5B76A

Crystal structure of moz double phd finger domain in complex with histone h3 crotonylation at k14
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
SLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
total genus 26
structure length 120
sequence length 120
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b76A00
2PNXA 3NG2A 4CA1A 2YW8A 1X4IA 5B78A 1XWHA 2L43A 3ZTGA 3N9OA 4I7DA 3SOUA 1X4JA 2VP7A 2MIQA 5C13A 4V3LC 1N87A 1WEPA 2H0DA 2ECWA 2LGLA 5DKAA 1VYXA 2L80A 4TKPB 2CKLA 3EB5A 5B76A 4WZ3B 2LDRA 5D1KB 3KV6A 4A4CA 2ECTA 4YABA 3L1XA 2LGVA 3O34A 2BAYA 4IC2A 2F6NA 4AP4A 3I2DA 2FSAA 2KYUA 5EYAF 5JG6A 5AITA 2ECVA 1WEEA 4A0CD 3M99A 4GNFA 3U5OA 1WESA 3M63A 2FUUA 5G05B 4GNDA 1E4UA 2VNFA 2MD8C 3O33A 4GNGA 2K4DA 3SOXA 1WEMA 5H1TA 5C11A 1F62A 4LLBA 2VPGA 2VJFB 4UP5A 2VPEA 3VK6A 4X3GA 1BORA 5B79A 2VJEA 4S3OB 4Q6FA 5FERA 3GV4A 2EA6A 2MT5A 3ZYQA 2YYRA 5FEYA 3N9PA 4N3WA 5D1LB 1V87A 1DVPA 3N9QA 1HYJA 2VJFA 2Y1MA 2F6JA 3L11A 2KU3A 3EB6A 4PTBA 4CCGX 2KWJA 2CKLB 2G45A 4R8PK 1WEOA 3O37A 2VPDA 1WEVA 2EGPA 2EODA 2KREA 2E6SA 5B77A 3T6RA 2E6RA 4YAXA 2KWOA 3L1ZB 3LQHA 2HDPA 4GNEA 2YHOA 3ZPVE 5I3LA 2G43A 4WA6A 2YUCA 5B8DA 2MNYA 2JRJA 5G0FA 4YBSA 3HCUA 5DINA 1JM7B 2KFTA 2L5UA 2Y43A 2ECJA 3O36A 2YQLA 4LKAA 3ZVYA 4A4BA 5KH7A 3DQVR 2D8SA 2YURA 1ZBDB 2CSYA 2K17A 2MD7B 2M85A 2UZGA 3V43A 3HCTA 4B86C 2KWNA 3KNVA 4AUQB 3PUQA 4UI9B 4R2YA 1LDKC 1VD4A 4YBTA 4I7BA 3RPGB 2XB1A 3PHDA 2YSJA 2I50A 5LKXA 3U5NA 1MM2A 2M1RA 1RMDA 2C2LA 2H0DB 1JM7A 3RTRB 2KGIA 3IHPA 3LQIA 4PPEA 4P5OB 5LKUA 3SHBA 2YT5A 1IYMA 3HTKC 5AIUA 5LKTA 2LXHC 4W4UA 1WEWA 2YSMA 2G6QA 3ZPV1 4IC3A 2MNZA 1U6GB 2YQMA 5KH9A 1T1HA 2YHNA 4F52B 3KV5A 2LN0A 3T7LA 1MM3A 1HYIA 2CT2A 4B7YC 2F42A 2LRIC 2YU4A 4BHWA 1WE9A 2HYED 2ECGA 4A49A 2MUMA 1K2FA 5LCWB 1WFKA 4FJCA 2FUIA 1WIMA 2K1JA 2ECNA 4FO9A 3HCSA 1Z2QA 4V3KC 2L75A 2LGGA 5TBNA 3KQIA 2OXQC 2VJEB 4YBMA 1JOCA 3MHSA 3C6WA 2JMDA 4BBQA 3M62A 2LXPC 1G25A 2K16A 4LJNA 5D1MB 5J3XA 3N9NA 2QIZA 5G04B 2DX8A 4LK9A 3ASLA 4FK5A 2ZETC 4FIPA 2XEUA 5TRBA 4AYCB 3N9MA 3ZNIA 1WGMA 4N4FA 3N9LA 4QF2A 4QF3A 4MSXA 4L7XA 1LDJB 4WZ2A 5H1VA 5LKZA 5H1UA 3FL2A 2KR4A 2RSDA 4LADB 3U5MA 2Y1NA 4ZUXU 2MA6A 5KH3A 4O64A 2M6MA 1WENA 4YC9A 4WZ0A 4ZQLA 1WILA 3LQJA 2JMIA 3QZVA 3PURA 1X4UA 4C9ZA 3ZVZB 2M3HA 3O7AA 2KWKA 2LGKA 4XI1A 4ZDTA 4AYCA 4MVTA 2L0BA 3SOWA 4I7CA 1WEQA 4NN2A 4GB0A 1FP0A 1CHCA 5B75A 2LQ6A 2NAAA 5FB1A 1Z6UA 2QJ0A 3U5PA 3MHHA 5TDWA 5H9MA 1FBVA 2AN6A 3GL6A 4R7EA 2PUYA 2CSZA 4YATA 1Z60A 1VFYA 3C5KA 4UP0A 4L58A 2MA5A 3O70A 2JMJA 2LV9A 4YADA 2RI7A 2C2VS 2KE1A 2VPBA 4S3OC 4AVXA 1WEUA 2IDAA 5TABA 5FB0A 2ECIA 2QICA 3RPGC 2KGGA 3O35A 2KIZA 3DPLR 2YREA 5TDRA 3LRQA
