2YHNA

The idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
VLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MYLIP
publication title The Idol-Ube2D Complex Mediates Sterol-Dependent Degradation of the Ldl Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yhnA00
2BAYA 3T6RA 2PNXA 1VFYA 4Q6FA 4YABA 3N9QA 2MIQA 3MHSA 1X4IA 3DQVR 3ZVZB 2MUMA 2VPGA 4GB0A 5C13A 3GV4A 3MHHA 5LKXA 4NN2A 3RPGB 5TABA 4LADB 2G45A 4C9ZA 2E6SA 2M1RA 3ZTGA 4AYCA 5AIUA 5EYAF 2C2VS 2LGVA 1Z6UA 2MA6A 4MVTA 4S3OC 2MD7B 5G0FA 4I7DA 5C11A 2YQLA 3HCUA 4CCGX 5TDWA 3LQIA 1T1HA 4N3WA 3KV6A 4MSXA 4R2YA 3O70A 3O37A 4YBSA 2XEUA 2KYUA 2LGKA 2CKLA 2YHOA 5TBNA 2K4DA 2JRJA 2ECWA 1HYJA 2YREA 3ZPV1 4A49A 1WENA 4UP5A 5D1MB 2KR4A 4B7YC 2Y1NA 2D8SA 5LCWB 3HTKC 4FJCA 2VP7A 3SOUA 2VPBA 4V3LC 4BBQA 1JM7A 3U5PA 4R7EA 4YADA 2LGGA 2MT5A 2I50A 2FUIA 2ECGA 4UI9B 3U5NA 4IC2A 2OXQC 3ZNIA 4AUQB 2L80A 4FO9A 4A4BA 4CA1A 2ECTA 3SOWA 4YC9A 3PUQA 2JMDA 2LGLA 2VJFA 1ZBDB 2FSAA 2KIZA 2VPDA 3U5MA 1RMDA 3KNVA 4UP0A 5TRBA 3O35A 1CHCA 4QF3A 2XB1A 4GNGA 2K16A 3FL2A 2LRIC 3L1ZB 2L75A 2YQMA 4LJNA 5KH7A 4R8PK 2ECIA 1WEUA 2LV9A 2ECNA 1VD4A 2VNFA 1WEWA 4WA6A 1X4UA 4BHWA 1K2FA 3C5KA 3ASLA 5FERA 2VJEB 2PUYA 5JG6A 1E4UA 5H1TA 3QZVA 5H1VA 1G25A 2CT2A 2JMIA 4YAXA 2ZETC 2VPEA 5I3LA 1JOCA 3LQJA 4GNDA 3O36A 3N9OA 2L43A 1U6GB 2F6NA 1WEVA 4L7XA 3C6WA 3N9NA 3N9PA 2FUUA 3RPGC 1N87A 3SOXA 2KGIA 1WIMA 5FEYA 2F6JA 2QICA 2ECVA 4LKAA 2M6MA 2KWKA 4N4FA 4W4UA 4YBMA 3VK6A 2UZGA 3O33A 3T7LA 2MD8C 2M3HA 3NG2A 3LRQA 3HCTA 2AN6A 4WZ0A 3L11A 3HCSA 3EB5A 1DVPA 2YT5A 2YU4A 1MM3A 2KGGA 2E6RA 3ZPVE 2Y1MA 2LQ6A 4YBTA 5G04B 1HYIA 5H9MA 2DX8A 2YURA 4GNEA 2EGPA 2H0DB 3GL6A 4QF2A 5D1KB 1WFKA 1IYMA 3O7AA 3KQIA 3V43A 1WILA 5LKTA 2KWOA 5B79A 3N9MA 2JMJA 2YYRA 2CSZA 2RI7A 2YUCA 2YW8A 2YSJA 4F52B 5LKUA 5B76A 5B78A 4S3OB 3PHDA 3RTRB 2QJ0A 4LK9A 4AYCB 1WEEA 4ZUXU 5KH3A 1WEOA 4L58A 4PPEA 2F42A 3N9LA 2K17A 5AITA 2Y43A 1XWHA 3SHBA 4WZ3B 5KH9A 3O34A 1X4JA 4X3GA 5H1UA 4PTBA 2KREA 4XI1A 3KV5A 5DKAA 1V87A 1WESA 4I7BA 1WEMA 2L5UA 2YSMA 4YATA 3M99A 5B77A 5TDRA 2G6QA 2KWJA 1WEQA 2VJEA 3M63A 2RSDA 3I2DA 3LQHA 2CKLB 2M85A 3L1XA 2LXHC 3ZYQA 5B75A 1LDKC 4A0CD 5J3XA 2IDAA 1MM2A 1Z2QA 4FIPA 5DINA 1BORA 3M62A 1LDJB 4O64A 2CSYA 3DPLR 4AP4A 3IHPA 2HYED 2ECJA 2KU3A 1F62A 2G43A 2MNZA 1JM7B 4P5OB 2YHNA 1WGMA 1Z60A 4LLBA 4ZQLA 4ZDTA 5G05B 2MNYA 4I7CA 2HDPA 3U5OA 2LDRA 5FB0A 2KWNA 2NAAA 2C2LA 2EODA 5FB1A 1FBVA 5LKZA 2LN0A 2LXPC 2L0BA 5D1LB 2QIZA 4B86C 4FK5A 3EB6A 4WZ2A 1WEPA 4A4CA 1WE9A 2VJFB 3PURA 2K1JA 2KFTA 2MA5A 4GNFA 5B8DA 1FP0A 3ZVYA 4IC3A 2EA6A 2KE1A 4AVXA 4V3KC 4TKPB 1VYXA 2H0DA
