5LCWB

Cryo-em structure of the anaphase-promoting complex/cyclosome, in complex with the mitotic checkpoint complex (apc/c-mcc) at 4.2 angstrom resolution
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
79
Chain Sequence
MKVKIKCWNGVATWLWVCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of APC/C regulation by the spindle assembly checkpoint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Anaphase-promoting complex subunit 1
total genus 7
structure length 79
sequence length 84
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5lcwB00
3O34A 2MT5A 2YYRA 2JMIA 4LKAA 3QZVA 2E6RA 4YBSA 2KU3A 2YQMA 3ZVYA 2ZETC 2KWOA 2MNYA 4B7YC 1Z2QA 2QICA 2AN6A 2Y1MA 4ZQLA 3U5PA 2LXHC 1WEPA 2VPEA 3SOWA 2YT5A 5KH7A 3ZPVE 2L75A 2KFTA 2MD7B 4A4BA 2ECTA 4FO9A 2K4DA 2G45A 1WEWA 4R2YA 4O64A 1WEOA 2G6QA 3FL2A 5TABA 5H1VA 5AITA 2MIQA 5TRBA 4GNGA 5B77A 1MM2A 5DINA 3N9LA 3LRQA 3SOUA 2VNFA 3DPLR 2G43A 1LDKC 3MHHA 5B75A 2F6JA 2RI7A 4WA6A 2Y43A 4LADB 5J3XA 1MM3A 1WEVA 4IC3A 5LCWB 3L11A 4F52B 4TKPB 3RTRB 3N9QA 1IYMA 1G25A 4B86C 2CT2A 2DX8A 2KWNA 3LQIA 4BBQA 2JMDA 1Z6UA 4A49A 4I7BA 2YQLA 4YATA 2VJEA 2LRIC 2VPBA 5KH9A 4ZDTA 2CSYA 2L80A 2H0DA 2YHNA 1XWHA 2C2LA 5TDWA 4AP4A 3I2DA 2ECNA 2XB1A 1WEEA 4PPEA 2UZGA 5C11A 2VJFB 4FK5A 2EGPA 4QF3A 2YUCA 3VK6A 4W4UA 2M3HA 2VJEB 2VP7A 4GNEA 1F62A 3RPGC 3ZTGA 2Y1NA 2D8SA 3EB6A 4MVTA 1WEUA 4GB0A 3ZYQA 2FUIA 4S3OB 5B76A 1WFKA 2FUUA 2LGVA 4YC9A 1VD4A 4FJCA 3PUQA 2RSDA 4UI9B 1VFYA 3GL6A 5JG6A 4GNDA 1FP0A 1N87A 3C5KA 4AVXA 5LKTA 2K17A 2YU4A 3T7LA 1WIMA 2CSZA 4YADA 3HCSA 5G0FA 4GNFA 5AIUA 4NN2A 1X4IA 5H1UA 5B79A 4L58A 2M6MA 1BORA 4N3WA 1WEMA 3N9OA 4R7EA 4V3KC 2F42A 1WEQA 3O33A 4A4CA 1LDJB 4UP0A 4WZ3B 2KGIA 2VPGA 4N4FA 2KWKA 3O70A 2OXQC 2YHOA 2LQ6A 4CCGX 2QJ0A 2L43A 2I50A 4LLBA 1K2FA 5D1MB 2LGGA 2ECGA 2MD8C 3GV4A 2H0DB 3LQJA 3PURA 1HYIA 2C2VS 2ECJA 1WILA 5I3LA 3ZVZB 3O35A 3M62A 2YURA 4I7DA 1CHCA 2JMJA 5D1LB 1V87A 3NG2A 4YBMA 5B78A 4UP5A 1X4UA 2QIZA 5FEYA 1X4JA 2LN0A 2KREA 3U5OA 5LKXA 5TDRA 4P5OB 4PTBA 2KWJA 3L1XA 1DVPA 2BAYA 1E4UA 2KGGA 4FIPA 3N9NA 4QF2A 3M99A 4AYCA 2XEUA 3SHBA 3U5MA 4MSXA 5LKUA 3ASLA 2KIZA 1VYXA 1JM7A 2HYED 3O7AA 2EODA 4WZ2A 2LXPC 2MA5A 3RPGB 3T6RA 4AUQB 4L7XA 4R8PK 2IDAA 4V3LC 2LDRA 3MHSA 1WGMA 3SOXA 2YW8A 3KV6A 1WESA 2KR4A 5EYAF 3M63A 4LJNA 4A0CD 4C9ZA 5FERA 2MUMA 2LV9A 3U5NA 2NAAA 3KQIA 2KE1A 2ECWA 2LGLA 4YABA 3HCTA 2YSMA 2HDPA 2L5UA 2EA6A 3L1ZB 3HCUA 