5B76A

Crystal structure of moz double phd finger domain in complex with histone h3 crotonylation at k14
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
SLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 120
sequence length 120
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b76A00
2E6RA 3SHBA 4WZ3B 4YBSA 2G45A 2LV9A 2M3HA 2ECVA 4NN2A 2VJFA 5DKAA 2CSZA 4L58A 2VPGA 4C9ZA 3I2DA 3HCSA 3O35A 5D1KB 4S3OB 3ZPV1 4F52B 2VNFA 2CKLA 2ECTA 2XEUA 2K4DA 4N3WA 3C5KA 2BAYA 2LGGA 2K16A 2L75A 3U5OA 4P5OB 2KYUA 4YBTA 5TBNA 4WZ0A 2NAAA 4MVTA 2JRJA 4QF2A 2ECNA 5FERA 2YW8A 2YSMA 4PTBA 3N9QA 2EGPA 2EODA 4WZ2A 1K2FA 5D1MB 1VFYA 2E6SA 5KH9A 2HDPA 1WEMA 5LKZA 3U5PA 2MD8C 4FIPA 5B76A 1WEEA 4V3LC 3O70A 4GNEA 2RI7A 3RTRB 4AYCA 4AVXA 2VJFB 3L11A 2QJ0A 3NG2A 1VD4A 3ZVYA 3LRQA 4ZQLA 2YREA 2LQ6A 2FUUA 3SOUA 5LKXA 2YU4A 1WFKA 2KE1A 4CCGX 2C2VS 2MNZA 2CKLB 4A0CD 2KGIA 3KV6A 3M63A 2KR4A 3O33A 2L43A 2LXHC 1Z6UA 4UP0A 2YSJA 4LKAA 2L80A 2LGLA 4UI9B 1BORA 2MT5A 2YURA 1CHCA 4ZDTA 5C13A 1WENA 5AITA 2ECJA 3LQJA 3L1XA 3O7AA 1JM7A 4Q6FA 4R8PK 5LKUA 2LN0A 4ZUXU 2D8SA 1XWHA 3N9OA 2YHNA 4L7XA 2MNYA 2LGKA 1V87A 1U6GB 4UP5A 4V3KC 4AYCB 4LLBA 3HCUA 1WILA 2CT2A 1WEUA 4GB0A 4B86C 2VPEA 4R7EA 3V43A 1IYMA 4FK5A 2PNXA 2G43A 2KU3A 5B79A 2QICA 1WGMA 2KWOA 1X4UA 1T1HA 2KGGA 3FL2A 5FEYA 4FO9A 5D1LB 5B77A 3C6WA 3LQHA 1LDJB 5H9MA 4S3OC 2G6QA 1Z2QA 3LQIA 3M99A 4B7YC 1HYJA 1WEPA 2FSAA 1WIMA 5TRBA 5FB1A 4IC2A 3N9LA 1HYIA 2KWNA 3HTKC 2M1RA 3M62A 4WA6A 1JM7B 3RPGB 3O36A 3MHHA 4W4UA 3KQIA 4N4FA 2I50A 2LRIC 5JG6A 2F6JA 2M85A 2LXPC 2VJEA 2OXQC 4XI1A 1WE9A 2L0BA 2LGVA 4X3GA 2MD7B 5B78A 3PUQA 1ZBDB 3ZNIA 4BHWA 5H1TA 2YYRA 1F62A 4IC3A 1X4IA 5G04B 5KH3A 2KFTA 3ASLA 2JMJA 4YAXA 2JMIA 1WEVA 3ZTGA 4YATA 3DPLR 4GNFA 4LK9A 2MA6A 1WEQA 5TDWA 1WEOA 5G0FA 2FUIA 4QF3A 2UZGA 4GNGA 2ECIA 2KIZA 3VK6A 1N87A 5DINA 4BBQA 4PPEA 3ZYQA 5TABA 2AN6A 5H1UA 2MA5A 2C2LA 3N9MA 5I3LA 1Z60A 2HYED 1JOCA 4YBMA 3U5MA 2K17A 3O37A 2IDAA 2ECGA 1MM2A 4LADB 2Y1NA 2PUYA 5H1VA 2VPDA 1RMDA 3KNVA 3PURA 3PHDA 3T7LA 4O64A 3N9NA 5J3XA 4I7DA 2VJEB 5LKTA 2YQMA 5EYAF 3GL6A 1FBVA 5LCWB 3T6RA 3L1ZB 1MM3A 3DQVR 4AP4A 4A4CA 2VP7A 5FB0A 4A49A 2H0DA 2RSDA 2Y43A 3QZVA 2M6MA 3O34A 2QIZA 5KH7A 2EA6A 3EB5A 4AUQB 4TKPB 3KV5A 3ZPVE 4FJCA 4I7BA 2MUMA 4LJNA 2ECWA 1X4JA 2LDRA 2MIQA 2Y1MA 1FP0A 3SOWA 3IHPA 4YABA 3ZVZB 3HCTA 4YADA 4CA1A 2K1JA 4YC9A 2VPBA 5AIUA 3GV4A 1WEWA 3SOXA 1VYXA 2ZETC 4A4BA 2KWJA 2KREA 5B8DA 2DX8A 2F42A 2F6NA 2JMDA 5B75A 2KWKA 2YT5A 5TDRA 2L5UA 5C11A 2YQLA 4R2YA 2YHOA 1WESA 4GNDA 3MHSA 4MSXA 3N9PA 3U5NA 2XB1A 2YUCA 1G25A 5G05B 1DVPA 3RPGC 3EB6A 2CSYA 1LDKC 2H0DB 4I7CA 1E4UA