chains in the Genus database with same CATH superfamily
2PNXA 3FJUB 3NG2A 2KKYA 4CA1A 2YW8A 1X4IA 5B78A 1XWHA 2L43A 3ZTGA 3N9OA 4I7DA 3SOUA 1X4JA 2VP7A 2MIQA 5C13A 4V3LC 1N87A 1WEPA 2H0DA 2ECWA 2LGLA 5DKAA 1VYXA 2L80A 4TKPB 4O62A 2CKLA 3EB5A 5B76A 4WZ3B 2LDRA 5D1KB 3FM8C 3KV6A 4A4CA 2ECTA 4YABA 3L1XA 2LGVA 3O34A 2BAYA 4IC2A 2F6NA 2JM3A 3I2DA 4AP4A 2FSAA 2KYUA 5EYAF 5JG6A 5AITA 2ECVA 1WEEA 4A0CD 3M99A 4GNFA 4H9DA 3U5OA 1WESA 3M63A 2FUUA 5G05B 4GNDA 4QQ4A 3T9KA 1E4UA 2VNFA 2CRRA 2MD8C 3O33A 4GNGA 2K4DA 3SOXA 1WEMA 5H1TA 5C11A 1F62A 2FD4A 4LLBA 4OGCA 2E61A 2VPGA 2VJFB 4UP5A 2VPEA 3VK6A 4X3GA 1BORA 5B79A 2VJEA 4S3OB 4Q6FA 5FERA 3GV4A 2EA6A 2MT5A 3ZYQA 2YYRA 5FEYA 3N9PA 4N3WA 5D1LB 1V87A 1DVPA 3N9QA 1HYJA 2VJFA 2EXUA 2Y1MA 2F6JA 3L11A 2KU3A 3EB6A 3O47A 4PTBA 4CCGX 2KWJA 5K3QA 2CKLB 2G45A 4R8PK 1WEOA 3O37A 2VPDA 1WEVA 2EGPA 2EODA 3LDYA 2KREA 2E6SA 4OGEA 5B77A 5SVXA 3T6RA 2E6RA 4YAXA 2KWOA 2YVRA 3L1ZB 3FEHA 3LQHA 5SVIA 2HDPA 4GNEA 2YHOA 3ZPVE 5I3LA 3MDBC 2G43A 4WA6A 2YUCA 5B8DA 2MNYA 2JRJA 3LVRE 2EGMA 5G0FA 4YBSA 1DCQA 3HCUA 5DINA 1JM7B 2KFTA 2L5UA 2KKXA 2Y43A 2ECJA 2L7PA 3O36A 2YQLA 4LKAA 3ZVYA 2B0OE 4A4BA 5KH7A 3DQVR 2D8SA 2YURA 1ZBDB 2CSYA 3E2DA 2K17A 2MD7B 2M85A 2DSMA 2UZGA 3V43A 3HCTA 4B86C 2KWNA 3KNVA 4AUQB 3PUQA 4UI9B 4R2YA 1LDKC 1VD4A 3SUBA 4YBTA 4I7BA 3RPGB 2XB1A 3PHDA 2YSJA 2I50A 5LKXA 3U5NA 1MM2A 2M1RA 1RMDA 2C2LA 2H0DB 1JM7A 3RTRB 2KGIA 3IHPA 3LQIA 4PPEA 3M7KA 4P5OB 5LKUA 3SHBA 2YT5A 5SVIB 1IYMA 3HTKC 5AIUA 5LKTA 2LXHC 4W4UA 1WEWA 2YSMA 2G6QA 3PLWA 3ZPV1 4IC3A 2MNZA 1U6GB 2YQMA 2P57A 5KH9A 1T1HA 2YHNA 4F52B 3KV5A 2LN0A 3T7LA 1MM3A 1HYIA 2MKEA 2CT2A 4B7YC 2F42A 2LRIC 2YU4A 4BHWA 1WE9A 2HYED 2CONA 2ECGA 4A49A 2XOYA 2MUMA 1K2FA 5LCWB 1WFKA 4FJCA 2FUIA 1WIMA 2K1JA 2ECNA 2OWAA 3HCSA 1Z2QA 4FO9A 4V3KC 2L75A 2LGGA 5TBNA 3KQIA 2OXQC 2VJEB 4YBMA 1JOCA 3MHSA 2LAUA 3C6WA 3DWDA 2JMDA 4BBQA 3M62A 4Z0RA 2DJAA 2LXPC 2D8UA 1G25A 2K16A 4LJNA 5D1MB 5J3XA 3N9NA 2QIZA 5G04B 2DX8A 4LK9A 3ASLA 4FK5A 2ZETC 4FIPA 2XEUA 4F1PA 5TRBA 4AYCB 3N9MA 3ZNIA 1WGMA 4N4FA 3N9LA 4QF2A 4QF3A 4MSXA 4L7XA 1LDJB 4WZ2A 5H1VA 5LKZA 