4S3OC 4ZUXU 4Q6FA 2MA6A 3PHDA 4WZ0A 2CKLA 1Z60A 3C6WA 5D1KB 5H9MA 2FSAA 2K16A 2F6NA 4YBTA 1WE9A 3ZPV1 2L0BA 5DKAA 5G04B 2PUYA 3EB5A 5TBNA 4LK9A 3KNVA 2ECVA 5LKZA 3KV5A 5FB0A 5B8DA 5H1TA 2VJFA 1U6GB 1WENA 3DQVR 3LQHA 2CKLB 2VPDA 3V43A 3ZNIA 4CA1A 2YREA 3HTKC 4AYCB 2MNZA 1T1HA 5KH3A 1ZBDB 4BHWA 1JOCA 5G05B 2K1JA 4X3GA 2M85A 3N9MA 1HYJA 1JM7B 2YSJA 5FB1A 2E6SA 4IC2A 4YAXA 2M1RA 4I7CA 5C13A 2PNXA 2JRJA 1RMDA 3IHPA 1FBVA 2ECIA 3O37A 3O36A 2KYUA 3N9PA 2LGKA 4XI1A
chains in the Genus database with same CATH superfamily
3O34A 3LJUX 2MT5A 2YYRA 3FEHA 2JMIA 4LKAA 3QZVA 2E6RA 4YBSA 2KKXA 2KU3A 2YQMA 3ZVYA 2ZETC 1DCQA 2KWOA 2MNYA 4B7YC 1Z2QA 2QICA 2AN6A 2Y1MA 4ZQLA 3U5PA 2LXHC 1WEPA 2VPEA 3PLWA 3SOWA 2YT5A 5KH7A 3ZPVE 4QQ4A 2L75A 2KFTA 2CRWA 2MD7B 4A4BA 2ECTA 4FO9A 2K4DA 2L7PA 2G45A 1WEWA 4R2YA 4O64A 1WEOA 2YVRA 2G6QA 3FL2A 5TABA 5H1VA 5AITA 2MIQA 3DDTA 5TRBA 4GNGA 5B77A 1MM2A 5DINA 3N9LA 3LRQA 3SOUA 2VNFA 3DPLR 2G43A 1LDKC 2XOZA 3MHHA 5B75A 2F6JA 2RI7A 4WA6A 2Y43A 2XOCA 4LADB 5J3XA 1MM3A 1WEVA 4IC3A 5LCWB 3L11A 4F52B 4TKPB 5SVIA 3RTRB 2MKEA 3N9QA 1IYMA 1G25A 4B86C 2CT2A 2DX8A 2KWNA 3LQIA 2CSVA 4BBQA 2JMDA 1Z6UA 4A49A 4I7BA 2YQLA 4YATA 2EXUA 2VJEA 3LDYA 2LRIC 2VPBA 5KH9A 4ZDTA 2CSYA 2L80A 2H0DA 3LVQE 2YHNA 1XWHA 5SVIB 3DWDA 2C2LA 5TDWA 2EGMA 5SVXA 4AP4A 3I2DA 2ECNA 2XB1A 1WEEA 4PPEA 2UZGA 5C11A 2VJFB 4FK5A 2EGPA 4QF3A 2YUCA 3VK6A 4W4UA 2M3HA 2VJEB 2VP7A 4O62A 4GNEA 1F62A 3RPGC 3ZTGA 2Y1NA 2D8SA 3EB6A 4MVTA 1WEUA 4GB0A 3ZYQA 2FUIA 4S3OB 5B76A 1WFKA 2RR4A 2FUUA 2LGVA 4YC9A 1VD4A 4FJCA 2CRRA 3PUQA 2RSDA 4UI9B 1VFYA 3GL6A 5JG6A 2B0OE 4GNDA 1FP0A 1N87A 3C5KA 4AVXA 5LKTA 2K17A 2YU4A 3T7LA 1WIMA 2CSZA 4YADA 3HCSA 5G0FA 4GNFA 5AIUA 4NN2A 3H7HA 3T9KA 4Z0OA 1X4IA 5H1UA 5B79A 4L58A 2M6MA 1BORA 4N3WA 1WEMA 3N9OA 4R7EA 4V3KC 2FFWA 2F42A 3O47A 1WEQA 3O33A 4A4CA 1LDJB 4UP0A 4WZ3B 2KGIA 2VPGA 4N4FA 2KWKA 2D8UA 3O70A 2OXQC 2YHOA 2LQ6A 4CCGX 2DJAA 2QJ0A 2L43A 2I50A 4LLBA 1K2FA 5D1MB 2LGGA 2ECGA 2MD8C 3GV4A 2H0DB 3LQJA 3PURA 1HYIA 2C2VS 2ECJA 1WILA 5I3LA 2M13A 3ZVZB 3O35A 3M62A 2XOYA 2YURA 4I7DA 1CHCA 2JMJA 5D1LB 4OGEA 1V87A 3NG2A 4YBMA 5B78A 4UP5A 1X4UA 5SVYA 2CONA 2QIZA 5FEYA 1X4JA 2LN0A 2KREA 3U5OA 4Z0RA 5LKXA 5TDRA 4P5OB 4PTBA 2KWJA 3L1XA 3FM8C 1DVPA 2BAYA 1E4UA 3JUEA 2KGGA 4FIPA 3N9NA 4QF2A 3M99A 4AYCA 2XEUA 3SHBA 3U5MA 4MSXA 3KDEC 5LKUA 3ASLA 2KIZA 1VYXA 3M7KA 1JM7A 2HYED 3O7AA 2EODA 4WZ2A 2LXPC 2MA5A 3RPGB 