chains in the Genus database with same CATH superfamily
2BAYA 3T6RA 4Z0OA 2KKXA 2PNXA 1VFYA 4Q6FA 4YABA 3N9QA 2MIQA 3MHSA 1X4IA 3DQVR 3ZVZB 2MUMA 2VPGA 4GB0A 5C13A 3GV4A 3MHHA 1MBMA 5LKXA 4NN2A 3RPGB 5TABA 4LADB 2G45A 4C9ZA 2E6SA 2M1RA 2EGMA 3ZTGA 4AYCA 5AIUA 3SUBA 5EYAF 2C2VS 2LGVA 1Z6UA 3MDBC 2MA6A 4MVTA 4S3OC 2MD7B 5G0FA 2FFWA 4I7DA 5C11A 2YQLA 3HCUA 2P57A 4CCGX 5TDWA 3LQIA 1T1HA 2XOYA 4N3WA 3KV6A 4MSXA 4R2YA 3O70A 2CONA 2DJAA 3O37A 3E2DA 5SVXA 4YBSA 2XEUA 2KYUA 2LGKA 2CKLA 2YHOA 5TBNA 2K4DA 2JRJA 2ECWA 1HYJA 2YREA 3ZPV1 4A49A 3O47A 1WENA 4UP5A 5D1MB 2KR4A 4B7YC 2Y1NA 2D8SA 5LCWB 3HTKC 4FJCA 2VP7A 3SOUA 2VPBA 4V3LC 4BBQA 1JM7A 4F1PA 3U5PA 4R7EA 4YADA 2LGGA 2CRRA 2MT5A 2I50A 4Z0RA 3PLWA 2FUIA 2ECGA 4UI9B 3U5NA 4IC2A 3FM8C 2OXQC 3ZNIA 4AUQB 2MKEA 3FAOA 2L80A 2FD4A 4FO9A 4A4BA 4CA1A 2ECTA 3SOWA 4YC9A 3PUQA 2JMDA 2LGLA 2VJFA 1ZBDB 2FSAA 3M7KA 2KIZA 2VPDA 3U5MA 1RMDA 3KNVA 4UP0A 5TRBA 3O35A 5K3QA 1CHCA 4QF3A 3JUEA 2XB1A 4GNGA 2K16A 2XOZA 3FL2A 2LRIC 3L1ZB 2L75A 2YQMA 4LJNA 5KH7A 4R8PK 2ECIA 1WEUA 2LV9A 2ECNA 1VD4A 2VNFA 2DSMA 1WEWA 4WA6A 3T9KA 1X4UA 4BHWA 1K2FA 3C5KA 2XP0A 3ASLA 5FERA 2VJEB 2PUYA 5JG6A 2YVRA 1E4UA 5H1TA 3QZVA 5H1VA 1G25A 2CT2A 2JMIA 4YAXA 2ZETC 2VPEA 5I3LA 1JOCA 3LQJA 3Q1DA 4GNDA 3O36A 3N9OA 2EXUA 2L43A 1U6GB 2F6NA 1WEVA 4L7XA 3C6WA 2JUNA 3N9NA 2FUUA 3N9PA 3RPGC 1N87A 3SOXA 2KGIA 1WIMA 5FEYA 2F6JA 2QICA 2ECVA 4LKAA 2M6MA 2KWKA 3FANA 2D8UA 4N4FA 4W4UA 4YBMA 3VK6A 3LJUX 2UZGA 3O33A 3T7LA 2MD8C 2M3HA 3NG2A 5SVIB 3LRQA 3HCTA 3FEHA 3FJUB 2AN6A 4WZ0A 3DWDA 3L11A 3LDYA 3HCSA 3EB5A 1DVPA 2YT5A 2YU4A 1MM3A 2KGGA 2E6RA 3ZPVE 2Y1MA 2LQ6A 4YBTA 5G04B 1HYIA 5H9MA 2DX8A 2YURA 4GNEA 2EGPA 2H0DB 3GL6A 4QF2A 5D1KB 1WFKA 4OGCA 1IYMA 3O7AA 3KQIA 3V43A 1WILA 5SVYA 5LKTA 2KWOA 5B79A 3N9MA 2JMJA 4QQ4A 2YYRA 2CSZA 2RI7A 2YUCA 2YW8A 2LAUA 2YSJA 4F52B 5LKUA 2KKYA 5B76A 2CSVA 4S3OB 3PHDA 5B78A 3RTRB 2QJ0A 4LK9A 4AYCB 1WEEA 4ZUXU 5KH3A 1WEOA 4L58A 3LVQE 4PPEA 2F42A 3N9LA 2K17A 5AITA 2Y43A 1XWHA 3SHBA 4WZ3B 5KH9A 4H9DA 3O34A 1X4JA 4X3GA 5H1UA 4PTBA 2KREA 4XI1A 3KV5A 5DKAA 1V87A 1WESA 4I7BA 1WEMA 2L5UA 2YSMA 4YATA 3M99A 5B77A 2M13A 2IQJA 5TDRA 3KDEC 