chains in the Genus database with same CATH superfamily
2RR4A 2E6RA 3SHBA 4WZ3B 4YBSA 2G45A 2LV9A 2M3HA 2ECVA 4NN2A 2VJFA 5DKAA 2CSZA 4L58A 2VPGA 4C9ZA 3I2DA 3HCSA 3O35A 5D1KB 3FANA 4S3OB 3ZPV1 5SVIA 4F52B 2VNFA 2CKLA 2XOCA 2ECTA 2XEUA 2K4DA 4N3WA 3C5KA 2BAYA 2LGGA 2K16A 2L75A 3U5OA 4P5OB 2KYUA 4YBTA 5TBNA 4WZ0A 3SUBA 2NAAA 4MVTA 2JRJA 4QF2A 2ECNA 5FERA 2YW8A 2YSMA 4PTBA 3N9QA 2EGPA 2EODA 5K3QA 4WZ2A 1K2FA 5D1MB 2JUNA 1VFYA 2E6SA 5KH9A 2HDPA 1WEMA 5LKZA 3U5PA 2B0OE 2MD8C 4FIPA 5B76A 1WEEA 2XP0A 4V3LC 3O70A 4GNEA 2RI7A 3RTRB 2M13A 4AYCA 4AVXA 2VJFB 3L11A 2QJ0A 3NG2A 2CRRA 1VD4A 3ZVYA 3LRQA 4ZQLA 2YREA 2LQ6A 2FUUA 3SOUA 5LKXA 2YU4A 3KDEC 3LVQE 3FJUB 5SVIB 1WFKA 2KE1A 4CCGX 2C2VS 2MNZA 2CKLB 4A0CD 2KGIA 3KV6A 3M63A 2KR4A 3O33A 2L43A 2LXHC 1Z6UA 4F1PA 2DSMA 4UP0A 2YSJA 2KKYA 4LKAA 2L80A 2LGLA 5SVXA 4UI9B 3LDYA 2D8UA 1BORA 2LAUA 2MT5A 2YURA 1CHCA 4ZDTA 3FM8C 5C13A 1WENA 2OWAA 5AITA 2ECJA 5SVYA 3LQJA 3L1XA 3O7AA 2L7PA 1JM7A 4Q6FA 4R8PK 5LKUA 2LN0A 4ZUXU 2EXUA 3E2DA 2D8SA 1XWHA 3N9OA 2YHNA 4L7XA 2MNYA 2LGKA 1V87A 1U6GB 4UP5A 3FAOA 2P57A 4V3KC 4AYCB 4LLBA 3O47A 3HCUA 1WILA 2CT2A 1WEUA 4GB0A 4B86C 2VPEA 4R7EA 3V43A 2EGMA 1IYMA 4FK5A 2PNXA 2G43A 2KU3A 5B79A 2QICA 1WGMA 2KWOA 1X4UA 3T9KA 1T1HA 2KGGA 3FL2A 5FEYA 4FO9A 5D1LB 5B77A 3C6WA 3DWDA 2E61A 3LQHA 1LDJB 5H9MA 2G6QA 3H7HA 1Z2QA 4S3OC 3FEHA 3LQIA 3M99A 3Q1DA 4B7YC 1HYJA 1WEPA 2FSAA 1WIMA 5TRBA 5FB1A 4IC2A 3N9LA 3LVRE 1HYIA 2KWNA 3HTKC 2M1RA 3M62A 4WA6A 3JUEA 1JM7B 3RPGB 3O36A 3MHHA 4W4UA 3KQIA 4N4FA 2I50A 2LRIC 5JG6A 3DDTA 2F6JA 2M85A 2LXPC 2VJEA 2FFWA 2OXQC 4XI1A 1WE9A 2L0BA 2LGVA 4X3GA 2MD7B 2CRWA 2DJAA 5B78A 4O62A 3PUQA 4Z0RA 1ZBDB 3ZNIA 4BHWA 5H1TA 2YYRA 1F62A 4IC3A 1X4IA 5G04B 5KH3A 2KFTA 3ASLA 2JMJA 4YAXA 2JMIA 1WEVA 3ZTGA 2FD4A 4YATA 3DPLR 4GNFA 4LK9A 4QQ4A 2MA6A 1WEQA 5TDWA 1WEOA 5G0FA 2FUIA 4QF3A 2UZGA 4GNGA 2ECIA 2KIZA 3VK6A 1N87A 5DINA 4BBQA 4PPEA 3ZYQA 5TABA 2AN6A 5H1UA 2MA5A 2C2LA 3N9MA 5I3LA 2XOZA 1Z60A 2HYED 1JOCA 4YBMA 3U5MA 2K17A 3O37A 2IDAA 2ECGA 1MBMA 1MM2A 2IQJA 4LADB 2Y1NA 2PUYA 5H1VA 2VPDA 1RMDA 3PURA 3KNVA 3PHDA 2KKXA 3T7LA 4O64A 3N9NA 5J3XA 4I7DA 2VJEB 