3T6RA 4AUQB 4L7XA 4R8PK 2IDAA 2P57A 4V3LC 2LDRA 3MHSA 2JM3A 2E61A 1WGMA 3SOXA 2YW8A 3KV6A 1WESA 2OWAA 2KR4A 5EYAF 2FD4A 1MBMA 3M63A 4LJNA 4A0CD 4C9ZA 5FERA 2MUMA 2LV9A 3U5NA 2NAAA 3KQIA 3FANA 4OGCA 2IQJA 2KE1A 2ECWA 2LGLA 4YABA 3SUBA 3HCTA 2YSMA 2HDPA 2L5UA 2EA6A 3L1ZB 3HCUA 4S3OC 4ZUXU 4Q6FA 3FAOA 2MA6A 3PHDA 4WZ0A 2LAUA 2CKLA 1Z60A 3C6WA 5D1KB 5H9MA 5K3QA 2FSAA 2K16A 2F6NA 3MDBC 1WE9A 4YBTA 3ZPV1 2L0BA 2KKYA 5DKAA 5G04B 2PUYA 2DSMA 3EB5A 5TBNA 4LK9A 3KNVA 2XP0A 2ECVA 5LKZA 3KV5A 5FB0A 5B8DA 5H1TA 4H9DA 2VJFA 1U6GB 3FJUB 1WENA 3DQVR 3LQHA 2CKLB 3E2DA 2VPDA 3V43A 3ZNIA 4CA1A 2YREA 3HTKC 4F1PA 4AYCB 2MNZA 1T1HA 5KH3A 1ZBDB 4BHWA 1JOCA 5G05B 2K1JA 4X3GA 2M85A 3N9MA 1HYJA 1JM7B 2YSJA 5FB1A 3LVRE 2E6SA 4IC2A 4YAXA 2M1RA 4I7CA 5C13A 2PNXA 2JRJA 1RMDA 3IHPA 1FBVA 2ECIA 3Q1DA 3O37A 2JUNA 3O36A 2KYUA 3N9PA 2LGKA 4XI1A
chains in the Genus database with same CATH topology
3O34A 2MT5A 2YYRA 2JMIA 4LKAA 3QZVA 2E6RA 4YBSA 2KU3A 2YQMA 3ZVYA 2ZETC 2KWOA 2MNYA 4B7YC 1Z2QA 2QICA 2AN6A 2Y1MA 4ZQLA 3U5PA 2LXHC 1WEPA 2VPEA 3SOWA 2YT5A 5KH7A 3ZPVE 2L75A 2KFTA 2MD7B 4A4BA 2ECTA 4FO9A 2K4DA 2G45A 1WEWA 4R2YA 4O64A 1WEOA 2G6QA 3FL2A 5TABA 5H1VA 5AITA 2MIQA 5TRBA 4GNGA 5B77A 1MM2A 5DINA 3N9LA 3LRQA 3SOUA 2VNFA 3DPLR 2G43A 1LDKC 3MHHA 5B75A 2F6JA 2RI7A 4WA6A 2Y43A 4LADB 5J3XA 1MM3A 1WEVA 4IC3A 5LCWB 3L11A 4F52B 4TKPB 3RTRB 3N9QA 1IYMA 1G25A 4B86C 2CT2A 2DX8A 2KWNA 3LQIA 4BBQA 2JMDA 1Z6UA 4A49A 4I7BA 2YQLA 4YATA 2VJEA 2LRIC 2VPBA 5KH9A 4ZDTA 2CSYA 2L80A 2H0DA 2YHNA 1XWHA 2C2LA 5TDWA 4AP4A 3I2DA 2ECNA 2XB1A 1WEEA 4PPEA 2UZGA 5C11A 2VJFB 4FK5A 2EGPA 4QF3A 2YUCA 3VK6A 4W4UA 2M3HA 2VJEB 2VP7A 4GNEA 1F62A 3RPGC 3ZTGA 2Y1NA 2D8SA 3EB6A 4MVTA 1WEUA 4GB0A 3ZYQA 2FUIA 4S3OB 5B76A 1WFKA 2FUUA 2LGVA 4YC9A 1VD4A 4FJCA 3PUQA 2RSDA 4UI9B 1VFYA 3GL6A 5JG6A 4GNDA 1FP0A 1N87A 3C5KA 4AVXA 5LKTA 2K17A 2YU4A 3T7LA 1WIMA 2CSZA 4YADA 3HCSA 5G0FA 4GNFA 5AIUA 4NN2A 1X4IA 5H1UA 5B79A 4L58A 2M6MA 1BORA 4N3WA 1WEMA 3N9OA 4R7EA 4V3KC 2F42A 1WEQA 3O33A 4A4CA 1LDJB 4UP0A 4WZ3B 2KGIA 2VPGA 4N4FA 2KWKA 3O70A 2OXQC 2YHOA 2LQ6A 4CCGX 2QJ0A 2L43A 2I50A 4LLBA 1K2FA 5D1MB 2LGGA 2ECGA 2MD8C 3GV4A 2H0DB 3LQJA 3PURA 1HYIA 2C2VS 2ECJA 1WILA 5I3LA 3ZVZB 3O35A 3M62A 2YURA 4I7DA 1CHCA 2JMJA 5D1LB 1V87A 3NG2A 4YBMA 5B78A 4UP5A 1X4UA 2QIZA 5FEYA 1X4JA 2LN0A 2KREA 3U5OA 5LKXA 5TDRA 4P5OB 4PTBA 2KWJA 3L1XA 1DVPA 2BAYA 1E4UA 2KGGA 4FIPA 3N9NA 4QF2A 3M99A 