2G6QA 2KWJA 1DCQA 1WEQA 2VJEA 3M63A 4OGEA 2RSDA 3I2DA 3LQHA 2CKLB 2M85A 3L1XA 2LXHC 3ZYQA 3H7HA 2XOCA 5B75A 1LDKC 4A0CD 5J3XA 2IDAA 1MM2A 1Z2QA 4FIPA 4O62A 2RR4A 1BORA 5DINA 2OWAA 3M62A 1LDJB 4O64A 2CSYA 2E61A 3DPLR 4AP4A 3IHPA 2HYED 2ECJA 2KU3A 1F62A 2G43A 2MNZA 1JM7B 4P5OB 2YHNA 1WGMA 1Z60A 4LLBA 4ZQLA 4ZDTA 5G05B 2MNYA 2CRWA 4I7CA 2HDPA 3U5OA 2LDRA 5FB0A 2KWNA 2NAAA 2C2LA 2EODA 5FB1A 1FBVA 5LKZA 2B0OE 2JM3A 2LN0A 2LXPC 2L0BA 3DDTA 5SVIA 5D1LB 2QIZA 4B86C 3LVRE 4FK5A 3EB6A 4WZ2A 1WEPA 4A4CA 1WE9A 2VJFB 3PURA 2K1JA 2KFTA 2MA5A 4GNFA 5B8DA 2L7PA 1FP0A 3ZVYA 4IC3A 2EA6A 2KE1A 4AVXA 4V3KC 4TKPB 1VYXA 2H0DA
chains in the Genus database with same CATH topology
2BAYA 3T6RA 2PNXA 1VFYA 4Q6FA 4YABA 3N9QA 2MIQA 3MHSA 1X4IA 3DQVR 3ZVZB 2MUMA 2VPGA 4GB0A 5C13A 3GV4A 3MHHA 5LKXA 4NN2A 3RPGB 5TABA 4LADB 2G45A 4C9ZA 2E6SA 2M1RA 3ZTGA 4AYCA 5AIUA 5EYAF 2C2VS 2LGVA 1Z6UA 2MA6A 4MVTA 4S3OC 2MD7B 5G0FA 4I7DA 5C11A 2YQLA 3HCUA 4CCGX 5TDWA 3LQIA 1T1HA 4N3WA 3KV6A 4MSXA 4R2YA 3O70A 3O37A 4YBSA 2XEUA 2KYUA 2LGKA 2CKLA 2YHOA 5TBNA 2K4DA 2JRJA 2ECWA 1HYJA 2YREA 3ZPV1 4A49A 1WENA 4UP5A 5D1MB 2KR4A 4B7YC 2Y1NA 2D8SA 5LCWB 3HTKC 4FJCA 2VP7A 3SOUA 2VPBA 4V3LC 4BBQA 1JM7A 3U5PA 4R7EA 4YADA 2LGGA 2MT5A 2I50A 2FUIA 2ECGA 4UI9B 3U5NA 4IC2A 2OXQC 3ZNIA 4AUQB 2L80A 4FO9A 4A4BA 4CA1A 2ECTA 3SOWA 4YC9A 3PUQA 2JMDA 2LGLA 2VJFA 1ZBDB 2FSAA 2KIZA 2VPDA 3U5MA 1RMDA 3KNVA 4UP0A 5TRBA 3O35A 1CHCA 4QF3A 2XB1A 4GNGA 2K16A 3FL2A 2LRIC 3L1ZB 2L75A 2YQMA 4LJNA 5KH7A 4R8PK 2ECIA 1WEUA 2LV9A 2ECNA 1VD4A 2VNFA 1WEWA 4WA6A 1X4UA 4BHWA 1K2FA 3C5KA 3ASLA 5FERA 2VJEB 2PUYA 5JG6A 1E4UA 5H1TA 3QZVA 5H1VA 1G25A 2CT2A 2JMIA 4YAXA 2ZETC 2VPEA 5I3LA 1JOCA 3LQJA 4GNDA 3O36A 3N9OA 2L43A 1U6GB 2F6NA 1WEVA 4L7XA 3C6WA 3N9NA 3N9PA 2FUUA 3RPGC 1N87A 3SOXA 2KGIA 1WIMA 5FEYA 2F6JA 2QICA 2ECVA 4LKAA 2M6MA 2KWKA 4N4FA 4W4UA 4YBMA 3VK6A 2UZGA 3O33A 3T7LA 2MD8C 2M3HA 3NG2A 3LRQA 3HCTA 2AN6A 4WZ0A 3L11A 3HCSA 3EB5A 1DVPA 2YT5A 2YU4A 1MM3A 2KGGA 2E6RA 3ZPVE 2Y1MA 2LQ6A 4YBTA 5G04B 1HYIA 5H9MA 2DX8A 2YURA 4GNEA 2EGPA 2H0DB 3GL6A 4QF2A 5D1KB 1WFKA 1IYMA 3O7AA 3KQIA 3V43A 1WILA 5LKTA 2KWOA 5B79A 3N9MA 2JMJA 2YYRA 2CSZA 2RI7A 2YUCA 2YW8A 2YSJA 4F52B 5LKUA 5B76A 5B78A 4S3OB 3PHDA 3RTRB 2QJ0A 4LK9A 4AYCB 1WEEA 4ZUXU 5KH3A 1WEOA 4L58A 4PPEA 2F42A 3N9LA 2K17A 5AITA 2Y43A 1XWHA 3SHBA 4WZ3B 5KH9A 3O34A 1X4JA 4X3GA 5H1UA 4PTBA 