5H1UA 3FL2A 2JUNA 2KR4A 2RSDA 4LADB 3U5MA 2Y1NA 4ZUXU 2MA6A 5KH3A 4O64A 3FANA 2M6MA 1WENA 4YC9A 4WZ0A 4ZQLA 1WILA 3LQJA 2JMIA 3QZVA 3PURA 1X4UA 4C9ZA 3ZVZB 2M3HA 3O7AA 2KWKA 2LGKA 4XI1A 4ZDTA 4AYCA 3LVQE 4MVTA 2L0BA 3SOWA 4I7CA 1WEQA 4NN2A 4GB0A 1FP0A 1CHCA 5B75A 2LQ6A 3FAOA 2NAAA 5FB1A 1MBMA 1Z6UA 2QJ0A 3U5PA 3MHHA 5TDWA 5H9MA 5SVYA 1FBVA 2RR4A 2AN6A 3GL6A 4R7EA 2PUYA 2XP0A 2CSZA 4YATA 2CRWA 1Z60A 3H7HA 1VFYA 3DDTA 3C5KA 4UP0A 3LJUX 4Z0OA 4L58A 2MA5A 3O70A 3Q1DA 2XOZA 2JMJA 2LV9A 4YADA 2RI7A 2C2VS 2KE1A 2IQJA 2VPBA 2XOCA 4S3OC 4AVXA 1WEUA 2IDAA 5TABA 5FB0A 3JUEA 2ECIA 3KDEC 2QICA 3RPGC 2FFWA 2KGGA 3O35A 2KIZA 3DPLR 2CSVA 2YREA 5TDRA 3LRQA 2M13A
chains in the Genus database with same CATH topology
2PNXA 3NG2A 4CA1A 2YW8A 1X4IA 5B78A 1XWHA 2L43A 3ZTGA 3N9OA 4I7DA 3SOUA 1X4JA 2VP7A 2MIQA 5C13A 4V3LC 1N87A 1WEPA 2H0DA 2ECWA 2LGLA 5DKAA 1VYXA 2L80A 4TKPB 2CKLA 3EB5A 5B76A 4WZ3B 2LDRA 5D1KB 3KV6A 4A4CA 2ECTA 4YABA 3L1XA 2LGVA 3O34A 2BAYA 4IC2A 2F6NA 4AP4A 3I2DA 2FSAA 2KYUA 5EYAF 5JG6A 5AITA 2ECVA 1WEEA 4A0CD 3M99A 4GNFA 3U5OA 1WESA 3M63A 2FUUA 5G05B 4GNDA 1E4UA 2VNFA 2MD8C 3O33A 4GNGA 2K4DA 3SOXA 1WEMA 5H1TA 5C11A 1F62A 4LLBA 2VPGA 2VJFB 4UP5A 2VPEA 3VK6A 4X3GA 1BORA 5B79A 2VJEA 4S3OB 4Q6FA 5FERA 3GV4A 2EA6A 2MT5A 3ZYQA 2YYRA 5FEYA 3N9PA 4N3WA 5D1LB 1V87A 1DVPA 3N9QA 1HYJA 2VJFA 2Y1MA 2F6JA 3L11A 2KU3A 3EB6A 4PTBA 4CCGX 2KWJA 2CKLB 2G45A 4R8PK 1WEOA 3O37A 2VPDA 1WEVA 2EGPA 2EODA 2KREA 2E6SA 5B77A 3T6RA 2E6RA 4YAXA 2KWOA 3L1ZB 3LQHA 2HDPA 4GNEA 2YHOA 3ZPVE 5I3LA 2G43A 4WA6A 2YUCA 5B8DA 2MNYA 2JRJA 5G0FA 4YBSA 3HCUA 5DINA 1JM7B 2KFTA 2L5UA 2Y43A 2ECJA 3O36A 2YQLA 4LKAA 3ZVYA 4A4BA 5KH7A 3DQVR 2D8SA 2YURA 1ZBDB 2CSYA 2K17A 2MD7B 2M85A 2UZGA 3V43A 3HCTA 4B86C 2KWNA 3KNVA 4AUQB 3PUQA 4UI9B 4R2YA 1LDKC 1VD4A 4YBTA 4I7BA 3RPGB 2XB1A 3PHDA 2YSJA 2I50A 5LKXA 3U5NA 1MM2A 2M1RA 1RMDA 2C2LA 2H0DB 1JM7A 3RTRB 2KGIA 3IHPA 3LQIA 4PPEA 4P5OB 5LKUA 3SHBA 2YT5A 1IYMA 3HTKC 5AIUA 5LKTA 2LXHC 4W4UA 1WEWA 2YSMA 2G6QA 3ZPV1 4IC3A 2MNZA 1U6GB 2YQMA 5KH9A 1T1HA 2YHNA 4F52B 3KV5A 2LN0A 3T7LA 1MM3A 1HYIA 2CT2A 4B7YC 2F42A 2LRIC 2YU4A 4BHWA 1WE9A 2HYED 2ECGA 4A49A 2MUMA 1K2FA 5LCWB 1WFKA 4FJCA 2FUIA 1WIMA 2K1JA 2ECNA 4FO9A 3HCSA 1Z2QA 4V3KC 2L75A 2LGGA 5TBNA 3KQIA 2OXQC 2VJEB 4YBMA 1JOCA 3MHSA 3C6WA 2JMDA 4BBQA 3M62A 2LXPC 1G25A 2K16A 4LJNA 5D1MB 5J3XA 3N9NA 2QIZA 5G04B 2DX8A 4LK9A 