X;  1WE9 A;  2E6R A;  2M85 A;  4YAX A;  3RTR B;  2JMJ A;  4WZ2 A;  5SVI B;  4A4B A;  4L58 A;  4YBM A;  2KWN A;  2CKL A;  2YHO A;  4I7B A;  2K1J A;  5C11 A;  1JM7 A;  2UZG A;  2QJ0 A;  5H1V A;  4FJC A;  2MT5 A;  4B86 C;  5FB0 A;  2C2V S;  4IC3 A;  2I50 A;  5B78 A;  3O34 A;  4BHW A;  2Y1N A;  4GNE A;  4PTB A;  3O36 A;  4LLB A;  2YSM A;  3PHD A;  3O33 A;  3O35 A;  4PPE A;  4F1P A;  5D1L B;  3LQJ A;  2D8S A;  2F6N A;  3LJU X;  4W4U A;  2DSM A;  4S3O B;  4A0C D;  3LRQ A;  4I7D A;  2XOC A;  3N9N A;  3LQI A;  4LKA A;  3ZVY A;  5C13 A;  4AP4 A;  3V43 A;  2E6S A;  4ZDT A;  2FUI A;  2NAA A;  4FK5 A;  1WEP A;  4FO9 A;  1MM2 A;  2L75 A;  4TKP B;  2VNF A;  2VPE A;  3L1X A;  2M13 A;  3HCU A;  3LVQ E;  2RR4 A;  3HCS A;  5G05 B;  2MA6 A;  2MUM A;  5SVX A;  1WFK A;  2YT5 A;  4Z0R A;  4A4C A;  2H0D A;  1VFY A;  1JOC A;  3FAN A;  5J3X A;  4OGE A;  4YAB A;  1X4I A;  2CSZ A;  2KKX A;  3C6W A;  2F6J A;  4AUQ B;  4QF2 A;  1Z6U A;  2XP0 A;  2KR4 A;  5LCW B;  4YC9 A;  3SHB A;  1IYM A;  5TDW A;  5B79 A;  3SUB A;  4YAT A;  5H9M A;  2YU4 A;  2RSD A;  1XWH A;  2Y43 A;  4V3L C;  1Z2Q A;  5KH9 A;  5LKT A;  1BOR A;  3O70 A;  2VJF A;  4XI1 A;  1V87 A;  4WZ3 B;  1RMD A;  4ZQL A;  3FM8 C;  5AIT A;  1DVP A;  5K3Q A;  1FBV A;  2M1R A;  4GNG A;  4AYC B;  2YHN A;  2LRI C;  4AYC A;  4Z0O A;  5FB1 A;  4H9D A;  4O62 A;  4WA6 A;  2EA6 A;  3DWD A;  2PUY A;  4O64 A;  2ECG A;  2P57 A;  2LXP C;  5D1M B;  2QIC A;  1WGM A;  4GB0 A;  4AVX A;  2MNZ A;  2FSA A;  1CHC A;  2MKE A;  3N9O A;  5TBN A;  3RPG C;  3O47 A;  2LDR A;  2XEU A;  1WES A;  4QF3 A;  2FUU A;  3I2D A;  2YSJ A;  4GNF A;  1WEM A;  1WEN A;  3M63 A;  3GL6 A;  4IC2 A;  2L43 A;  4F52 B;  2YUC A;  2YQL A;  3KV5 A;  2FFW A;  3FJU B;  3U5M A;  4QQ4 A;  2G43 A;  1LDK C;  2XB1 A;  4OGC A;  2CON A;  2CT2 A;  2JMI A;  4YBT A;  2L0B A;  2ECJ A;  5SVI A;  2BAY A;  2E61 A;  2M6M A;  5FER A;  2KFT A;  3EB5 A;  3HTK C;  1WEQ A;  5DKA A;  3GV4 A;  2JUN A;  2HYE D;  3KNV A;  3N9L A;  2Y1M A;  5KH7 A;  4Q6F A;  2G45 A;  2B0O E;  2XOY A;  2MNY A;  2YW8 A;  4NN2 A;  3LVR E;  3LDY A;  2YRE A;  2HDP A;  1X4U A;  2EOD A;  3MHH A;  2ECW A;  2XOZ A;  2KU3 A;  2L80 A;  5SVY A;  1VD4 A;  2LGG A;  2OWA A;  3T9K A;  5B76 A;  5B75 A;  5TRB A;  3JUE A;  3SOX A;  4P5O B;  4FIP A;  5H1T A;  3RPG B;  5LKZ A;  3N9M A;  2EGP A;  2LN0 A;  3ASL A;  3M99 A;  4UI9 B;  3ZPV 1;  3MHS A;  5DIN A;  3U5P A;  3KV6 A;  4R7E A;  1T1H A;  2LGV A;  