4AYCA 2XEUA 3SHBA 3U5MA 4MSXA 5LKUA 3ASLA 2KIZA 1VYXA 1JM7A 2HYED 3O7AA 2EODA 4WZ2A 2LXPC 2MA5A 3RPGB 3T6RA 4AUQB 4L7XA 4R8PK 2IDAA 4V3LC 2LDRA 3MHSA 1WGMA 3SOXA 2YW8A 3KV6A 1WESA 2KR4A 5EYAF 3M63A 4LJNA 4A0CD 4C9ZA 5FERA 2MUMA 2LV9A 3U5NA 2NAAA 3KQIA 2KE1A 2ECWA 2LGLA 4YABA 3HCTA 2YSMA 2HDPA 2L5UA 2EA6A 3L1ZB 3HCUA 4S3OC 4ZUXU 4Q6FA 2MA6A 3PHDA 4WZ0A 2CKLA 1Z60A 3C6WA 5D1KB 5H9MA 2FSAA 2K16A 2F6NA 4YBTA 1WE9A 3ZPV1 2L0BA 5DKAA 5G04B 2PUYA 3EB5A 5TBNA 4LK9A 3KNVA 2ECVA 5LKZA 3KV5A 5FB0A 5B8DA 5H1TA 2VJFA 1U6GB 1WENA 3DQVR 3LQHA 2CKLB 2VPDA 3V43A 3ZNIA 4CA1A 2YREA 3HTKC 4AYCB 2MNZA 1T1HA 5KH3A 1ZBDB 4BHWA 1JOCA 5G05B 2K1JA 4X3GA 2M85A 3N9MA 1HYJA 1JM7B 2YSJA 5FB1A 2E6SA 4IC2A 4YAXA 2M1RA 4I7CA 5C13A 2PNXA 2JRJA 1RMDA 3IHPA 1FBVA 2ECIA 3O37A 3O36A 2KYUA 3N9PA 2LGKA 4XI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O34 A;  2MT5 A;  2YYR A;  2JMI A;  4LKA A;  3QZV A;  2E6R A;  4YBS A;  2KU3 A;  2YQM A;  3ZVY A;  2ZET C;  2KWO A;  2MNY A;  4B7Y C;  1Z2Q A;  2QIC A;  2AN6 A;  2Y1M A;  4ZQL A;  3U5P A;  2LXH C;  1WEP A;  2VPE A;  3SOW A;  2YT5 A;  5KH7 A;  3ZPV E;  2L75 A;  2KFT A;  2MD7 B;  4A4B A;  2ECT A;  4FO9 A;  2K4D A;  2G45 A;  1WEW A;  4R2Y A;  4O64 A;  1WEO A;  2G6Q A;  3FL2 A;  5TAB A;  5H1V A;  5AIT A;  2MIQ A;  5TRB A;  4GNG A;  5B77 A;  1MM2 A;  5DIN A;  3N9L A;  3LRQ A;  3SOU A;  2VNF A;  3DPL R;  2G43 A;  1LDK C;  3MHH A;  5B75 A;  2F6J A;  2RI7 A;  4WA6 A;  2Y43 A;  4LAD B;  5J3X A;  1MM3 A;  1WEV A;  4IC3 A;  5LCW B;  3L11 A;  4F52 B;  4TKP B;  3RTR B;  3N9Q A;  1IYM A;  1G25 A;  4B86 C;  2CT2 A;  2DX8 A;  2KWN A;  3LQI A;  4BBQ A;  2JMD A;  1Z6U A;  4A49 A;  4I7B A;  2YQL A;  4YAT A;  2VJE A;  2LRI C;  2VPB A;  5KH9 A;  4ZDT A;  2CSY A;  2L80 A;  2H0D A;  2YHN A;  1XWH A;  2C2L A;  5TDW A;  4AP4 A;  3I2D A;  2ECN A;  2XB1 A;  1WEE A;  4PPE A;  2UZG A;  5C11 A;  2VJF B;  4FK5 A;  2EGP A;  4QF3 A;  2YUC A;  3VK6 A;  4W4U A;  2M3H A;  2VJE B;  2VP7 A;  4GNE A;  1F62 A;  3RPG C;  3ZTG A;  2Y1N A;  2D8S A;  3EB6 A;  4MVT A;  1WEU A;  4GB0 A;  3ZYQ A;  2FUI A;  4S3O B;  5B76 A;  1WFK A;  2FUU A;  2LGV A;  4YC9 A;  1VD4 A;  4FJC A;  3PUQ A;  2RSD A;  4UI9 B;  1VFY A;  3GL6 A;  5JG6 A;  4GND A;  1FP0 A;  1N87 A;  3C5K A;  4AVX A;  5LKT A;  2K17 A;  2YU4 A;  3T7L A;  1WIM A;  2CSZ A;  4YAD A;  3HCS A;  5G0F A;  4GNF A;  5AIU A;  4NN2 A;  1X4I A;  5H1U A;  5B79 A;  4L58 A;  