5AITA

A complex of of rnf4-ring domain, ubev2, ubc13-ub (isopeptide crosslink)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
129
structure length
129
Chain Sequence
SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYIGSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF4
publication title Structural Basis for the Ring Catalyzed Synthesis of K63 Linked Ubiquitin Chains
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 129
sequence length 129
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5aitA00
4O64A 4UP5A 4WZ3B 2F42A 1Z6UA 3KNVA 4LK9A 3U5MA 5H1TA 2KFTA 1RMDA 2G45A 3O35A 2EGPA 3M62A 5KH7A 3IHPA 2YU4A 1X4IA 4MVTA 2K17A 2Y1NA 4YC9A 2LGLA 1JM7B 4TKPB 2YURA 2KR4A 3HCUA 1XWHA 3RTRB 3VK6A 4F52B 2HYED 3PURA 4QF3A 2YSJA 1ZBDB 4AP4A 5H1VA 1MM2A 4PTBA 2LN0A 4FJCA 2MNZA 2RSDA 1Z2QA 4L7XA 2VJFA 2KU3A 5FEYA 5B77A 2VJEA 1HYJA 2CSYA 2LRIC 5D1KB 2MA6A 2FUUA 5B76A 1IYMA 2KWNA 2F6NA 2QJ0A 4V3KC 3KV6A 5AITA 5FB1A 2L43A 1JOCA 1WEVA 5KH9A 5LKZA 2CKLB 4YABA 1WEPA 2MUMA 4FIPA 4R7EA 1HYIA 2Y1MA 3U5PA 4WA6A 2ECTA 2MA5A 3PUQA 3O36A 4ZUXU 2MIQA 3NG2A 1MM3A 2FSAA 1VD4A 5B8DA 1FP0A 3O70A 2VPEA 4YATA 3ZVZB 4L58A 2PNXA 2LV9A 1WEOA 2JMIA 2CT2A 5AIUA 2L0BA 2LXHC 2ECWA 4YBTA 2KE1A 2KGGA 4GNEA 2G6QA 4C9ZA 5JG6A 2VPDA 3FL2A 4LKAA 4GNDA 3L1ZB 1WEEA 2M3HA 4A49A 5TBNA 4ZDTA 1WIMA 1T1HA 2MD7B 2KGIA 2Y43A 4AYCB 3N9LA 5D1MB 1WEUA 4YAXA 5TDRA 3HCTA 3N9NA 3SOXA 3O37A 2LXPC 5EYAF 2YYRA 4WZ0A 4BBQA 4CA1A 3N9QA 2QIZA 2CSZA 1E4UA 1WGMA 1WENA 4B86C 4AUQB 2LGKA 5DINA 4I7CA 3ZTGA 4W4UA 2K1JA 3GV4A 1LDJB 2VP7A 1JM7A 3T7LA 4AYCA 3M63A 2VPGA 2K4DA 2YQMA 2JRJA 2C2LA 5D1LB 1Z60A 2C2VS 4B7YC 5DKAA 5H1UA 3HTKC 3L11A 5H9MA 5TRBA 2H0DB 3MHHA 2L80A 1V87A 1BORA 2AN6A 2YUCA 4LADB 4PPEA 2E6RA 3MHSA 3C6WA 3EB6A 2EA6A 2VPBA 1WEQA 3LQIA 1X4JA 5G0FA 