5KH3 A;  2IDA A;  1MBM A;  1WIM A;  4I7C A;  5EYA F;  4WZ0 A;  2VP7 A;  2L7P A;  2D8U A;  5TDR A;  2JM3 A;  5AIU A;  1FP0 A;  4L7X A;  3ZVZ B;  2LQ6 A;  1DCQ A;  2KWJ A;  5G0F A;  2LGL A;  3FL2 A;  1HYJ A;  2RI7 A;  1WEU A;  1VYX A;  2YYR A;  2KYU A;  4UP5 A;  2LGK A;  3FEH A;  4MSX A;  2VPD A;  5G04 B;  5B77 A;  2G6Q A;  4N3W A;  2KE1 A;  2KGG A;  2OXQ C;  2YVR A;  1JM7 B;  3KDE C;  3EB6 A;  1F62 A;  2LXH C;  3SOW A;  2F42 A;  3KQI A;  4LK9 A;  1Z60 A;  1HYI A;  4MVT A;  2VJF B;  2DJA A;  4V3K C;  3U5N A;  4C9Z A;  2YQM A;  3N9P A;  4YBS A;  2K17 A;  5TAB A;  2EXU A;  3FAO A;  5D1K B;  2JRJ A;  2MA5 A;  4X3G A;  3ZPV E;  2VJE B;  2H0D B;  4YAD A;  1E4U A;  2LV9 A;  3T6R A;  2LAU A;  5H1U A;  3E2D A;  2ZET C;  3Q1D A;  3MDB C;  3ZNI A;  3ZTG A;  3M62 A;  2CSV A;  3IHP A;  5JG6 A;  4CA1 A;  1WEO A;  3PUQ A;  5LKU A;  3N9Q A;  1WEE A;  2CSY A;  4LAD B;  2KGI A;  1X4J A;  4R8P K;  2KIZ A;  2ECI A;  1MM3 A;  4UP0 A;  3SOU A;  2ECT A;  2L5U A;  2MD8 C;  3L1Z B;  2ECN A;  3QZV A;  3PLW A;  1ZBD B;  1WEW A;  1U6G B;  1WEV A;  5B8D A;  3O37 A;  3L11 A;  4R2Y A;  2M3H A;  2CRR A;  3ZYQ A;  2PNX A;  4ZUX U;  4N4F A;  3LQH A;  3DQV R;  2JMD A;  4GND A;  4A49 A;  3H7H A;  3O7A A;  3DPL R;  2FD4 A;  3M7K A;  2MIQ A;  1K2F A;  2K16 A;  4S3O C;  3VK6 A; 
#chains in the Genus database with same CATH homology
 3HCT A;  1N87 A;  2MD7 B;  4BBQ A;  2YUR A;  2DX8 A;  2CKL B;  2K4D A;  2VPG A;  3T7L A;  2ECV A;  5LKX A;  2VPB A;  2VJE A;  2KRE A;  3NG2 A;  2KWO A;  5FEY A;  4LJN A;  1LDJ B;  4B7Y C;  1WIL A;  5I3L A;  3PUR A;  2KWK A;  2C2L A;  3C5K A;  3U5O A;  2QIZ A;  2AN6 A;  1G25 A;  4CCG X;  1WE9 A;  2E6R A;  2M85 A;  4YAX A;  3RTR B;  2JMJ A;  4WZ2 A;  4A4B A;  4L58 A;  4YBM A;  2KWN A;  2CKL A;  2YHO A;  4I7B A;  2K1J A;  5C11 A;  1JM7 A;  2UZG A;  2QJ0 A;  5H1V A;  4FJC A;  4B86 C;  2MT5 A;  5FB0 A;  2C2V S;  4IC3 A;  2I50 A;  5B78 A;  3O34 A;  4BHW A;  2Y1N A;  4GNE A;  4PTB A;  3O36 A;  4LLB A;  2YSM A;  3PHD A;  3O33 A;  3O35 A;  4PPE A;  5D1L B;  3LQJ A;  2D8S A;  2F6N A;  4W4U A;  4S3O B;  4A0C D;  3LRQ A;  4I7D A;  3N9N A;  3LQI A;  4LKA A;  3ZVY A;  5C13 A;  4AP4 A;  3V43 A;  2E6S A;  4ZDT A;  2FUI A;  2NAA A;  4FK5 A;  1WEP A;  4FO9 A;  1MM2 A;  2L75 A;  4TKP B;  2VNF A;  2VPE A;  3L1X A;  3HCU A;  3HCS A;  5G05 B;  2MA6 A;  2MUM A;  1WFK A;  2YT5 A;  4A4C A;  2H0D A;  1VFY A;  1JOC A;  5J3X A;  4YAB A;  1X4I A;  