2M6M A;  1BOR A;  4N3W A;  1WEM A;  3N9O A;  4R7E A;  4V3K C;  2F42 A;  1WEQ A;  3O33 A;  4A4C A;  1LDJ B;  4UP0 A;  4WZ3 B;  2KGI A;  2VPG A;  4N4F A;  2KWK A;  3O70 A;  2OXQ C;  2YHO A;  2LQ6 A;  4CCG X;  2QJ0 A;  2L43 A;  2I50 A;  4LLB A;  1K2F A;  5D1M B;  2LGG A;  2ECG A;  2MD8 C;  3GV4 A;  2H0D B;  3LQJ A;  3PUR A;  1HYI A;  2C2V S;  2ECJ A;  1WIL A;  5I3L A;  3ZVZ B;  3O35 A;  3M62 A;  2YUR A;  4I7D A;  1CHC A;  2JMJ A;  5D1L B;  1V87 A;  3NG2 A;  4YBM A;  5B78 A;  4UP5 A;  1X4U A;  2QIZ A;  5FEY A;  1X4J A;  2LN0 A;  2KRE A;  3U5O A;  5LKX A;  5TDR A;  4P5O B;  4PTB A;  2KWJ A;  3L1X A;  1DVP A;  2BAY A;  1E4U A;  2KGG A;  4FIP A;  3N9N A;  4QF2 A;  3M99 A;  4AYC A;  2XEU A;  3SHB A;  3U5M A;  4MSX A;  5LKU A;  3ASL A;  2KIZ A;  1VYX A;  1JM7 A;  2HYE D;  3O7A A;  2EOD A;  4WZ2 A;  2LXP C;  2MA5 A;  3RPG B;  3T6R A;  4AUQ B;  4L7X A;  4R8P K;  2IDA A;  4V3L C;  2LDR A;  3MHS A;  1WGM A;  3SOX A;  2YW8 A;  3KV6 A;  1WES A;  2KR4 A;  5EYA F;  3M63 A;  4LJN A;  4A0C D;  4C9Z A;  5FER A;  2MUM A;  2LV9 A;  3U5N A;  2NAA A;  3KQI A;  2KE1 A;  2ECW A;  2LGL A;  4YAB A;  3HCT A;  2YSM A;  2HDP A;  2L5U A;  2EA6 A;  3L1Z B;  3HCU A;  4S3O C;  4ZUX U;  4Q6F A;  2MA6 A;  3PHD A;  4WZ0 A;  2CKL A;  1Z60 A;  3C6W A;  5D1K B;  5H9M A;  2FSA A;  2K16 A;  2F6N A;  4YBT A;  1WE9 A;  3ZPV 1;  2L0B A;  5DKA A;  5G04 B;  2PUY A;  3EB5 A;  5TBN A;  4LK9 A;  3KNV A;  2ECV A;  5LKZ A;  3KV5 A;  5FB0 A;  5B8D A;  5H1T A;  2VJF A;  1U6G B;  1WEN A;  3DQV R;  3LQH A;  2CKL B;  2VPD A;  3V43 A;  3ZNI A;  4CA1 A;  2YRE A;  3HTK C;  4AYC B;  2MNZ A;  1T1H A;  5KH3 A;  1ZBD B;  4BHW A;  1JOC A;  5G05 B;  2K1J A;  4X3G A;  2M85 A;  3N9M A;  1HYJ A;  1JM7 B;  2YSJ A;  5FB1 A;  2E6S A;  4IC2 A;  4YAX A;  2M1R A;  4I7C A;  5C13 A;  2PNX A;  2JRJ A;  1RMD A;  3IHP A;  1FBV A;  2ECI A;  3O37 A;  3O36 A;  2KYU A;  3N9P A;  2LGK A;  4XI1 A; 
#chains in the Genus database with same CATH topology
 3O34 A;  3LJU X;  2MT5 A;  2YYR A;  3FEH A;  2JMI A;  4LKA A;  3QZV A;  2E6R A;  4YBS A;  2KKX A;  2KU3 A;  2YQM A;  3ZVY A;  2ZET C;  1DCQ A;  2KWO A;  2MNY A;  4B7Y C;  1Z2Q A;  2QIC A;  2AN6 A;  2Y1M A;  4ZQL A;  3U5P A;  2LXH C;  1WEP A;  2VPE A;  3PLW A;  3SOW A;  2YT5 A;  5KH7 A;  3ZPV E;  4QQ4 A;  2L75 A;  2KFT A;  2CRW A;  2MD7 B;  4A4B A;  2ECT A;  4FO9 A;  2K4D A;  2L7P A;  2G45 A;  1WEW A;  4R2Y A;  4O64 