5C13A 1VFYA 3GL6A 5C11A 2UZGA 2LQ6A 3ASLA 1WILA 4CCGX 2KWJA 4N4FA 4YBMA 4S3OB 2MD8C 3ZNIA 2YREA 1G25A 2CKLA 4IC3A 3PHDA 2JMDA 3O34A 4V3LC 4Q6FA 4LJNA 2ECIA 2L75A 3L1XA 2ECVA 3V43A 2LGGA 1WESA 4WZ2A 1VYXA 2EODA 5G05B 2IDAA 2QICA 1LDKC 4A0CD 2KYUA 3N9OA 4X3GA 2M6MA 4YBSA 5KH3A 2I50A 2ECJA 3KQIA 2KREA 5LCWB 4XI1A 3T6RA 4I7BA 2D8SA 4NN2A 3M99A 4QF2A 4UI9B 2MNYA 2VJFB 4AVXA 4FK5A 2G43A 3LRQA 2F6JA 3C5KA 1WFKA 5FB0A 2VJEB 2MT5A 5B75A 4S3OC 3O33A 1WEWA 3HCSA 1WE9A 3SHBA 2KWKA 4YADA 2M1RA 2PUYA 1N87A 5B79A 3U5NA 1DVPA 1X4UA 2LDRA 3DQVR 1FBVA 5FERA 5I3LA 4UP0A 2L5UA 4I7DA 5TABA 4GB0A 5G04B 2FUIA 3EB5A 2BAYA 3RPGB 2XB1A 2ECGA 3SOWA 1F62A 2YHOA 4R8PK 1CHCA 4MSXA 4GNFA 3I2DA 3ZPV1 4P5OB 3KV5A 5LKTA 2ECNA 5LKUA 3N9MA 3ZYQA 2YQLA 2NAAA 3LQHA 4IC2A 3LQJA 5J3XA 4LLBA 2KWOA 5B78A 2YHNA 3DPLR 4A4CA 2M85A 4FO9A 3ZVYA 5TDWA 1WEMA 4BHWA 2HDPA 3O7AA 3N9PA 2KIZA 1K2FA 2OXQC 3QZVA 2DX8A 4A4BA 2YSMA 2XEUA 3U5OA 2E6SA 4R2YA 2H0DA 1U6GB 4GNGA 2RI7A 3SOUA 2K16A 5LKXA 2ZETC 4N3WA 3RPGC 2JMJA 2YT5A 4ZQLA 3ZPVE 2LGVA 2VNFA 2YW8A
chains in the Genus database with same CATH superfamily
4O64A 4UP5A 4WZ3B 2F42A 1Z6UA 3KNVA 4LK9A 3U5MA 5H1TA 2KFTA 1RMDA 2G45A 3O35A 2EGPA 2CRRA 3M62A 5KH7A 3IHPA 2YU4A 1X4IA 4MVTA 2K17A 2Y1NA 4YC9A 2EXUA 2LGLA 1JM7B 4TKPB 2YURA 2KR4A 3HCUA 1XWHA 3RTRB 3VK6A 4F52B 2HYED 3PURA 4QF3A 2YSJA 1ZBDB 4AP4A 5H1VA 1MM2A 4PTBA 2LN0A 4FJCA 2MNZA 2RSDA 1Z2QA 4L7XA 2VJFA 2KU3A 5FEYA 5B77A 2VJEA 1HYJA 3KDEC 2CSYA 2LRIC 5D1KB 2MA6A 2FUUA 5B76A 1IYMA 2KWNA 2F6NA 2QJ0A 4V3KC 3KV6A 5AITA 5FB1A 2L43A 3LVQE 2IQJA 1JOCA 1WEVA 5KH9A 5LKZA 2M13A 2CKLB 4YABA 1WEPA 2MUMA 4FIPA 4R7EA 1HYIA 2Y1MA 3U5PA 4WA6A 5SVIA 2ECTA 2MA5A 3PUQA 3O36A 2XP0A 4ZUXU 2MIQA 3NG2A 1MM3A 2RR4A 2FSAA 1VD4A 2FD4A 5B8DA 1FP0A 1MBMA 3O70A 2VPEA 3FANA 4YATA 3ZVZB 