5LKTA 2YQMA 5EYAF 3GL6A 1FBVA 5LCWB 4OGCA 3T6RA 3L1ZB 1MM3A 3DQVR 4AP4A 4A4CA 2VP7A 2CSVA 5FB0A 4A49A 2H0DA 2RSDA 2Y43A 3QZVA 2M6MA 3O34A 2QIZA 5KH7A 2EA6A 3EB5A 3PLWA 4AUQB 4TKPB 3KV5A 3ZPVE 4FJCA 1DCQA 4I7BA 4H9DA 2MUMA 4LJNA 2ECWA 1X4JA 3MDBC 2LDRA 2MIQA 2Y1MA 1FP0A 3SOWA 3IHPA 4YABA 3ZVZB 3HCTA 4YADA 4CA1A 2K1JA 4YC9A 2VPBA 5AIUA 3GV4A 1WEWA 3SOXA 1VYXA 2ZETC 4A4BA 2KWJA 2KREA 5B8DA 2DX8A 2F42A 2F6NA 2JMDA 2MKEA 5B75A 2KWKA 2YVRA 2YT5A 5TDRA 2L5UA 5C11A 4OGEA 2YQLA 4Z0OA 2CONA 4R2YA 2YHOA 1WESA 4GNDA 3MHSA 4MSXA 3M7KA 3N9PA 3U5NA 2XB1A 2YUCA 1G25A 5G05B 1DVPA 3LJUX 3RPGC 3EB6A 2CSYA 1LDKC 2XOYA 2H0DB 2JM3A 4I7CA 1E4UA
chains in the Genus database with same CATH topology
2E6RA 3SHBA 4WZ3B 4YBSA 2G45A 2LV9A 2M3HA 2ECVA 4NN2A 2VJFA 5DKAA 2CSZA 4L58A 2VPGA 4C9ZA 3I2DA 3HCSA 3O35A 5D1KB 4S3OB 3ZPV1 4F52B 2VNFA 2CKLA 2ECTA 2XEUA 2K4DA 4N3WA 3C5KA 2BAYA 2LGGA 2K16A 2L75A 3U5OA 4P5OB 2KYUA 4YBTA 5TBNA 4WZ0A 2NAAA 4MVTA 2JRJA 4QF2A 2ECNA 5FERA 2YW8A 2YSMA 4PTBA 3N9QA 2EGPA 2EODA 4WZ2A 1K2FA 5D1MB 1VFYA 2E6SA 5KH9A 2HDPA 1WEMA 5LKZA 3U5PA 2MD8C 4FIPA 5B76A 1WEEA 4V3LC 3O70A 4GNEA 2RI7A 3RTRB 4AYCA 4AVXA 2VJFB 3L11A 2QJ0A 3NG2A 1VD4A 3ZVYA 3LRQA 4ZQLA 2YREA 2LQ6A 2FUUA 3SOUA 5LKXA 2YU4A 1WFKA 2KE1A 4CCGX 2C2VS 2MNZA 2CKLB 4A0CD 2KGIA 3KV6A 3M63A 2KR4A 3O33A 2L43A 2LXHC 1Z6UA 4UP0A 2YSJA 4LKAA 2L80A 2LGLA 4UI9B 1BORA 2MT5A 2YURA 1CHCA 4ZDTA 5C13A 1WENA 5AITA 2ECJA 3LQJA 3L1XA 3O7AA 1JM7A 4Q6FA 4R8PK 5LKUA 2LN0A 4ZUXU 2D8SA 1XWHA 3N9OA 2YHNA 4L7XA 2MNYA 2LGKA 1V87A 1U6GB 4UP5A 4V3KC 4AYCB 4LLBA 3HCUA 1WILA 2CT2A 1WEUA 4GB0A 4B86C 2VPEA 4R7EA 3V43A 1IYMA 4FK5A 2PNXA 2G43A 2KU3A 5B79A 2QICA 1WGMA 2KWOA 1X4UA 1T1HA 2KGGA 3FL2A 5FEYA 4FO9A 5D1LB 5B77A 3C6WA 3LQHA 1LDJB 5H9MA 4S3OC 2G6QA 1Z2QA 3LQIA 3M99A 4B7YC 1HYJA 1WEPA 2FSAA 1WIMA 5TRBA 5FB1A 4IC2A 3N9LA 1HYIA 2KWNA 3HTKC 2M1RA 3M62A 4WA6A 1JM7B 3RPGB 3O36A 3MHHA 4W4UA 3KQIA 4N4FA 2I50A 2LRIC 5JG6A 2F6JA 2M85A 2LXPC 2VJEA 2OXQC 4XI1A 1WE9A 2L0BA 2LGVA 4X3GA 2MD7B 5B78A 3PUQA 1ZBDB 3ZNIA 4BHWA 5H1TA 2YYRA 1F62A 4IC3A 1X4IA 5G04B 5KH3A 2KFTA 3ASLA 2JMJA 4YAXA 2JMIA 1WEVA 3ZTGA 4YATA 3DPLR 4GNFA 4LK9A 2MA6A 1WEQA 5TDWA 1WEOA 5G0FA 2FUIA 4QF3A 2UZGA 4GNGA 2ECIA 2KIZA 3VK6A 1N87A 5DINA 4BBQA 4PPEA 3ZYQA 5TABA 2AN6A 5H1UA 2MA5A 2C2LA 3N9MA 5I3LA 1Z60A 2HYED 1JOCA 4YBMA 3U5MA 2K17A 3O37A 2IDAA 2ECGA 1MM2A 4LADB 2Y1NA 