A;  1WEO A;  2YVR A;  2G6Q A;  3FL2 A;  5TAB A;  5H1V A;  5AIT A;  2MIQ A;  3DDT A;  5TRB A;  4GNG A;  5B77 A;  1MM2 A;  5DIN A;  3N9L A;  3LRQ A;  3SOU A;  2VNF A;  3DPL R;  2G43 A;  1LDK C;  2XOZ A;  3MHH A;  5B75 A;  2F6J A;  2RI7 A;  4WA6 A;  2Y43 A;  2XOC A;  4LAD B;  5J3X A;  1MM3 A;  1WEV A;  4IC3 A;  5LCW B;  3L11 A;  4F52 B;  4TKP B;  5SVI A;  3RTR B;  2MKE A;  3N9Q A;  1IYM A;  1G25 A;  4B86 C;  2CT2 A;  2DX8 A;  2KWN A;  3LQI A;  2CSV A;  4BBQ A;  2JMD A;  1Z6U A;  4A49 A;  4I7B A;  2YQL A;  4YAT A;  2EXU A;  2VJE A;  3LDY A;  2LRI C;  2VPB A;  5KH9 A;  4ZDT A;  2CSY A;  2L80 A;  2H0D A;  3LVQ E;  2YHN A;  1XWH A;  5SVI B;  3DWD A;  2C2L A;  5TDW A;  2EGM A;  5SVX A;  4AP4 A;  3I2D A;  2ECN A;  2XB1 A;  1WEE A;  4PPE A;  2UZG A;  5C11 A;  2VJF B;  4FK5 A;  2EGP A;  4QF3 A;  2YUC A;  3VK6 A;  4W4U A;  2M3H A;  2VJE B;  2VP7 A;  4O62 A;  4GNE A;  1F62 A;  3RPG C;  3ZTG A;  2Y1N A;  2D8S A;  3EB6 A;  4MVT A;  1WEU A;  4GB0 A;  3ZYQ A;  2FUI A;  4S3O B;  5B76 A;  1WFK A;  2RR4 A;  2FUU A;  2LGV A;  4YC9 A;  1VD4 A;  4FJC A;  2CRR A;  3PUQ A;  2RSD A;  4UI9 B;  1VFY A;  3GL6 A;  5JG6 A;  2B0O E;  4GND A;  1FP0 A;  1N87 A;  3C5K A;  4AVX A;  5LKT A;  2K17 A;  2YU4 A;  3T7L A;  1WIM A;  2CSZ A;  4YAD A;  3HCS A;  5G0F A;  4GNF A;  5AIU A;  4NN2 A;  3H7H A;  3T9K A;  4Z0O A;  1X4I A;  5H1U A;  5B79 A;  4L58 A;  2M6M A;  1BOR A;  4N3W A;  1WEM A;  3N9O A;  4R7E A;  4V3K C;  2FFW A;  2F42 A;  3O47 A;  1WEQ A;  3O33 A;  4A4C A;  1LDJ B;  4UP0 A;  4WZ3 B;  2KGI A;  2VPG A;  4N4F A;  2KWK A;  2D8U A;  3O70 A;  2OXQ C;  2YHO A;  2LQ6 A;  4CCG X;  2DJA A;  2QJ0 A;  2L43 A;  2I50 A;  4LLB A;  1K2F A;  5D1M B;  2LGG A;  2ECG A;  2MD8 C;  3GV4 A;  2H0D B;  3LQJ A;  3PUR A;  1HYI A;  2C2V S;  2ECJ A;  1WIL A;  5I3L A;  2M13 A;  3ZVZ B;  3O35 A;  3M62 A;  2XOY A;  2YUR A;  4I7D A;  1CHC A;  2JMJ A;  5D1L B;  4OGE A;  1V87 A;  3NG2 A;  4YBM A;  5B78 A;  4UP5 A;  1X4U A;  5SVY A;  2CON A;  2QIZ A;  5FEY A;  1X4J A;  2LN0 A;  2KRE A;  3U5O A;  4Z0R A;  5LKX A;  5TDR A;  4P5O B;  4PTB A;  2KWJ A;  3L1X A;  3FM8 C;  1DVP A;  2BAY A;  1E4U A;  3JUE A;  2KGG A;  4FIP A;  3N9N A;  4QF2 A;  3M99 A;  4AYC A;  2XEU A;  3SHB A;  3U5M A;  4MSX A;  3KDE C;  5LKU A;  3ASL A;  2KIZ A;  1VYX A;  3M7K A;  1JM7 A;  2HYE D;  3O7A A;  2EOD A;  4WZ2 A;  2LXP C;  2MA5 A;  3RPG B;  3T6R A;  4AUQ B;  4L7X A;  4R8P