3ASLA 4FK5A 2ZETC 4FIPA 2XEUA 5TRBA 4AYCB 3N9MA 3ZNIA 1WGMA 4N4FA 3N9LA 4QF2A 4QF3A 4MSXA 4L7XA 1LDJB 4WZ2A 5H1VA 5LKZA 5H1UA 3FL2A 2KR4A 2RSDA 4LADB 3U5MA 2Y1NA 4ZUXU 2MA6A 5KH3A 4O64A 2M6MA 1WENA 4YC9A 4WZ0A 4ZQLA 1WILA 3LQJA 2JMIA 3QZVA 3PURA 1X4UA 4C9ZA 3ZVZB 2M3HA 3O7AA 2KWKA 2LGKA 4XI1A 4ZDTA 4AYCA 4MVTA 2L0BA 3SOWA 4I7CA 1WEQA 4NN2A 4GB0A 1FP0A 1CHCA 5B75A 2LQ6A 2NAAA 5FB1A 1Z6UA 2QJ0A 3U5PA 3MHHA 5TDWA 5H9MA 1FBVA 2AN6A 3GL6A 4R7EA 2PUYA 2CSZA 4YATA 1Z60A 1VFYA 3C5KA 4UP0A 4L58A 2MA5A 3O70A 2JMJA 2LV9A 4YADA 2RI7A 2C2VS 2KE1A 2VPBA 4S3OC 4AVXA 1WEUA 2IDAA 5TABA 5FB0A 2ECIA 2QICA 3RPGC 2KGGA 3O35A 2KIZA 3DPLR 2YREA 5TDRA 3LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNX A;  3NG2 A;  4CA1 A;  2YW8 A;  1X4I A;  5B78 A;  1XWH A;  2L43 A;  3ZTG A;  3N9O A;  4I7D A;  3SOU A;  1X4J A;  2VP7 A;  2MIQ A;  5C13 A;  4V3L C;  1N87 A;  1WEP A;  2H0D A;  2ECW A;  2LGL A;  5DKA A;  1VYX A;  2L80 A;  4TKP B;  2CKL A;  3EB5 A;  5B76 A;  4WZ3 B;  2LDR A;  5D1K B;  3KV6 A;  4A4C A;  2ECT A;  4YAB A;  3L1X A;  2LGV A;  3O34 A;  2BAY A;  4IC2 A;  2F6N A;  4AP4 A;  3I2D A;  2FSA A;  2KYU A;  5EYA F;  5JG6 A;  5AIT A;  2ECV A;  1WEE A;  4A0C D;  3M99 A;  4GNF A;  3U5O A;  1WES A;  3M63 A;  2FUU A;  5G05 B;  4GND A;  1E4U A;  2VNF A;  2MD8 C;  3O33 A;  4GNG A;  2K4D A;  3SOX A;  1WEM A;  5H1T A;  5C11 A;  1F62 A;  4LLB A;  2VPG A;  2VJF B;  4UP5 A;  2VPE A;  3VK6 A;  4X3G A;  1BOR A;  5B79 A;  2VJE A;  4S3O B;  4Q6F A;  5FER A;  3GV4 A;  2EA6 A;  2MT5 A;  3ZYQ A;  2YYR A;  5FEY A;  3N9P A;  4N3W A;  5D1L B;  1V87 A;  1DVP A;  3N9Q A;  1HYJ A;  2VJF A;  2Y1M A;  2F6J A;  3L11 A;  2KU3 A;  3EB6 A;  4PTB A;  4CCG X;  2KWJ A;  2CKL B;  2G45 A;  4R8P K;  1WEO A;  3O37 A;  2VPD A;  1WEV A;  2EGP A;  2EOD A;  2KRE A;  2E6S A;  5B77 A;  3T6R A;  2E6R A;  4YAX A;  2KWO A;  3L1Z B;  3LQH A;  2HDP A;  4GNE A;  2YHO A;  3ZPV E;  5I3L A;  2G43 A;  4WA6 A;  2YUC A;  5B8D A;  2MNY A;  2JRJ A;  5G0F A;  4YBS A;  3HCU A;  5DIN A;  1JM7 B;  2KFT A;  2L5U A;  2Y43 A;  2ECJ A;  3O36 A;  2YQL A;  4LKA A;  3ZVY A;  4A4B A;  5KH7 A;  3DQV R;  2D8S A;  2YUR A;  1ZBD B;  2CSY A;  2K17 A;  2MD7 B;  2M85 A;  2UZG A;  3V43 A;  3HCT A;  4B86 C;  2KWN A;  3KNV A;  4AUQ B;  3PUQ A;  4UI9 B;  4R2Y A;  1LDK C;  1VD4 A;  4YBT A;  4I7B A;  3RPG B;  2XB1 A;  3PHD A;  2YSJ A;  2I50 A;  5LKX A;  3U5N