2PUYA 5H1VA 2VPDA 1RMDA 3KNVA 3PURA 3PHDA 3T7LA 4O64A 3N9NA 5J3XA 4I7DA 2VJEB 5LKTA 2YQMA 5EYAF 3GL6A 1FBVA 5LCWB 3T6RA 3L1ZB 1MM3A 3DQVR 4AP4A 4A4CA 2VP7A 5FB0A 4A49A 2H0DA 2RSDA 2Y43A 3QZVA 2M6MA 3O34A 2QIZA 5KH7A 2EA6A 3EB5A 4AUQB 4TKPB 3KV5A 3ZPVE 4FJCA 4I7BA 2MUMA 4LJNA 2ECWA 1X4JA 2LDRA 2MIQA 2Y1MA 1FP0A 3SOWA 3IHPA 4YABA 3ZVZB 3HCTA 4YADA 4CA1A 2K1JA 4YC9A 2VPBA 5AIUA 3GV4A 1WEWA 3SOXA 1VYXA 2ZETC 4A4BA 2KWJA 2KREA 5B8DA 2DX8A 2F42A 2F6NA 2JMDA 5B75A 2KWKA 2YT5A 5TDRA 2L5UA 5C11A 2YQLA 4R2YA 2YHOA 1WESA 4GNDA 3MHSA 4MSXA 3N9PA 3U5NA 2XB1A 2YUCA 1G25A 5G05B 1DVPA 3RPGC 3EB6A 2CSYA 1LDKC 2H0DB 4I7CA 1E4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6R A;  3SHB A;  4WZ3 B;  4YBS A;  2G45 A;  2LV9 A;  2M3H A;  2ECV A;  4NN2 A;  2VJF A;  5DKA A;  2CSZ A;  4L58 A;  2VPG A;  4C9Z A;  3I2D A;  3HCS A;  3O35 A;  5D1K B;  4S3O B;  3ZPV 1;  4F52 B;  2VNF A;  2CKL A;  2ECT A;  2XEU A;  2K4D A;  4N3W A;  3C5K A;  2BAY A;  2LGG A;  2K16 A;  2L75 A;  3U5O A;  4P5O B;  2KYU A;  4YBT A;  5TBN A;  4WZ0 A;  2NAA A;  4MVT A;  2JRJ A;  4QF2 A;  2ECN A;  5FER A;  2YW8 A;  2YSM A;  4PTB A;  3N9Q A;  2EGP A;  2EOD A;  4WZ2 A;  1K2F A;  5D1M B;  1VFY A;  2E6S A;  5KH9 A;  2HDP A;  1WEM A;  5LKZ A;  3U5P A;  2MD8 C;  4FIP A;  5B76 A;  1WEE A;  4V3L C;  3O70 A;  4GNE A;  2RI7 A;  3RTR B;  4AYC A;  4AVX A;  2VJF B;  3L11 A;  2QJ0 A;  3NG2 A;  1VD4 A;  3ZVY A;  3LRQ A;  4ZQL A;  2YRE A;  2LQ6 A;  2FUU A;  3SOU A;  5LKX A;  2YU4 A;  1WFK A;  2KE1 A;  4CCG X;  2C2V S;  2MNZ A;  2CKL B;  4A0C D;  2KGI A;  3KV6 A;  3M63 A;  2KR4 A;  3O33 A;  2L43 A;  2LXH C;  1Z6U A;  4UP0 A;  2YSJ A;  4LKA A;  2L80 A;  2LGL A;  4UI9 B;  1BOR A;  2MT5 A;  2YUR A;  1CHC A;  4ZDT A;  5C13 A;  1WEN A;  5AIT A;  2ECJ A;  3LQJ A;  3L1X A;  3O7A A;  1JM7 A;  4Q6F A;  4R8P K;  5LKU A;  2LN0 A;  4ZUX U;  2D8S A;  1XWH A;  3N9O A;  2YHN A;  4L7X A;  2MNY A;  2LGK A;  1V87 A;  1U6G B;  4UP5 A;  4V3K C;  4AYC B;  4LLB A;  3HCU A;  1WIL A;  2CT2 A;  1WEU A;  4GB0 A;  4B86 C;  2VPE A;  4R7E A;  3V43 A;  1IYM A;  4FK5 A;  2PNX A;  2G43 A;  2KU3 A;  5B79 A;  2QIC A;  1WGM A;  2KWO A;  1X4U A;  1T1H A;  2KGG A;  3FL2 A;  5FEY A;  4FO9 A;  5D1L B;  5B77 A;  3C6W A;  3LQH A;  1LDJ B;  5H9M A;  4S3O C;  2G6Q A;  1Z2Q A;  3LQI A;  3M99 A;  4B7Y C;  1HYJ A;  1WEP A;  2FSA A;  1WIM A;  5TRB A;  5FB1 A;  