K;  2IDA A;  2P57 A;  4V3L C;  2LDR A;  3MHS A;  2JM3 A;  2E61 A;  1WGM A;  3SOX A;  2YW8 A;  3KV6 A;  1WES A;  2OWA A;  2KR4 A;  5EYA F;  2FD4 A;  1MBM A;  3M63 A;  4LJN A;  4A0C D;  4C9Z A;  5FER A;  2MUM A;  2LV9 A;  3U5N A;  2NAA A;  3KQI A;  3FAN A;  4OGC A;  2IQJ A;  2KE1 A;  2ECW A;  2LGL A;  4YAB A;  3SUB A;  3HCT A;  2YSM A;  2HDP A;  2L5U A;  2EA6 A;  3L1Z B;  3HCU A;  4S3O C;  4ZUX U;  4Q6F A;  3FAO A;  2MA6 A;  3PHD A;  4WZ0 A;  2LAU A;  2CKL A;  1Z60 A;  3C6W A;  5D1K B;  5H9M A;  5K3Q A;  2FSA A;  2K16 A;  2F6N A;  3MDB C;  1WE9 A;  4YBT A;  3ZPV 1;  2L0B A;  2KKY A;  5DKA A;  5G04 B;  2PUY A;  2DSM A;  3EB5 A;  5TBN A;  4LK9 A;  3KNV A;  2XP0 A;  2ECV A;  5LKZ A;  3KV5 A;  5FB0 A;  5B8D A;  5H1T A;  4H9D A;  2VJF A;  1U6G B;  3FJU B;  1WEN A;  3DQV R;  3LQH A;  2CKL B;  3E2D A;  2VPD A;  3V43 A;  3ZNI A;  4CA1 A;  2YRE A;  3HTK C;  4F1P A;  4AYC B;  2MNZ A;  1T1H A;  5KH3 A;  1ZBD B;  4BHW A;  1JOC A;  5G05 B;  2K1J A;  4X3G A;  2M85 A;  3N9M A;  1HYJ A;  1JM7 B;  2YSJ A;  5FB1 A;  3LVR E;  2E6S A;  4IC2 A;  4YAX A;  2M1R A;  4I7C A;  5C13 A;  2PNX A;  2JRJ A;  1RMD A;  3IHP A;  1FBV A;  2ECI A;  3Q1D A;  3O37 A;  2JUN A;  3O36 A;  2KYU A;  3N9P A;  2LGK A;  4XI1 A; 
#chains in the Genus database with same CATH homology
 3O34 A;  2MT5 A;  2YYR A;  2JMI A;  4LKA A;  3QZV A;  2E6R A;  4YBS A;  2KU3 A;  2YQM A;  3ZVY A;  2ZET C;  2KWO A;  2MNY A;  4B7Y C;  1Z2Q A;  2QIC A;  2AN6 A;  2Y1M A;  4ZQL A;  3U5P A;  2LXH C;  1WEP A;  2VPE A;  3SOW A;  2YT5 A;  5KH7 A;  3ZPV E;  2L75 A;  2KFT A;  2MD7 B;  4A4B A;  2ECT A;  4FO9 A;  2K4D A;  2G45 A;  1WEW A;  4R2Y A;  4O64 A;  1WEO A;  2G6Q A;  3FL2 A;  5TAB A;  5H1V A;  5AIT A;  2MIQ A;  5TRB A;  4GNG A;  5B77 A;  1MM2 A;  5DIN A;  3N9L A;  3LRQ A;  3SOU A;  2VNF A;  3DPL R;  2G43 A;  1LDK C;  3MHH A;  5B75 A;  2F6J A;  2RI7 A;  4WA6 A;  2Y43 A;  4LAD B;  5J3X A;  1MM3 A;  1WEV A;  4IC3 A;  5LCW B;  3L11 A;  4F52 B;  4TKP B;  3RTR B;  3N9Q A;  1IYM A;  1G25 A;  4B86 C;  2CT2 A;  2DX8 A;  2KWN A;  3LQI A;  4BBQ A;  2JMD A;  1Z6U A;  4A49 A;  4I7B A;  2YQL A;  4YAT A;  2VJE A;  2LRI C;  2VPB A;  5KH9 A;  4ZDT A;  2CSY A;  2L80 A;  2H0D A;  2YHN A;  1XWH A;  2C2L A;  5TDW A;  4AP4 A;  3I2D A;  2ECN A;  2XB1 A;  1WEE A;  4PPE A;  2UZG A;  5C11 A;  2VJF B;  4FK5 A;  2EGP A;  4QF3 A;  2YUC A;  3VK6 A;  4W4U A;  2M3H A;  2VJE B;  2VP7 