A;  1MM2 A;  2M1R A;  1RMD A;  2C2L A;  2H0D B;  1JM7 A;  3RTR B;  2KGI A;  3IHP A;  3LQI A;  4PPE A;  4P5O B;  5LKU A;  3SHB A;  2YT5 A;  1IYM A;  3HTK C;  5AIU A;  5LKT A;  2LXH C;  4W4U A;  1WEW A;  2YSM A;  2G6Q A;  3ZPV 1;  4IC3 A;  2MNZ A;  1U6G B;  2YQM A;  5KH9 A;  1T1H A;  2YHN A;  4F52 B;  3KV5 A;  2LN0 A;  3T7L A;  1MM3 A;  1HYI A;  2CT2 A;  4B7Y C;  2F42 A;  2LRI C;  2YU4 A;  4BHW A;  1WE9 A;  2HYE D;  2ECG A;  4A49 A;  2MUM A;  1K2F A;  5LCW B;  1WFK A;  4FJC A;  2FUI A;  1WIM A;  2K1J A;  2ECN A;  4FO9 A;  3HCS A;  1Z2Q A;  4V3K C;  2L75 A;  2LGG A;  5TBN A;  3KQI A;  2OXQ C;  2VJE B;  4YBM A;  1JOC A;  3MHS A;  3C6W A;  2JMD A;  4BBQ A;  3M62 A;  2LXP C;  1G25 A;  2K16 A;  4LJN A;  5D1M B;  5J3X A;  3N9N A;  2QIZ A;  5G04 B;  2DX8 A;  4LK9 A;  3ASL A;  4FK5 A;  2ZET C;  4FIP A;  2XEU A;  5TRB A;  4AYC B;  3N9M A;  3ZNI A;  1WGM A;  4N4F A;  3N9L A;  4QF2 A;  4QF3 A;  4MSX A;  4L7X A;  1LDJ B;  4WZ2 A;  5H1V A;  5LKZ A;  5H1U A;  3FL2 A;  2KR4 A;  2RSD A;  4LAD B;  3U5M A;  2Y1N A;  4ZUX U;  2MA6 A;  5KH3 A;  4O64 A;  2M6M A;  1WEN A;  4YC9 A;  4WZ0 A;  4ZQL A;  1WIL A;  3LQJ A;  2JMI A;  3QZV A;  3PUR A;  1X4U A;  4C9Z A;  3ZVZ B;  2M3H A;  3O7A A;  2KWK A;  2LGK A;  4XI1 A;  4ZDT A;  4AYC A;  4MVT A;  2L0B A;  3SOW A;  4I7C A;  1WEQ A;  4NN2 A;  4GB0 A;  1FP0 A;  1CHC A;  5B75 A;  2LQ6 A;  2NAA A;  5FB1 A;  1Z6U A;  2QJ0 A;  3U5P A;  3MHH A;  5TDW A;  5H9M A;  1FBV A;  2AN6 A;  3GL6 A;  4R7E A;  2PUY A;  2CSZ A;  4YAT A;  1Z60 A;  1VFY A;  3C5K A;  4UP0 A;  4L58 A;  2MA5 A;  3O70 A;  2JMJ A;  2LV9 A;  4YAD A;  2RI7 A;  2C2V S;  2KE1 A;  2VPB A;  4S3O C;  4AVX A;  1WEU A;  2IDA A;  5TAB A;  5FB0 A;  2ECI A;  2QIC A;  3RPG C;  2KGG A;  3O35 A;  2KIZ A;  3DPL R;  2YRE A;  5TDR A;  3LRQ A; 
#chains in the Genus database with same CATH topology
 2PNX A;  3FJU B;  3NG2 A;  2KKY A;  4CA1 A;  2YW8 A;  1X4I A;  5B78 A;  1XWH A;  2L43 A;  3ZTG A;  3N9O A;  4I7D A;  3SOU A;  1X4J A;  2VP7 A;  2MIQ A;  5C13 A;  4V3L C;  1N87 A;  1WEP A;  2H0D A;  2ECW A;  2LGL A;  5DKA A;  1VYX A;  2L80 A;  4TKP B;  4O62 A;  2CKL A;  3EB5 A;  5B76 A;  4WZ3 B;  2LDR A;  5D1K B;  3FM8 C;  3KV6 A;  4A4C A;  2ECT A;  4YAB A;  3L1X A;  2LGV A;  3O34 A;  2BAY A;  4IC2 A;  2F6N A;  2JM3 A;  3I2D A;  4AP4 A;  2FSA A;  2KYU A;  5EYA F;  5JG6 A;  5AIT A;  2ECV A;  1WEE A;  