2KREA 4XI1A 3KV5A 5DKAA 1V87A 1WESA 4I7BA 1WEMA 2L5UA 2YSMA 4YATA 3M99A 5B77A 5TDRA 2G6QA 2KWJA 1WEQA 2VJEA 3M63A 2RSDA 3I2DA 3LQHA 2CKLB 2M85A 3L1XA 2LXHC 3ZYQA 5B75A 1LDKC 4A0CD 5J3XA 2IDAA 1MM2A 1Z2QA 4FIPA 5DINA 1BORA 3M62A 1LDJB 4O64A 2CSYA 3DPLR 4AP4A 3IHPA 2HYED 2ECJA 2KU3A 1F62A 2G43A 2MNZA 1JM7B 4P5OB 2YHNA 1WGMA 1Z60A 4LLBA 4ZQLA 4ZDTA 5G05B 2MNYA 4I7CA 2HDPA 3U5OA 2LDRA 5FB0A 2KWNA 2NAAA 2C2LA 2EODA 5FB1A 1FBVA 5LKZA 2LN0A 2LXPC 2L0BA 5D1LB 2QIZA 4B86C 4FK5A 3EB6A 4WZ2A 1WEPA 4A4CA 1WE9A 2VJFB 3PURA 2K1JA 2KFTA 2MA5A 4GNFA 5B8DA 1FP0A 3ZVYA 4IC3A 2EA6A 2KE1A 4AVXA 4V3KC 4TKPB 1VYXA 2H0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAY A;  3T6R A;  2PNX A;  1VFY A;  4Q6F A;  4YAB A;  3N9Q A;  2MIQ A;  3MHS A;  1X4I A;  3DQV R;  3ZVZ B;  2MUM A;  2VPG A;  4GB0 A;  5C13 A;  3GV4 A;  3MHH A;  5LKX A;  4NN2 A;  3RPG B;  5TAB A;  4LAD B;  2G45 A;  4C9Z A;  2E6S A;  2M1R A;  3ZTG A;  4AYC A;  5AIU A;  5EYA F;  2C2V S;  2LGV A;  1Z6U A;  2MA6 A;  4MVT A;  4S3O C;  2MD7 B;  5G0F A;  4I7D A;  5C11 A;  2YQL A;  3HCU A;  4CCG X;  5TDW A;  3LQI A;  1T1H A;  4N3W A;  3KV6 A;  4MSX A;  4R2Y A;  3O70 A;  3O37 A;  4YBS A;  2XEU A;  2KYU A;  2LGK A;  2CKL A;  2YHO A;  5TBN A;  2K4D A;  2JRJ A;  2ECW A;  1HYJ A;  2YRE A;  3ZPV 1;  4A49 A;  1WEN A;  4UP5 A;  5D1M B;  2KR4 A;  4B7Y C;  2Y1N A;  2D8S A;  5LCW B;  3HTK C;  4FJC A;  2VP7 A;  3SOU A;  2VPB A;  4V3L C;  4BBQ A;  1JM7 A;  3U5P A;  4R7E A;  4YAD A;  2LGG A;  2MT5 A;  2I50 A;  2FUI A;  2ECG A;  4UI9 B;  3U5N A;  4IC2 A;  2OXQ C;  3ZNI A;  4AUQ B;  2L80 A;  4FO9 A;  4A4B A;  4CA1 A;  2ECT A;  3SOW A;  4YC9 A;  3PUQ A;  2JMD A;  2LGL A;  2VJF A;  1ZBD B;  2FSA A;  2KIZ A;  2VPD A;  3U5M A;  1RMD A;  3KNV A;  4UP0 A;  5TRB A;  3O35 A;  1CHC A;  4QF3 A;  2XB1 A;  4GNG A;  2K16 A;  3FL2 A;  2LRI C;  3L1Z B;  2L75 A;  2YQM A;  4LJN A;  5KH7 A;  4R8P K;  2ECI A;  1WEU A;  2LV9 A;  2ECN A;  1VD4 A;  2VNF A;  1WEW A;  4WA6 A;  1X4U A;  4BHW A;  1K2F A;  3C5K A;  3ASL A;  5FER A;  2VJE B;  2PUY A;  5JG6 A;  1E4U A;  5H1T A;  3QZV A;  5H1V A;  1G25 A;  2CT2 A;  2JMI A;  4YAX A;  2ZET C;  2VPE A;  5I3L A;  1JOC A;  3LQJ A;  4GND A;  3O36 A;  3N9O A;  2L43 A;  1U6G B;  2F6N A;  1WEV A;  4L7X A;  3C6W A;  3N9N A;  3N9P A;  2FUU A;  3RPG C;  1N87 A;  3SOX A;  2KGI A;  1WIM A;  5FEY A;  2F6J A;  2QIC A;  2ECV