4L58A 2PNXA 2LV9A 1WEOA 2JMIA 2CT2A 5AIUA 2EGMA 2L0BA 2LXHC 2ECWA 4YBTA 2KE1A 2KGGA 3M7KA 4GNEA 2G6QA 4C9ZA 5JG6A 2VPDA 3FL2A 3MDBC 4LKAA 4GNDA 3L1ZB 1WEEA 2CONA 2M3HA 4A49A 5TBNA 4ZDTA 1WIMA 1T1HA 2MD7B 2KGIA 2Y43A 5SVXA 4AYCB 3N9LA 5D1MB 1WEUA 4YAXA 5TDRA 3DWDA 2DSMA 4H9DA 3HCTA 2B0OE 3N9NA 3SOXA 3O37A 2CSVA 2LXPC 5EYAF 2YYRA 4WZ0A 4BBQA 4CA1A 2XOYA 3N9QA 2QIZA 2CSZA 1E4UA 1WGMA 1WENA 4B86C 4AUQB 2LGKA 5DINA 4I7CA 3ZTGA 4W4UA 2K1JA 2DJAA 3GV4A 1LDJB 2VP7A 1JM7A 3T7LA 4AYCA 3M63A 2VPGA 2K4DA 2YQMA 2JRJA 2C2LA 5D1LB 1Z60A 2C2VS 2E61A 4B7YC 3FEHA 5DKAA 5H1UA 3HTKC 3L11A 4Z0OA 5H9MA 5TRBA 2H0DB 3MHHA 4OGCA 2YVRA 2L80A 1V87A 1BORA 2AN6A 2CRWA 2YUCA 4LADB 4PPEA 3T9KA 2E6RA 3MHSA 3C6WA 3EB6A 2P57A 2EA6A 2VPBA 2KKYA 3LVRE 1WEQA 3LQIA 3FM8C 1X4JA 5G0FA 5C13A 1VFYA 3E2DA 3GL6A 2UZGA 5C11A 2LQ6A 3ASLA 3SUBA 1WILA 4CCGX 4O62A 2KWJA 4N4FA 4YBMA 4S3OB 2MD8C 3ZNIA 3DDTA 2YREA 1G25A 2CKLA 4IC3A 3PHDA 4F1PA 2JMDA 3O34A 4V3LC 4Q6FA 4LJNA 3PLWA 2ECIA 4Z0RA 2L75A 3L1XA 2ECVA 3V43A 2LGGA 1WESA 4WZ2A 1VYXA 2EODA 3O47A 5G05B 2IDAA 2QICA 1LDKC 2FFWA 2OWAA 2XOCA 4A0CD 2KYUA 3N9OA 3FAOA 4X3GA 2M6MA 4YBSA 5KH3A 2I50A 2ECJA 3KQIA 2KREA 5LCWB 4XI1A 3T6RA 2JUNA 4I7BA 2D8SA 4NN2A 3M99A 4QF2A 4UI9B 2MNYA 1DCQA 2VJFB 4AVXA 4FK5A 2G43A 3LRQA 2F6JA 3C5KA 1WFKA 5FB0A 2VJEB 2MT5A 5B75A 2XOZA 4S3OC 3O33A 3Q1DA 1WEWA 3HCSA 3LDYA 1WE9A 3SHBA 2KWKA 4YADA 2M1RA 5SVYA 2PUYA 1N87A 5B79A 3U5NA 1DVPA 1X4UA 2LDRA 3DQVR 1FBVA 5FERA 5I3LA 4UP0A 2L5UA 4I7DA 5TABA 4GB0A 5SVIB 5K3QA 5G04B 2FUIA 3EB5A 2BAYA 3H7HA 3RPGB 2XB1A 2ECGA 3SOWA 1F62A 2YHOA 4R8PK 1CHCA 4MSXA 4GNFA 3I2DA 3ZPV1 4P5OB 3KV5A 5LKTA 2ECNA 5LKUA 3N9MA 3ZYQA 2JM3A 2NAAA 2YQLA 3LQHA 2LAUA 4IC2A 3LQJA 5J3XA 4LLBA 2KWOA 5B78A 2YHNA 3DPLR 4A4CA 2M85A 4FO9A 3FJUB 3ZVYA 5TDWA 1WEMA 4BHWA 4QQ4A 2HDPA 3O7AA 3N9PA 2KIZA 1K2FA 2OXQC 3QZVA 2DX8A 2D8UA 4A4BA 2YSMA 2XEUA 3U5OA 2E6SA 4OGEA 4R2YA 2H0DA 1U6GB 4GNGA 2KKXA 2RI7A 3SOUA 3JUEA 2K16A 5LKXA 2ZETC 4N3WA 3RPGC 2MKEA 2JMJA 3LJUX 2YT5A 4ZQLA 3ZPVE 2LGVA 2VNFA 2L7PA 2YW8A