4A0C D;  3M99 A;  4GNF A;  4H9D A;  3U5O A;  1WES A;  3M63 A;  2FUU A;  5G05 B;  4GND A;  4QQ4 A;  3T9K A;  1E4U A;  2VNF A;  2CRR A;  2MD8 C;  3O33 A;  4GNG A;  2K4D A;  3SOX A;  1WEM A;  5H1T A;  5C11 A;  1F62 A;  2FD4 A;  4LLB A;  4OGC A;  2E61 A;  2VPG A;  2VJF B;  4UP5 A;  2VPE A;  3VK6 A;  4X3G A;  1BOR A;  5B79 A;  2VJE A;  4S3O B;  4Q6F A;  5FER A;  3GV4 A;  2EA6 A;  2MT5 A;  3ZYQ A;  2YYR A;  5FEY A;  3N9P A;  4N3W A;  5D1L B;  1V87 A;  1DVP A;  3N9Q A;  1HYJ A;  2VJF A;  2EXU A;  2Y1M A;  2F6J A;  3L11 A;  2KU3 A;  3EB6 A;  3O47 A;  4PTB A;  4CCG X;  2KWJ A;  5K3Q A;  2CKL B;  2G45 A;  4R8P K;  1WEO A;  3O37 A;  2VPD A;  1WEV A;  2EGP A;  2EOD A;  3LDY A;  2KRE A;  2E6S A;  4OGE A;  5B77 A;  5SVX A;  3T6R A;  2E6R A;  4YAX A;  2KWO A;  2YVR A;  3L1Z B;  3FEH A;  3LQH A;  5SVI A;  2HDP A;  4GNE A;  2YHO A;  3ZPV E;  5I3L A;  3MDB C;  2G43 A;  4WA6 A;  2YUC A;  5B8D A;  2MNY A;  2JRJ A;  3LVR E;  2EGM A;  5G0F A;  4YBS A;  1DCQ A;  3HCU A;  5DIN A;  1JM7 B;  2KFT A;  2L5U A;  2KKX A;  2Y43 A;  2ECJ A;  2L7P A;  3O36 A;  2YQL A;  4LKA A;  3ZVY A;  2B0O E;  4A4B A;  5KH7 A;  3DQV R;  2D8S A;  2YUR A;  1ZBD B;  2CSY A;  3E2D A;  2K17 A;  2MD7 B;  2M85 A;  2DSM A;  2UZG A;  3V43 A;  3HCT A;  4B86 C;  2KWN A;  3KNV A;  4AUQ B;  3PUQ A;  4UI9 B;  4R2Y A;  1LDK C;  1VD4 A;  3SUB A;  4YBT A;  4I7B A;  3RPG B;  2XB1 A;  3PHD A;  2YSJ A;  2I50 A;  5LKX A;  3U5N A;  1MM2 A;  2M1R A;  1RMD A;  2C2L A;  2H0D B;  1JM7 A;  3RTR B;  2KGI A;  3IHP A;  3LQI A;  4PPE A;  3M7K A;  4P5O B;  5LKU A;  3SHB A;  2YT5 A;  5SVI B;  1IYM A;  3HTK C;  5AIU A;  5LKT A;  2LXH C;  4W4U A;  1WEW A;  2YSM A;  2G6Q A;  3PLW A;  3ZPV 1;  4IC3 A;  2MNZ A;  1U6G B;  2YQM A;  2P57 A;  5KH9 A;  1T1H A;  2YHN A;  4F52 B;  3KV5 A;  2LN0 A;  3T7L A;  1MM3 A;  1HYI A;  2MKE A;  2CT2 A;  4B7Y C;  2F42 A;  2LRI C;  2YU4 A;  4BHW A;  1WE9 A;  2HYE D;  2CON A;  2ECG A;  4A49 A;  2XOY A;  2MUM A;  1K2F A;  5LCW B;  1WFK A;  4FJC A;  2FUI A;  1WIM A;  2K1J A;  2ECN A;  2OWA A;  3HCS A;  1Z2Q A;  4FO9 A;  4V3K C;  2L75 A;  2LGG A;  5TBN A;  3KQI A;  2OXQ C;  2VJE B;  4YBM A;  1JOC A;  3MHS A;  2LAU A;  3C6W A;  3DWD A;  2JMD A;  4BBQ A;  3M62 A;  4Z0R A;  2DJA A;  2LXP C;  2D8U A;  1G25 A;  2K16 A;  4LJN A;  5D1M B;  5J3X A;  3N9N A;  2QIZ A;  5G04 B;  2DX8 A;  4LK9 A;  3ASL A;  4FK5 A;  2ZET C;  