A;  4LKA A;  2M6M A;  2KWK A;  4N4F A;  4W4U A;  4YBM A;  3VK6 A;  2UZG A;  3O33 A;  3T7L A;  2MD8 C;  2M3H A;  3NG2 A;  3LRQ A;  3HCT A;  2AN6 A;  4WZ0 A;  3L11 A;  3HCS A;  3EB5 A;  1DVP A;  2YT5 A;  2YU4 A;  1MM3 A;  2KGG A;  2E6R A;  3ZPV E;  2Y1M A;  2LQ6 A;  4YBT A;  5G04 B;  1HYI A;  5H9M A;  2DX8 A;  2YUR A;  4GNE A;  2EGP A;  2H0D B;  3GL6 A;  4QF2 A;  5D1K B;  1WFK A;  1IYM A;  3O7A A;  3KQI A;  3V43 A;  1WIL A;  5LKT A;  2KWO A;  5B79 A;  3N9M A;  2JMJ A;  2YYR A;  2CSZ A;  2RI7 A;  2YUC A;  2YW8 A;  2YSJ A;  4F52 B;  5LKU A;  5B76 A;  5B78 A;  4S3O B;  3PHD A;  3RTR B;  2QJ0 A;  4LK9 A;  4AYC B;  1WEE A;  4ZUX U;  5KH3 A;  1WEO A;  4L58 A;  4PPE A;  2F42 A;  3N9L A;  2K17 A;  5AIT A;  2Y43 A;  1XWH A;  3SHB A;  4WZ3 B;  5KH9 A;  3O34 A;  1X4J A;  4X3G A;  5H1U A;  4PTB A;  2KRE A;  4XI1 A;  3KV5 A;  5DKA A;  1V87 A;  1WES A;  4I7B A;  1WEM A;  2L5U A;  2YSM A;  4YAT A;  3M99 A;  5B77 A;  5TDR A;  2G6Q A;  2KWJ A;  1WEQ A;  2VJE A;  3M63 A;  2RSD A;  3I2D A;  3LQH A;  2CKL B;  2M85 A;  3L1X A;  2LXH C;  3ZYQ A;  5B75 A;  1LDK C;  4A0C D;  5J3X A;  2IDA A;  1MM2 A;  1Z2Q A;  4FIP A;  5DIN A;  1BOR A;  3M62 A;  1LDJ B;  4O64 A;  2CSY A;  3DPL R;  4AP4 A;  3IHP A;  2HYE D;  2ECJ A;  2KU3 A;  1F62 A;  2G43 A;  2MNZ A;  1JM7 B;  4P5O B;  2YHN A;  1WGM A;  1Z60 A;  4LLB A;  4ZQL A;  4ZDT A;  5G05 B;  2MNY A;  4I7C A;  2HDP A;  3U5O A;  2LDR A;  5FB0 A;  2KWN A;  2NAA A;  2C2L A;  2EOD A;  5FB1 A;  1FBV A;  5LKZ A;  2LN0 A;  2LXP C;  2L0B A;  5D1L B;  2QIZ A;  4B86 C;  4FK5 A;  3EB6 A;  4WZ2 A;  1WEP A;  4A4C A;  1WE9 A;  2VJF B;  3PUR A;  2K1J A;  2KFT A;  2MA5 A;  4GNF A;  5B8D A;  1FP0 A;  3ZVY A;  4IC3 A;  2EA6 A;  2KE1 A;  4AVX A;  4V3K C;  4TKP B;  1VYX A;  2H0D A; 
#chains in the Genus database with same CATH topology
 2BAY A;  3T6R A;  4Z0O A;  2KKX A;  2PNX A;  1VFY A;  4Q6F A;  4YAB A;  3N9Q A;  2MIQ A;  3MHS A;  1X4I A;  3DQV R;  3ZVZ B;  2MUM A;  2VPG A;  4GB0 A;  5C13 A;  3GV4 A;  3MHH A;  1MBM A;  5LKX A;  4NN2 A;  3RPG B;  5TAB A;  4LAD B;  2G45 A;  4C9Z A;  2E6S A;  2M1R A;  2EGM A;  3ZTG A;  4AYC A;  5AIU A;  3SUB A;  5EYA F;  2C2V S;  2LGV A;  1Z6U A;  3MDB C;  2MA6 A;  4MVT A;  4S3O C;  2MD7 B;  5G0F A;  2FFW A;  4I7D A;  5C11 A;  2YQL A;  3HCU A;  2P57 A;  4CCG X;  5TDW A;  3LQI A;  1T1H A;  2XOY A;  4N3W A;  3KV6 A;  4MSX