2CSZ A;  3C6W A;  2F6J A;  4AUQ B;  4QF2 A;  1Z6U A;  2KR4 A;  5LCW B;  4YC9 A;  3SHB A;  1IYM A;  5TDW A;  5B79 A;  4YAT A;  5H9M A;  2YU4 A;  2RSD A;  1XWH A;  2Y43 A;  4V3L C;  1Z2Q A;  5KH9 A;  5LKT A;  1BOR A;  3O70 A;  2VJF A;  4XI1 A;  1V87 A;  4WZ3 B;  1RMD A;  4ZQL A;  5AIT A;  1DVP A;  1FBV A;  2M1R A;  4GNG A;  4AYC B;  2YHN A;  2LRI C;  4AYC A;  5FB1 A;  4WA6 A;  2EA6 A;  2PUY A;  4O64 A;  2ECG A;  2LXP C;  5D1M B;  2QIC A;  1WGM A;  4GB0 A;  4AVX A;  2MNZ A;  2FSA A;  1CHC A;  3N9O A;  5TBN A;  3RPG C;  2LDR A;  2XEU A;  1WES A;  4QF3 A;  2FUU A;  3I2D A;  2YSJ A;  4GNF A;  1WEM A;  1WEN A;  3M63 A;  3GL6 A;  4IC2 A;  2L43 A;  4F52 B;  2YUC A;  2YQL A;  3KV5 A;  3U5M A;  2G43 A;  1LDK C;  2XB1 A;  2CT2 A;  2JMI A;  4YBT A;  2L0B A;  2ECJ A;  2BAY A;  2M6M A;  5FER A;  2KFT A;  3EB5 A;  3HTK C;  1WEQ A;  5DKA A;  3GV4 A;  2HYE D;  3KNV A;  3N9L A;  2Y1M A;  5KH7 A;  4Q6F A;  2G45 A;  2MNY A;  2YW8 A;  4NN2 A;  2YRE A;  2HDP A;  1X4U A;  2EOD A;  3MHH A;  2ECW A;  2KU3 A;  2L80 A;  1VD4 A;  2LGG A;  5B76 A;  5B75 A;  5TRB A;  3SOX A;  4P5O B;  4FIP A;  5H1T A;  3RPG B;  5LKZ A;  3N9M A;  2EGP A;  2LN0 A;  3ASL A;  3M99 A;  4UI9 B;  3ZPV 1;  3MHS A;  5DIN A;  3U5P A;  3KV6 A;  4R7E A;  1T1H A;  2LGV A;  5KH3 A;  2IDA A;  1WIM A;  4I7C A;  5EYA F;  4WZ0 A;  2VP7 A;  5TDR A;  5AIU A;  1FP0 A;  4L7X A;  3ZVZ B;  2LQ6 A;  2KWJ A;  5G0F A;  2LGL A;  3FL2 A;  1HYJ A;  2RI7 A;  1WEU A;  1VYX A;  2YYR A;  2KYU A;  4UP5 A;  2LGK A;  4MSX A;  2VPD A;  5G04 B;  5B77 A;  2G6Q A;  4N3W A;  2KE1 A;  2KGG A;  2OXQ C;  1JM7 B;  3EB6 A;  1F62 A;  2LXH C;  3SOW A;  2F42 A;  3KQI A;  4LK9 A;  1Z60 A;  1HYI A;  4MVT A;  2VJF B;  4V3K C;  3U5N A;  4C9Z A;  2YQM A;  3N9P A;  4YBS A;  2K17 A;  5TAB A;  5D1K B;  2JRJ A;  2MA5 A;  4X3G A;  3ZPV E;  2VJE B;  2H0D B;  4YAD A;  1E4U A;  2LV9 A;  3T6R A;  5H1U A;  2ZET C;  3ZNI A;  3ZTG A;  3M62 A;  3IHP A;  5JG6 A;  4CA1 A;  1WEO A;  3PUQ A;  5LKU A;  3N9Q A;  1WEE A;  2CSY A;  4LAD B;  2KGI A;  1X4J A;  4R8P K;  2KIZ A;  2ECI A;  1MM3 A;  4UP0 A;  3SOU A;  2ECT A;  2MD8 C;  2L5U A;  3L1Z B;  2ECN A;  3QZV A;  1ZBD B;  1WEW A;  1U6G B;  1WEV A;  5B8D A;  3O37 A;  3L11 A;  4R2Y A;  2M3H A;  3ZYQ A;  2PNX A;  4ZUX U;  4N4F A;  3LQH A;  3DQV R;  2JMD A;  4GND A;  4A49 A;  3O7A A;  3DPL R;  2MIQ A;  1K2F A;  2K16 A;  4S3O C;  3VK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...