4FIP A;  2XEU A;  4F1P A;  5TRB A;  4AYC B;  3N9M A;  3ZNI A;  1WGM A;  4N4F A;  3N9L A;  4QF2 A;  4QF3 A;  4MSX A;  4L7X A;  1LDJ B;  4WZ2 A;  5H1V A;  5LKZ A;  5H1U A;  3FL2 A;  2JUN A;  2KR4 A;  2RSD A;  4LAD B;  3U5M A;  2Y1N A;  4ZUX U;  2MA6 A;  5KH3 A;  4O64 A;  3FAN A;  2M6M A;  1WEN A;  4YC9 A;  4WZ0 A;  4ZQL A;  1WIL A;  3LQJ A;  2JMI A;  3QZV A;  3PUR A;  1X4U A;  4C9Z A;  3ZVZ B;  2M3H A;  3O7A A;  2KWK A;  2LGK A;  4XI1 A;  4ZDT A;  4AYC A;  3LVQ E;  4MVT A;  2L0B A;  3SOW A;  4I7C A;  1WEQ A;  4NN2 A;  4GB0 A;  1FP0 A;  1CHC A;  5B75 A;  2LQ6 A;  3FAO A;  2NAA A;  5FB1 A;  1MBM A;  1Z6U A;  2QJ0 A;  3U5P A;  3MHH A;  5TDW A;  5H9M A;  5SVY A;  1FBV A;  2RR4 A;  2AN6 A;  3GL6 A;  4R7E A;  2PUY A;  2XP0 A;  2CSZ A;  4YAT A;  2CRW A;  1Z60 A;  3H7H A;  1VFY A;  3DDT A;  3C5K A;  4UP0 A;  3LJU X;  4Z0O A;  4L58 A;  2MA5 A;  3O70 A;  3Q1D A;  2XOZ A;  2JMJ A;  2LV9 A;  4YAD A;  2RI7 A;  2C2V S;  2KE1 A;  2IQJ A;  2VPB A;  2XOC A;  4S3O C;  4AVX A;  1WEU A;  2IDA A;  5TAB A;  5FB0 A;  3JUE A;  2ECI A;  3KDE C;  2QIC A;  3RPG C;  2FFW A;  2KGG A;  3O35 A;  2KIZ A;  3DPL R;  2CSV A;  2YRE A;  5TDR A;  3LRQ A;  2M13 A; 
#chains in the Genus database with same CATH homology
 2PNX A;  3NG2 A;  4CA1 A;  2YW8 A;  1X4I A;  5B78 A;  1XWH A;  2L43 A;  3ZTG A;  3N9O A;  4I7D A;  3SOU A;  1X4J A;  2VP7 A;  2MIQ A;  5C13 A;  4V3L C;  1N87 A;  1WEP A;  2H0D A;  2ECW A;  2LGL A;  5DKA A;  1VYX A;  2L80 A;  4TKP B;  2CKL A;  3EB5 A;  5B76 A;  4WZ3 B;  2LDR A;  5D1K B;  3KV6 A;  4A4C A;  2ECT A;  4YAB A;  3L1X A;  2LGV A;  3O34 A;  2BAY A;  4IC2 A;  2F6N A;  4AP4 A;  3I2D A;  2FSA A;  2KYU A;  5EYA F;  5JG6 A;  5AIT A;  2ECV A;  1WEE A;  4A0C D;  3M99 A;  4GNF A;  3U5O A;  1WES A;  3M63 A;  2FUU A;  5G05 B;  4GND A;  1E4U A;  2VNF A;  2MD8 C;  3O33 A;  4GNG A;  2K4D A;  3SOX A;  1WEM A;  5H1T A;  5C11 A;  1F62 A;  4LLB A;  2VPG A;  2VJF B;  4UP5 A;  2VPE A;  3VK6 A;  4X3G A;  1BOR A;  5B79 A;  2VJE A;  4S3O B;  4Q6F A;  5FER A;  3GV4 A;  2EA6 A;  2MT5 A;  3ZYQ A;  2YYR A;  5FEY A;  3N9P A;  4N3W A;  5D1L B;  1V87 A;  1DVP A;  3N9Q A;  1HYJ A;  2VJF A;  2Y1M A;  2F6J A;  3L11 A;  2KU3 A;  3EB6 A;  4PTB A;  4CCG X;  2KWJ A;  2CKL B;  2G45 A;  4R8P K;  1WEO A;  3O37 A;  2VPD A;  1WEV A;  2EGP A;  2EOD A;  2KRE A;  2E6S A;  5B77 A;  3T6R A;  2E6R A;  4YAX A;  2KWO