A;  4R2Y A;  3O70 A;  2CON A;  2DJA A;  3O37 A;  3E2D A;  5SVX A;  4YBS A;  2XEU A;  2KYU A;  2LGK A;  2CKL A;  2YHO A;  5TBN A;  2K4D A;  2JRJ A;  2ECW A;  1HYJ A;  2YRE A;  3ZPV 1;  4A49 A;  3O47 A;  1WEN A;  4UP5 A;  5D1M B;  2KR4 A;  4B7Y C;  2Y1N A;  2D8S A;  5LCW B;  3HTK C;  4FJC A;  2VP7 A;  3SOU A;  2VPB A;  4V3L C;  4BBQ A;  1JM7 A;  4F1P A;  3U5P A;  4R7E A;  4YAD A;  2LGG A;  2CRR A;  2MT5 A;  2I50 A;  4Z0R A;  3PLW A;  2FUI A;  2ECG A;  4UI9 B;  3U5N A;  4IC2 A;  3FM8 C;  2OXQ C;  3ZNI A;  4AUQ B;  2MKE A;  3FAO A;  2L80 A;  2FD4 A;  4FO9 A;  4A4B A;  4CA1 A;  2ECT A;  3SOW A;  4YC9 A;  3PUQ A;  2JMD A;  2LGL A;  2VJF A;  1ZBD B;  2FSA A;  3M7K A;  2KIZ A;  2VPD A;  3U5M A;  1RMD A;  3KNV A;  4UP0 A;  5TRB A;  3O35 A;  5K3Q A;  1CHC A;  4QF3 A;  3JUE A;  2XB1 A;  4GNG A;  2K16 A;  2XOZ A;  3FL2 A;  2LRI C;  3L1Z B;  2L75 A;  2YQM A;  4LJN A;  5KH7 A;  4R8P K;  2ECI A;  1WEU A;  2LV9 A;  2ECN A;  1VD4 A;  2VNF A;  2DSM A;  1WEW A;  4WA6 A;  3T9K A;  1X4U A;  4BHW A;  1K2F A;  3C5K A;  2XP0 A;  3ASL A;  5FER A;  2VJE B;  2PUY A;  5JG6 A;  2YVR A;  1E4U A;  5H1T A;  3QZV A;  5H1V A;  1G25 A;  2CT2 A;  2JMI A;  4YAX A;  2ZET C;  2VPE A;  5I3L A;  1JOC A;  3LQJ A;  3Q1D A;  4GND A;  3O36 A;  3N9O A;  2EXU A;  2L43 A;  1U6G B;  2F6N A;  1WEV A;  4L7X A;  3C6W A;  2JUN A;  3N9N A;  2FUU A;  3N9P A;  3RPG C;  1N87 A;  3SOX A;  2KGI A;  1WIM A;  5FEY A;  2F6J A;  2QIC A;  2ECV A;  4LKA A;  2M6M A;  2KWK A;  3FAN A;  2D8U A;  4N4F A;  4W4U A;  4YBM A;  3VK6 A;  3LJU X;  2UZG A;  3O33 A;  3T7L A;  2MD8 C;  2M3H A;  3NG2 A;  5SVI B;  3LRQ A;  3HCT A;  3FEH A;  3FJU B;  2AN6 A;  4WZ0 A;  3DWD A;  3L11 A;  3LDY A;  3HCS A;  3EB5 A;  1DVP A;  2YT5 A;  2YU4 A;  1MM3 A;  2KGG A;  2E6R A;  3ZPV E;  2Y1M A;  2LQ6 A;  4YBT A;  5G04 B;  1HYI A;  5H9M A;  2DX8 A;  2YUR A;  4GNE A;  2EGP A;  2H0D B;  3GL6 A;  4QF2 A;  5D1K B;  1WFK A;  4OGC A;  1IYM A;  3O7A A;  3KQI A;  3V43 A;  1WIL A;  5SVY A;  5LKT A;  2KWO A;  5B79 A;  3N9M A;  2JMJ A;  4QQ4 A;  2YYR A;  2CSZ A;  2RI7 A;  2YUC A;  2YW8 A;  2LAU A;  2YSJ A;  4F52 B;  5LKU A;  2KKY A;  5B76 A;  2CSV A;  4S3O B;  3PHD A;  5B78 A;  3RTR B;  2QJ0 A;  4LK9 A;  4AYC B;  1WEE A;  4ZUX U;  5KH3 A;  1WEO A;  4L58 A;  3LVQ E;  4PPE A;  2F42 A;  3N9L A;  2K17 A;  5AIT A;  2Y43 A;  1XWH A;  3SHB A;  4WZ3 B;  5KH9 