4IC2 A;  3N9L A;  1HYI A;  2KWN A;  3HTK C;  2M1R A;  3M62 A;  4WA6 A;  1JM7 B;  3RPG B;  3O36 A;  3MHH A;  4W4U A;  3KQI A;  4N4F A;  2I50 A;  2LRI C;  5JG6 A;  2F6J A;  2M85 A;  2LXP C;  2VJE A;  2OXQ C;  4XI1 A;  1WE9 A;  2L0B A;  2LGV A;  4X3G A;  2MD7 B;  5B78 A;  3PUQ A;  1ZBD B;  3ZNI A;  4BHW A;  5H1T A;  2YYR A;  1F62 A;  4IC3 A;  1X4I A;  5G04 B;  5KH3 A;  2KFT A;  3ASL A;  2JMJ A;  4YAX A;  2JMI A;  1WEV A;  3ZTG A;  4YAT A;  3DPL R;  4GNF A;  4LK9 A;  2MA6 A;  1WEQ A;  5TDW A;  1WEO A;  5G0F A;  2FUI A;  4QF3 A;  2UZG A;  4GNG A;  2ECI A;  2KIZ A;  3VK6 A;  1N87 A;  5DIN A;  4BBQ A;  4PPE A;  3ZYQ A;  5TAB A;  2AN6 A;  5H1U A;  2MA5 A;  2C2L A;  3N9M A;  5I3L A;  1Z60 A;  2HYE D;  1JOC A;  4YBM A;  3U5M A;  2K17 A;  3O37 A;  2IDA A;  2ECG A;  1MM2 A;  4LAD B;  2Y1N A;  2PUY A;  5H1V A;  2VPD A;  1RMD A;  3KNV A;  3PUR A;  3PHD A;  3T7L A;  4O64 A;  3N9N A;  5J3X A;  4I7D A;  2VJE B;  5LKT A;  2YQM A;  5EYA F;  3GL6 A;  1FBV A;  5LCW B;  3T6R A;  3L1Z B;  1MM3 A;  3DQV R;  4AP4 A;  4A4C A;  2VP7 A;  5FB0 A;  4A49 A;  2H0D A;  2RSD A;  2Y43 A;  3QZV A;  2M6M A;  3O34 A;  2QIZ A;  5KH7 A;  2EA6 A;  3EB5 A;  4AUQ B;  4TKP B;  3KV5 A;  3ZPV E;  4FJC A;  4I7B A;  2MUM A;  4LJN A;  2ECW A;  1X4J A;  2LDR A;  2MIQ A;  2Y1M A;  1FP0 A;  3SOW A;  3IHP A;  4YAB A;  3ZVZ B;  3HCT A;  4YAD A;  4CA1 A;  2K1J A;  4YC9 A;  2VPB A;  5AIU A;  3GV4 A;  1WEW A;  3SOX A;  1VYX A;  2ZET C;  4A4B A;  2KWJ A;  2KRE A;  5B8D A;  2DX8 A;  2F42 A;  2F6N A;  2JMD A;  5B75 A;  2KWK A;  2YT5 A;  5TDR A;  2L5U A;  5C11 A;  2YQL A;  4R2Y A;  2YHO A;  1WES A;  4GND A;  3MHS A;  4MSX A;  3N9P A;  3U5N A;  2XB1 A;  2YUC A;  1G25 A;  5G05 B;  1DVP A;  3RPG C;  3EB6 A;  2CSY A;  1LDK C;  2H0D B;  4I7C A;  1E4U A; 
#chains in the Genus database with same CATH topology
 2RR4 A;  2E6R A;  3SHB A;  4WZ3 B;  4YBS A;  2G45 A;  2LV9 A;  2M3H A;  2ECV A;  4NN2 A;  2VJF A;  5DKA A;  2CSZ A;  4L58 A;  2VPG A;  4C9Z A;  3I2D A;  3HCS A;  3O35 A;  5D1K B;  3FAN A;  4S3O B;  3ZPV 1;  5SVI A;  4F52 B;  2VNF A;  2CKL A;  2XOC A;  2ECT A;  2XEU A;  2K4D A;  4N3W A;  3C5K A;  2BAY A;  2LGG A;  2K16 A;  2L75 A;  3U5O A;  4P5O B;  2KYU A;  4YBT A;  5TBN A;  4WZ0 A;  3SUB A;  2NAA A;  4MVT A;  2JRJ A;  4QF2 A;  2ECN A;  5FER A;  2YW8 A;  2YSM A;  4PTB A;  3N9Q A;  2EGP A;  2EOD A;  5K3Q A;  4WZ2 