chains in the Genus database with same CATH topology
4O64A 4UP5A 4WZ3B 2F42A 1Z6UA 3KNVA 4LK9A 3U5MA 5H1TA 2KFTA 1RMDA 2G45A 3O35A 2EGPA 3M62A 5KH7A 3IHPA 2YU4A 1X4IA 4MVTA 2K17A 2Y1NA 4YC9A 2LGLA 1JM7B 4TKPB 2YURA 2KR4A 3HCUA 1XWHA 3RTRB 3VK6A 4F52B 2HYED 3PURA 4QF3A 2YSJA 1ZBDB 4AP4A 5H1VA 1MM2A 4PTBA 2LN0A 4FJCA 2MNZA 2RSDA 1Z2QA 4L7XA 2VJFA 2KU3A 5FEYA 5B77A 2VJEA 1HYJA 2CSYA 2LRIC 5D1KB 2MA6A 2FUUA 5B76A 1IYMA 2KWNA 2F6NA 2QJ0A 4V3KC 3KV6A 5AITA 5FB1A 2L43A 1JOCA 1WEVA 5KH9A 5LKZA 2CKLB 4YABA 1WEPA 2MUMA 4FIPA 4R7EA 1HYIA 2Y1MA 3U5PA 4WA6A 2ECTA 2MA5A 3PUQA 3O36A 4ZUXU 2MIQA 3NG2A 1MM3A 2FSAA 1VD4A 5B8DA 1FP0A 3O70A 2VPEA 4YATA 3ZVZB 4L58A 2PNXA 2LV9A 1WEOA 2JMIA 2CT2A 5AIUA 2L0BA 2LXHC 2ECWA 4YBTA 2KE1A 2KGGA 4GNEA 2G6QA 4C9ZA 5JG6A 2VPDA 3FL2A 4LKAA 4GNDA 3L1ZB 1WEEA 2M3HA 4A49A 5TBNA 4ZDTA 1WIMA 1T1HA 2MD7B 2KGIA 2Y43A 4AYCB 3N9LA 5D1MB 1WEUA 4YAXA 5TDRA 3HCTA 3N9NA 3SOXA 3O37A 2LXPC 5EYAF 2YYRA 4WZ0A 4BBQA 4CA1A 3N9QA 2QIZA 2CSZA 1E4UA 1WGMA 1WENA 4B86C 4AUQB 2LGKA 5DINA 4I7CA 3ZTGA 4W4UA 2K1JA 3GV4A 1LDJB 2VP7A 1JM7A 3T7LA 4AYCA 3M63A 2VPGA 2K4DA 2YQMA 2JRJA 2C2LA 5D1LB 1Z60A 2C2VS 4B7YC 5DKAA 5H1UA 3HTKC 3L11A 5H9MA 5TRBA 2H0DB 3MHHA 2L80A 1V87A 1BORA 2AN6A 2YUCA 4LADB 4PPEA 2E6RA 3MHSA 3C6WA 3EB6A 2EA6A 2VPBA 1WEQA 3LQIA 1X4JA 5G0FA 5C13A 1VFYA 3GL6A 5C11A 2UZGA 2LQ6A 3ASLA 1WILA 4CCGX 2KWJA 4N4FA 4YBMA 4S3OB 2MD8C 3ZNIA 2YREA 1G25A 2CKLA 4IC3A 3PHDA 2JMDA 3O34A 4V3LC 4Q6FA 4LJNA 2ECIA 2L75A 3L1XA 2ECVA 3V43A 2LGGA 1WESA 4WZ2A 1VYXA 2EODA 5G05B 2IDAA 2QICA 1LDKC 4A0CD 2KYUA 3N9OA 