A;  4H9D A;  3O34 A;  1X4J A;  4X3G A;  5H1U A;  4PTB A;  2KRE A;  4XI1 A;  3KV5 A;  5DKA A;  1V87 A;  1WES A;  4I7B A;  1WEM A;  2L5U A;  2YSM A;  4YAT A;  3M99 A;  5B77 A;  2M13 A;  2IQJ A;  5TDR A;  3KDE C;  2G6Q A;  2KWJ A;  1DCQ A;  1WEQ A;  2VJE A;  3M63 A;  4OGE A;  2RSD A;  3I2D A;  3LQH A;  2CKL B;  2M85 A;  3L1X A;  2LXH C;  3ZYQ A;  3H7H A;  2XOC A;  5B75 A;  1LDK C;  4A0C D;  5J3X A;  2IDA A;  1MM2 A;  1Z2Q A;  4FIP A;  4O62 A;  2RR4 A;  1BOR A;  5DIN A;  2OWA A;  3M62 A;  1LDJ B;  4O64 A;  2CSY A;  2E61 A;  3DPL R;  4AP4 A;  3IHP A;  2HYE D;  2ECJ A;  2KU3 A;  1F62 A;  2G43 A;  2MNZ A;  1JM7 B;  4P5O B;  2YHN A;  1WGM A;  1Z60 A;  4LLB A;  4ZQL A;  4ZDT A;  5G05 B;  2MNY A;  2CRW A;  4I7C A;  2HDP A;  3U5O A;  2LDR A;  5FB0 A;  2KWN A;  2NAA A;  2C2L A;  2EOD A;  5FB1 A;  1FBV A;  5LKZ A;  2B0O E;  2JM3 A;  2LN0 A;  2LXP C;  2L0B A;  3DDT A;  5SVI A;  5D1L B;  2QIZ A;  4B86 C;  3LVR E;  4FK5 A;  3EB6 A;  4WZ2 A;  1WEP A;  4A4C A;  1WE9 A;  2VJF B;  3PUR A;  2K1J A;  2KFT A;  2MA5 A;  4GNF A;  5B8D A;  2L7P A;  1FP0 A;  3ZVY A;  4IC3 A;  2EA6 A;  2KE1 A;  4AVX A;  4V3K C;  4TKP B;  1VYX A;  2H0D A; 
#chains in the Genus database with same CATH homology
 2BAY A;  3T6R A;  2PNX A;  1VFY A;  4Q6F A;  4YAB A;  3N9Q A;  2MIQ A;  3MHS A;  1X4I A;  3DQV R;  3ZVZ B;  2MUM A;  2VPG A;  4GB0 A;  5C13 A;  3GV4 A;  3MHH A;  5LKX A;  4NN2 A;  3RPG B;  5TAB A;  4LAD B;  2G45 A;  4C9Z A;  2E6S A;  2M1R A;  3ZTG A;  4AYC A;  5AIU A;  5EYA F;  2C2V S;  2LGV A;  1Z6U A;  2MA6 A;  4MVT A;  4S3O C;  2MD7 B;  5G0F A;  4I7D A;  5C11 A;  2YQL A;  3HCU A;  4CCG X;  5TDW A;  3LQI A;  1T1H A;  4N3W A;  3KV6 A;  4MSX A;  4R2Y A;  3O70 A;  3O37 A;  4YBS A;  2XEU A;  2KYU A;  2LGK A;  2CKL A;  2YHO A;  5TBN A;  2K4D A;  2JRJ A;  2ECW A;  1HYJ A;  2YRE A;  3ZPV 1;  4A49 A;  1WEN A;  4UP5 A;  5D1M B;  2KR4 A;  4B7Y C;  2Y1N A;  2D8S A;  5LCW B;  3HTK C;  4FJC A;  2VP7 A;  3SOU A;  2VPB A;  4V3L C;  4BBQ A;  1JM7 A;  3U5P A;  4R7E A;  4YAD A;  2LGG A;  2MT5 A;  2I50 A;  2FUI A;  2ECG A;  4UI9 B;  3U5N A;  4IC2 A;  2OXQ C;  3ZNI A;  4AUQ B;  2L80 A;  4FO9 A;  4A4B A;  4CA1 A;  2ECT A;  3SOW A;  4YC9 A;  3PUQ A;  2JMD A;  2LGL A;  2VJF A;  1ZBD B;  2FSA A;  2KIZ A;  2VPD A;  3U5M A;  1RMD A;  3KNV A;  4UP0 A;  5TRB A;  3O35 A;  1CHC A;  4QF3 A;  2XB1 A;  4GNG A;  2K16 