A;  1K2F A;  5D1M B;  2JUN A;  1VFY A;  2E6S A;  5KH9 A;  2HDP A;  1WEM A;  5LKZ A;  3U5P A;  2B0O E;  2MD8 C;  4FIP A;  5B76 A;  1WEE A;  2XP0 A;  4V3L C;  3O70 A;  4GNE A;  2RI7 A;  3RTR B;  2M13 A;  4AYC A;  4AVX A;  2VJF B;  3L11 A;  2QJ0 A;  3NG2 A;  2CRR A;  1VD4 A;  3ZVY A;  3LRQ A;  4ZQL A;  2YRE A;  2LQ6 A;  2FUU A;  3SOU A;  5LKX A;  2YU4 A;  3KDE C;  3LVQ E;  3FJU B;  5SVI B;  1WFK A;  2KE1 A;  4CCG X;  2C2V S;  2MNZ A;  2CKL B;  4A0C D;  2KGI A;  3KV6 A;  3M63 A;  2KR4 A;  3O33 A;  2L43 A;  2LXH C;  1Z6U A;  4F1P A;  2DSM A;  4UP0 A;  2YSJ A;  2KKY A;  4LKA A;  2L80 A;  2LGL A;  5SVX A;  4UI9 B;  3LDY A;  2D8U A;  1BOR A;  2LAU A;  2MT5 A;  2YUR A;  1CHC A;  4ZDT A;  3FM8 C;  5C13 A;  1WEN A;  2OWA A;  5AIT A;  2ECJ A;  5SVY A;  3LQJ A;  3L1X A;  3O7A A;  2L7P A;  1JM7 A;  4Q6F A;  4R8P K;  5LKU A;  2LN0 A;  4ZUX U;  2EXU A;  3E2D A;  2D8S A;  1XWH A;  3N9O A;  2YHN A;  4L7X A;  2MNY A;  2LGK A;  1V87 A;  1U6G B;  4UP5 A;  3FAO A;  2P57 A;  4V3K C;  4AYC B;  4LLB A;  3O47 A;  3HCU A;  1WIL A;  2CT2 A;  1WEU A;  4GB0 A;  4B86 C;  2VPE A;  4R7E A;  3V43 A;  2EGM A;  1IYM A;  4FK5 A;  2PNX A;  2G43 A;  2KU3 A;  5B79 A;  2QIC A;  1WGM A;  2KWO A;  1X4U A;  3T9K A;  1T1H A;  2KGG A;  3FL2 A;  5FEY A;  4FO9 A;  5D1L B;  5B77 A;  3C6W A;  3DWD A;  2E61 A;  3LQH A;  1LDJ B;  5H9M A;  2G6Q A;  3H7H A;  1Z2Q A;  4S3O C;  3FEH A;  3LQI A;  3M99 A;  3Q1D A;  4B7Y C;  1HYJ A;  1WEP A;  2FSA A;  1WIM A;  5TRB A;  5FB1 A;  4IC2 A;  3N9L A;  3LVR E;  1HYI A;  2KWN A;  3HTK C;  2M1R A;  3M62 A;  4WA6 A;  3JUE A;  1JM7 B;  3RPG B;  3O36 A;  3MHH A;  4W4U A;  3KQI A;  4N4F A;  2I50 A;  2LRI C;  5JG6 A;  3DDT A;  2F6J A;  2M85 A;  2LXP C;  2VJE A;  2FFW A;  2OXQ C;  4XI1 A;  1WE9 A;  2L0B A;  2LGV A;  4X3G A;  2MD7 B;  2CRW A;  2DJA A;  5B78 A;  4O62 A;  3PUQ A;  4Z0R A;  1ZBD B;  3ZNI A;  4BHW A;  5H1T A;  2YYR A;  1F62 A;  4IC3 A;  1X4I A;  5G04 B;  5KH3 A;  2KFT A;  3ASL A;  2JMJ A;  4YAX A;  2JMI A;  1WEV A;  3ZTG A;  2FD4 A;  4YAT A;  3DPL R;  4GNF A;  4LK9 A;  4QQ4 A;  2MA6 A;  1WEQ A;  5TDW A;  1WEO A;  5G0F A;  2FUI A;  4QF3 A;  2UZG A;  4GNG A;  2ECI A;  2KIZ A;  3VK6 A;  1N87 A;  5DIN A;  4BBQ A;  4PPE A;  3ZYQ A;  5TAB A;  2AN6 A;  5H1U A;  2MA5 A;  2C2L A;  3N9M A;  5I3L A;  2XOZ A;  1Z60 A;  2HYE D;  1JOC A;  4YBM A;  3U5M A;  2K17 A;  3O37 A;  