4X3GA 2M6MA 4YBSA 5KH3A 2I50A 2ECJA 3KQIA 2KREA 5LCWB 4XI1A 3T6RA 4I7BA 2D8SA 4NN2A 3M99A 4QF2A 4UI9B 2MNYA 2VJFB 4AVXA 4FK5A 2G43A 3LRQA 2F6JA 3C5KA 1WFKA 5FB0A 2VJEB 2MT5A 5B75A 4S3OC 3O33A 1WEWA 3HCSA 1WE9A 3SHBA 2KWKA 4YADA 2M1RA 2PUYA 1N87A 5B79A 3U5NA 1DVPA 1X4UA 2LDRA 3DQVR 1FBVA 5FERA 5I3LA 4UP0A 2L5UA 4I7DA 5TABA 4GB0A 5G04B 2FUIA 3EB5A 2BAYA 3RPGB 2XB1A 2ECGA 3SOWA 1F62A 2YHOA 4R8PK 1CHCA 4MSXA 4GNFA 3I2DA 3ZPV1 4P5OB 3KV5A 5LKTA 2ECNA 5LKUA 3N9MA 3ZYQA 2YQLA 2NAAA 3LQHA 4IC2A 3LQJA 5J3XA 4LLBA 2KWOA 5B78A 2YHNA 3DPLR 4A4CA 2M85A 4FO9A 3ZVYA 5TDWA 1WEMA 4BHWA 2HDPA 3O7AA 3N9PA 2KIZA 1K2FA 2OXQC 3QZVA 2DX8A 4A4BA 2YSMA 2XEUA 3U5OA 2E6SA 4R2YA 2H0DA 1U6GB 4GNGA 2RI7A 3SOUA 2K16A 5LKXA 2ZETC 4N3WA 3RPGC 2JMJA 2YT5A 4ZQLA 3ZPVE 2LGVA 2VNFA 2YW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O64 A;  4UP5 A;  4WZ3 B;  2F42 A;  1Z6U A;  3KNV A;  4LK9 A;  3U5M A;  5H1T A;  2KFT A;  1RMD A;  2G45 A;  3O35 A;  2EGP A;  3M62 A;  5KH7 A;  3IHP A;  2YU4 A;  1X4I A;  4MVT A;  2K17 A;  2Y1N A;  4YC9 A;  2LGL A;  1JM7 B;  4TKP B;  2YUR A;  2KR4 A;  3HCU A;  1XWH A;  3RTR B;  3VK6 A;  4F52 B;  2HYE D;  3PUR A;  4QF3 A;  2YSJ A;  1ZBD B;  4AP4 A;  5H1V A;  1MM2 A;  4PTB A;  2LN0 A;  4FJC A;  2MNZ A;  2RSD A;  1Z2Q A;  4L7X A;  2VJF A;  2KU3 A;  5FEY A;  5B77 A;  2VJE A;  1HYJ A;  2CSY A;  2LRI C;  5D1K B;  2MA6 A;  2FUU A;  5B76 A;  1IYM A;  2KWN A;  2F6N A;  2QJ0 A;  4V3K C;  3KV6 A;  5AIT A;  5FB1 A;  2L43 A;  1JOC A;  1WEV A;  5KH9 A;  5LKZ A;  2CKL B;  4YAB A;  1WEP A;  2MUM A;  4FIP A;  4R7E A;  1HYI A;  2Y1M A;  3U5P A;  4WA6 A;  2ECT A;  2MA5 A;  3PUQ A;  3O36 A;  4ZUX U;  2MIQ A;  3NG2 A;  1MM3 A;  2FSA A;  1VD4 A;  5B8D A;  1FP0 A;  3O70 A;  2VPE A;  4YAT A;  3ZVZ B;  4L58 A;  2PNX A;  2LV9 A;  1WEO A;  