A;  3L1Z B;  3LQH A;  2HDP A;  4GNE A;  2YHO A;  3ZPV E;  5I3L A;  2G43 A;  4WA6 A;  2YUC A;  5B8D A;  2MNY A;  2JRJ A;  5G0F A;  4YBS A;  3HCU A;  5DIN A;  1JM7 B;  2KFT A;  2L5U A;  2Y43 A;  2ECJ A;  3O36 A;  2YQL A;  4LKA A;  3ZVY A;  4A4B A;  5KH7 A;  3DQV R;  2D8S A;  2YUR A;  1ZBD B;  2CSY A;  2K17 A;  2MD7 B;  2M85 A;  2UZG A;  3V43 A;  3HCT A;  4B86 C;  2KWN A;  3KNV A;  4AUQ B;  3PUQ A;  4UI9 B;  4R2Y A;  1LDK C;  1VD4 A;  4YBT A;  4I7B A;  3RPG B;  2XB1 A;  3PHD A;  2YSJ A;  2I50 A;  5LKX A;  3U5N A;  1MM2 A;  2M1R A;  1RMD A;  2C2L A;  2H0D B;  1JM7 A;  3RTR B;  2KGI A;  3IHP A;  3LQI A;  4PPE A;  4P5O B;  5LKU A;  3SHB A;  2YT5 A;  1IYM A;  3HTK C;  5AIU A;  5LKT A;  2LXH C;  4W4U A;  1WEW A;  2YSM A;  2G6Q A;  3ZPV 1;  4IC3 A;  2MNZ A;  1U6G B;  2YQM A;  5KH9 A;  1T1H A;  2YHN A;  4F52 B;  3KV5 A;  2LN0 A;  3T7L A;  1MM3 A;  1HYI A;  2CT2 A;  4B7Y C;  2F42 A;  2LRI C;  2YU4 A;  4BHW A;  1WE9 A;  2HYE D;  2ECG A;  4A49 A;  2MUM A;  1K2F A;  5LCW B;  1WFK A;  4FJC A;  2FUI A;  1WIM A;  2K1J A;  2ECN A;  4FO9 A;  3HCS A;  1Z2Q A;  4V3K C;  2L75 A;  2LGG A;  5TBN A;  3KQI A;  2OXQ C;  2VJE B;  4YBM A;  1JOC A;  3MHS A;  3C6W A;  2JMD A;  4BBQ A;  3M62 A;  2LXP C;  1G25 A;  2K16 A;  4LJN A;  5D1M B;  5J3X A;  3N9N A;  2QIZ A;  5G04 B;  2DX8 A;  4LK9 A;  3ASL A;  4FK5 A;  2ZET C;  4FIP A;  2XEU A;  5TRB A;  4AYC B;  3N9M A;  3ZNI A;  1WGM A;  4N4F A;  3N9L A;  4QF2 A;  4QF3 A;  4MSX A;  4L7X A;  1LDJ B;  4WZ2 A;  5H1V A;  5LKZ A;  5H1U A;  3FL2 A;  2KR4 A;  2RSD A;  4LAD B;  3U5M A;  2Y1N A;  4ZUX U;  2MA6 A;  5KH3 A;  4O64 A;  2M6M A;  1WEN A;  4YC9 A;  4WZ0 A;  4ZQL A;  1WIL A;  3LQJ A;  2JMI A;  3QZV A;  3PUR A;  1X4U A;  4C9Z A;  3ZVZ B;  2M3H A;  3O7A A;  2KWK A;  2LGK A;  4XI1 A;  4ZDT A;  4AYC A;  4MVT A;  2L0B A;  3SOW A;  4I7C A;  1WEQ A;  4NN2 A;  4GB0 A;  1FP0 A;  1CHC A;  5B75 A;  2LQ6 A;  2NAA A;  5FB1 A;  1Z6U A;  2QJ0 A;  3U5P A;  3MHH A;  5TDW A;  5H9M A;  1FBV A;  2AN6 A;  3GL6 A;  4R7E A;  2PUY A;  2CSZ A;  4YAT A;  1Z60 A;  1VFY A;  3C5K A;  4UP0 A;  4L58 A;  2MA5 A;  3O70 A;  2JMJ A;  2LV9 A;  4YAD A;  2RI7 A;  2C2V S;  2KE1 A;  2VPB A;  4S3O C;  4AVX A;  1WEU A;  2IDA A;  5TAB A;  5FB0 A;  2ECI A;  2QIC A;  3RPG C;  2KGG A;  3O35 A;  2KIZ A;  3DPL R;  2YRE A;  5TDR A;  3LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...