2IDA A;  2ECG A;  1MBM A;  1MM2 A;  2IQJ A;  4LAD B;  2Y1N A;  2PUY A;  5H1V A;  2VPD A;  1RMD A;  3PUR A;  3KNV A;  3PHD A;  2KKX A;  3T7L A;  4O64 A;  3N9N A;  5J3X A;  4I7D A;  2VJE B;  5LKT A;  2YQM A;  5EYA F;  3GL6 A;  1FBV A;  5LCW B;  4OGC A;  3T6R A;  3L1Z B;  1MM3 A;  3DQV R;  4AP4 A;  4A4C A;  2VP7 A;  2CSV A;  5FB0 A;  4A49 A;  2H0D A;  2RSD A;  2Y43 A;  3QZV A;  2M6M A;  3O34 A;  2QIZ A;  5KH7 A;  2EA6 A;  3EB5 A;  3PLW A;  4AUQ B;  4TKP B;  3KV5 A;  3ZPV E;  4FJC A;  1DCQ A;  4I7B A;  4H9D A;  2MUM A;  4LJN A;  2ECW A;  1X4J A;  3MDB C;  2LDR A;  2MIQ A;  2Y1M A;  1FP0 A;  3SOW A;  3IHP A;  4YAB A;  3ZVZ B;  3HCT A;  4YAD A;  4CA1 A;  2K1J A;  4YC9 A;  2VPB A;  5AIU A;  3GV4 A;  1WEW A;  3SOX A;  1VYX A;  2ZET C;  4A4B A;  2KWJ A;  2KRE A;  5B8D A;  2DX8 A;  2F42 A;  2F6N A;  2JMD A;  2MKE A;  5B75 A;  2KWK A;  2YVR A;  2YT5 A;  5TDR A;  2L5U A;  5C11 A;  4OGE A;  2YQL A;  4Z0O A;  2CON A;  4R2Y A;  2YHO A;  1WES A;  4GND A;  3MHS A;  4MSX A;  3M7K A;  3N9P A;  3U5N A;  2XB1 A;  2YUC A;  1G25 A;  5G05 B;  1DVP A;  3LJU X;  3RPG C;  3EB6 A;  2CSY A;  1LDK C;  2XOY A;  2H0D B;  2JM3 A;  4I7C A;  1E4U A; 
#chains in the Genus database with same CATH homology
 2E6R A;  3SHB A;  4WZ3 B;  4YBS A;  2G45 A;  2LV9 A;  2M3H A;  2ECV A;  4NN2 A;  2VJF A;  5DKA A;  2CSZ A;  4L58 A;  2VPG A;  4C9Z A;  3I2D A;  3HCS A;  3O35 A;  5D1K B;  4S3O B;  3ZPV 1;  4F52 B;  2VNF A;  2CKL A;  2ECT A;  2XEU A;  2K4D A;  4N3W A;  3C5K A;  2BAY A;  2LGG A;  2K16 A;  2L75 A;  3U5O A;  4P5O B;  2KYU A;  4YBT A;  5TBN A;  4WZ0 A;  2NAA A;  4MVT A;  2JRJ A;  4QF2 A;  2ECN A;  5FER A;  2YW8 A;  2YSM A;  4PTB A;  3N9Q A;  2EGP A;  2EOD A;  4WZ2 A;  1K2F A;  5D1M B;  1VFY A;  2E6S A;  5KH9 A;  2HDP A;  1WEM A;  5LKZ A;  3U5P A;  2MD8 C;  4FIP A;  5B76 A;  1WEE A;  4V3L C;  3O70 A;  4GNE A;  2RI7 A;  3RTR B;  4AYC A;  4AVX A;  2VJF B;  3L11 A;  2QJ0 A;  3NG2 A;  1VD4 A;  3ZVY A;  3LRQ A;  4ZQL A;  2YRE A;  2LQ6 A;  2FUU A;  3SOU A;  5LKX A;  2YU4 A;  1WFK A;  2KE1 A;  4CCG X;  2C2V S;  2MNZ A;  2CKL B;  4A0C D;  2KGI A;  3KV6 A;  3M63 A;  2KR4 A;  3O33 A;  2L43 A;  2LXH C;  1Z6U A;  4UP0 A;  2YSJ A;  4LKA A;  2L80 A;  2LGL A;  4UI9 B;  1BOR A;  2MT5 A;  2YUR A;  1CHC A;  4ZDT A;  5C13 A;  1WEN A;  5AIT A;  2ECJ A;  3LQJ A;  3L1X A;  3O7A A;  1JM7 A;  4Q6F A;  4R8P K;  