A;  4GNE A;  1F62 A;  3RPG C;  3ZTG A;  2Y1N A;  2D8S A;  3EB6 A;  4MVT A;  1WEU A;  4GB0 A;  3ZYQ A;  2FUI A;  4S3O B;  5B76 A;  1WFK A;  2FUU A;  2LGV A;  4YC9 A;  1VD4 A;  4FJC A;  3PUQ A;  2RSD A;  4UI9 B;  1VFY A;  3GL6 A;  5JG6 A;  4GND A;  1FP0 A;  1N87 A;  3C5K A;  4AVX A;  5LKT A;  2K17 A;  2YU4 A;  3T7L A;  1WIM A;  2CSZ A;  4YAD A;  3HCS A;  5G0F A;  4GNF A;  5AIU A;  4NN2 A;  1X4I A;  5H1U A;  5B79 A;  4L58 A;  2M6M A;  1BOR A;  4N3W A;  1WEM A;  3N9O A;  4R7E A;  4V3K C;  2F42 A;  1WEQ A;  3O33 A;  4A4C A;  1LDJ B;  4UP0 A;  4WZ3 B;  2KGI A;  2VPG A;  4N4F A;  2KWK A;  3O70 A;  2OXQ C;  2YHO A;  2LQ6 A;  4CCG X;  2QJ0 A;  2L43 A;  2I50 A;  4LLB A;  1K2F A;  5D1M B;  2LGG A;  2ECG A;  2MD8 C;  3GV4 A;  2H0D B;  3LQJ A;  3PUR A;  1HYI A;  2C2V S;  2ECJ A;  1WIL A;  5I3L A;  3ZVZ B;  3O35 A;  3M62 A;  2YUR A;  4I7D A;  1CHC A;  2JMJ A;  5D1L B;  1V87 A;  3NG2 A;  4YBM A;  5B78 A;  4UP5 A;  1X4U A;  2QIZ A;  5FEY A;  1X4J A;  2LN0 A;  2KRE A;  3U5O A;  5LKX A;  5TDR A;  4P5O B;  4PTB A;  2KWJ A;  3L1X A;  1DVP A;  2BAY A;  1E4U A;  2KGG A;  4FIP A;  3N9N A;  4QF2 A;  3M99 A;  4AYC A;  2XEU A;  3SHB A;  3U5M A;  4MSX A;  5LKU A;  3ASL A;  2KIZ A;  1VYX A;  1JM7 A;  2HYE D;  3O7A A;  2EOD A;  4WZ2 A;  2LXP C;  2MA5 A;  3RPG B;  3T6R A;  4AUQ B;  4L7X A;  4R8P K;  2IDA A;  4V3L C;  2LDR A;  3MHS A;  1WGM A;  3SOX A;  2YW8 A;  3KV6 A;  1WES A;  2KR4 A;  5EYA F;  3M63 A;  4LJN A;  4A0C D;  4C9Z A;  5FER A;  2MUM A;  2LV9 A;  3U5N A;  2NAA A;  3KQI A;  2KE1 A;  2ECW A;  2LGL A;  4YAB A;  3HCT A;  2YSM A;  2HDP A;  2L5U A;  2EA6 A;  3L1Z B;  3HCU A;  4S3O C;  4ZUX U;  4Q6F A;  2MA6 A;  3PHD A;  4WZ0 A;  2CKL A;  1Z60 A;  3C6W A;  5D1K B;  5H9M A;  2FSA A;  2K16 A;  2F6N A;  4YBT A;  1WE9 A;  3ZPV 1;  2L0B A;  5DKA A;  5G04 B;  2PUY A;  3EB5 A;  5TBN A;  4LK9 A;  3KNV A;  2ECV A;  5LKZ A;  3KV5 A;  5FB0 A;  5B8D A;  5H1T A;  2VJF A;  1U6G B;  1WEN A;  3DQV R;  3LQH A;  2CKL B;  2VPD A;  3V43 A;  3ZNI A;  4CA1 A;  2YRE A;  3HTK C;  4AYC B;  2MNZ A;  1T1H A;  5KH3 A;  1ZBD B;  4BHW A;  1JOC A;  5G05 B;  2K1J A;  4X3G A;  2M85 A;  3N9M A;  1HYJ A;  1JM7 B;  2YSJ A;  5FB1 A;  2E6S A;  4IC2 A;  4YAX A;  2M1R A;  4I7C A;  5C13 A;  2PNX A;  2JRJ A;  1RMD A;  3IHP A;  1FBV A;  2ECI A;  3O37 A;  3O36 A;  2KYU A;  3N9P A;  2LGK A;  4XI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...