A;  3FL2 A;  2LRI C;  3L1Z B;  2L75 A;  2YQM A;  4LJN A;  5KH7 A;  4R8P K;  2ECI A;  1WEU A;  2LV9 A;  2ECN A;  1VD4 A;  2VNF A;  1WEW A;  4WA6 A;  1X4U A;  4BHW A;  1K2F A;  3C5K A;  3ASL A;  5FER A;  2VJE B;  2PUY A;  5JG6 A;  1E4U A;  5H1T A;  3QZV A;  5H1V A;  1G25 A;  2CT2 A;  2JMI A;  4YAX A;  2ZET C;  2VPE A;  5I3L A;  1JOC A;  3LQJ A;  4GND A;  3O36 A;  3N9O A;  2L43 A;  1U6G B;  2F6N A;  1WEV A;  4L7X A;  3C6W A;  3N9N A;  3N9P A;  2FUU A;  3RPG C;  1N87 A;  3SOX A;  2KGI A;  1WIM A;  5FEY A;  2F6J A;  2QIC A;  2ECV A;  4LKA A;  2M6M A;  2KWK A;  4N4F A;  4W4U A;  4YBM A;  3VK6 A;  2UZG A;  3O33 A;  3T7L A;  2MD8 C;  2M3H A;  3NG2 A;  3LRQ A;  3HCT A;  2AN6 A;  4WZ0 A;  3L11 A;  3HCS A;  3EB5 A;  1DVP A;  2YT5 A;  2YU4 A;  1MM3 A;  2KGG A;  2E6R A;  3ZPV E;  2Y1M A;  2LQ6 A;  4YBT A;  5G04 B;  1HYI A;  5H9M A;  2DX8 A;  2YUR A;  4GNE A;  2EGP A;  2H0D B;  3GL6 A;  4QF2 A;  5D1K B;  1WFK A;  1IYM A;  3O7A A;  3KQI A;  3V43 A;  1WIL A;  5LKT A;  2KWO A;  5B79 A;  3N9M A;  2JMJ A;  2YYR A;  2CSZ A;  2RI7 A;  2YUC A;  2YW8 A;  2YSJ A;  4F52 B;  5LKU A;  5B76 A;  5B78 A;  4S3O B;  3PHD A;  3RTR B;  2QJ0 A;  4LK9 A;  4AYC B;  1WEE A;  4ZUX U;  5KH3 A;  1WEO A;  4L58 A;  4PPE A;  2F42 A;  3N9L A;  2K17 A;  5AIT A;  2Y43 A;  1XWH A;  3SHB A;  4WZ3 B;  5KH9 A;  3O34 A;  1X4J A;  4X3G A;  5H1U A;  4PTB A;  2KRE A;  4XI1 A;  3KV5 A;  5DKA A;  1V87 A;  1WES A;  4I7B A;  1WEM A;  2L5U A;  2YSM A;  4YAT A;  3M99 A;  5B77 A;  5TDR A;  2G6Q A;  2KWJ A;  1WEQ A;  2VJE A;  3M63 A;  2RSD A;  3I2D A;  3LQH A;  2CKL B;  2M85 A;  3L1X A;  2LXH C;  3ZYQ A;  5B75 A;  1LDK C;  4A0C D;  5J3X A;  2IDA A;  1MM2 A;  1Z2Q A;  4FIP A;  5DIN A;  1BOR A;  3M62 A;  1LDJ B;  4O64 A;  2CSY A;  3DPL R;  4AP4 A;  3IHP A;  2HYE D;  2ECJ A;  2KU3 A;  1F62 A;  2G43 A;  2MNZ A;  1JM7 B;  4P5O B;  2YHN A;  1WGM A;  1Z60 A;  4LLB A;  4ZQL A;  4ZDT A;  5G05 B;  2MNY A;  4I7C A;  2HDP A;  3U5O A;  2LDR A;  5FB0 A;  2KWN A;  2NAA A;  2C2L A;  2EOD A;  5FB1 A;  1FBV A;  5LKZ A;  2LN0 A;  2LXP C;  2L0B A;  5D1L B;  2QIZ A;  4B86 C;  4FK5 A;  3EB6 A;  4WZ2 A;  1WEP A;  4A4C A;  1WE9 A;  2VJF B;  3PUR A;  2K1J A;  2KFT A;  2MA5 A;  4GNF A;  5B8D A;  1FP0 A;  3ZVY A;  4IC3 A;  2EA6 A;  2KE1 A;  4AVX A;  4V3K C;  4TKP B;  1VYX A;  2H0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...