5LKU A;  2LN0 A;  4ZUX U;  2D8S A;  1XWH A;  3N9O A;  2YHN A;  4L7X A;  2MNY A;  2LGK A;  1V87 A;  1U6G B;  4UP5 A;  4V3K C;  4AYC B;  4LLB A;  3HCU A;  1WIL A;  2CT2 A;  1WEU A;  4GB0 A;  4B86 C;  2VPE A;  4R7E A;  3V43 A;  1IYM A;  4FK5 A;  2PNX A;  2G43 A;  2KU3 A;  5B79 A;  2QIC A;  1WGM A;  2KWO A;  1X4U A;  1T1H A;  2KGG A;  3FL2 A;  5FEY A;  4FO9 A;  5D1L B;  5B77 A;  3C6W A;  3LQH A;  1LDJ B;  5H9M A;  4S3O C;  2G6Q A;  1Z2Q A;  3LQI A;  3M99 A;  4B7Y C;  1HYJ A;  1WEP A;  2FSA A;  1WIM A;  5TRB A;  5FB1 A;  4IC2 A;  3N9L A;  1HYI A;  2KWN A;  3HTK C;  2M1R A;  3M62 A;  4WA6 A;  1JM7 B;  3RPG B;  3O36 A;  3MHH A;  4W4U A;  3KQI A;  4N4F A;  2I50 A;  2LRI C;  5JG6 A;  2F6J A;  2M85 A;  2LXP C;  2VJE A;  2OXQ C;  4XI1 A;  1WE9 A;  2L0B A;  2LGV A;  4X3G A;  2MD7 B;  5B78 A;  3PUQ A;  1ZBD B;  3ZNI A;  4BHW A;  5H1T A;  2YYR A;  1F62 A;  4IC3 A;  1X4I A;  5G04 B;  5KH3 A;  2KFT A;  3ASL A;  2JMJ A;  4YAX A;  2JMI A;  1WEV A;  3ZTG A;  4YAT A;  3DPL R;  4GNF A;  4LK9 A;  2MA6 A;  1WEQ A;  5TDW A;  1WEO A;  5G0F A;  2FUI A;  4QF3 A;  2UZG A;  4GNG A;  2ECI A;  2KIZ A;  3VK6 A;  1N87 A;  5DIN A;  4BBQ A;  4PPE A;  3ZYQ A;  5TAB A;  2AN6 A;  5H1U A;  2MA5 A;  2C2L A;  3N9M A;  5I3L A;  1Z60 A;  2HYE D;  1JOC A;  4YBM A;  3U5M A;  2K17 A;  3O37 A;  2IDA A;  2ECG A;  1MM2 A;  4LAD B;  2Y1N A;  2PUY A;  5H1V A;  2VPD A;  1RMD A;  3KNV A;  3PUR A;  3PHD A;  3T7L A;  4O64 A;  3N9N A;  5J3X A;  4I7D A;  2VJE B;  5LKT A;  2YQM A;  5EYA F;  3GL6 A;  1FBV A;  5LCW B;  3T6R A;  3L1Z B;  1MM3 A;  3DQV R;  4AP4 A;  4A4C A;  2VP7 A;  5FB0 A;  4A49 A;  2H0D A;  2RSD A;  2Y43 A;  3QZV A;  2M6M A;  3O34 A;  2QIZ A;  5KH7 A;  2EA6 A;  3EB5 A;  4AUQ B;  4TKP B;  3KV5 A;  3ZPV E;  4FJC A;  4I7B A;  2MUM A;  4LJN A;  2ECW A;  1X4J A;  2LDR A;  2MIQ A;  2Y1M A;  1FP0 A;  3SOW A;  3IHP A;  4YAB A;  3ZVZ B;  3HCT A;  4YAD A;  4CA1 A;  2K1J A;  4YC9 A;  2VPB A;  5AIU A;  3GV4 A;  1WEW A;  3SOX A;  1VYX A;  2ZET C;  4A4B A;  2KWJ A;  2KRE A;  5B8D A;  2DX8 A;  2F42 A;  2F6N A;  2JMD A;  5B75 A;  2KWK A;  2YT5 A;  5TDR A;  2L5U A;  5C11 A;  2YQL A;  4R2Y A;  2YHO A;  1WES A;  4GND A;  3MHS A;  4MSX A;  3N9P A;  3U5N A;  2XB1 A;  2YUC A;  1G25 A;  5G05 B;  1DVP A;  3RPG C;  3EB6 A;  2CSY A;  1LDK C;  2H0D B;  4I7C A;  1E4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...