2JMI A;  2CT2 A;  5AIU A;  2L0B A;  2LXH C;  2ECW A;  4YBT A;  2KE1 A;  2KGG A;  4GNE A;  2G6Q A;  4C9Z A;  5JG6 A;  2VPD A;  3FL2 A;  4LKA A;  4GND A;  3L1Z B;  1WEE A;  2M3H A;  4A49 A;  5TBN A;  4ZDT A;  1WIM A;  1T1H A;  2MD7 B;  2KGI A;  2Y43 A;  4AYC B;  3N9L A;  5D1M B;  1WEU A;  4YAX A;  5TDR A;  3HCT A;  3N9N A;  3SOX A;  3O37 A;  2LXP C;  5EYA F;  2YYR A;  4WZ0 A;  4BBQ A;  4CA1 A;  3N9Q A;  2QIZ A;  2CSZ A;  1E4U A;  1WGM A;  1WEN A;  4B86 C;  4AUQ B;  2LGK A;  5DIN A;  4I7C A;  3ZTG A;  4W4U A;  2K1J A;  3GV4 A;  1LDJ B;  2VP7 A;  1JM7 A;  3T7L A;  4AYC A;  3M63 A;  2VPG A;  2K4D A;  2YQM A;  2JRJ A;  2C2L A;  5D1L B;  1Z60 A;  2C2V S;  4B7Y C;  5DKA A;  5H1U A;  3HTK C;  3L11 A;  5H9M A;  5TRB A;  2H0D B;  3MHH A;  2L80 A;  1V87 A;  1BOR A;  2AN6 A;  2YUC A;  4LAD B;  4PPE A;  2E6R A;  3MHS A;  3C6W A;  3EB6 A;  2EA6 A;  2VPB A;  1WEQ A;  3LQI A;  1X4J A;  5G0F A;  5C13 A;  1VFY A;  3GL6 A;  5C11 A;  2UZG A;  2LQ6 A;  3ASL A;  1WIL A;  4CCG X;  2KWJ A;  4N4F A;  4YBM A;  4S3O B;  2MD8 C;  3ZNI A;  2YRE A;  1G25 A;  2CKL A;  4IC3 A;  3PHD A;  2JMD A;  3O34 A;  4V3L C;  4Q6F A;  4LJN A;  2ECI A;  2L75 A;  3L1X A;  2ECV A;  3V43 A;  2LGG A;  1WES A;  4WZ2 A;  1VYX A;  2EOD A;  5G05 B;  2IDA A;  2QIC A;  1LDK C;  4A0C D;  2KYU A;  3N9O A;  4X3G A;  2M6M A;  4YBS A;  5KH3 A;  2I50 A;  2ECJ A;  3KQI A;  2KRE A;  5LCW B;  4XI1 A;  3T6R A;  4I7B A;  2D8S A;  4NN2 A;  3M99 A;  4QF2 A;  4UI9 B;  2MNY A;  2VJF B;  4AVX A;  4FK5 A;  2G43 A;  3LRQ A;  2F6J A;  3C5K A;  1WFK A;  5FB0 A;  2VJE B;  2MT5 A;  5B75 A;  4S3O C;  3O33 A;  1WEW A;  3HCS A;  1WE9 A;  3SHB A;  2KWK A;  4YAD A;  2M1R A;  2PUY A;  1N87 A;  5B79 A;  3U5N A;  1DVP A;  1X4U A;  2LDR A;  3DQV R;  1FBV A;  5FER A;  5I3L A;  4UP0 A;  2L5U A;  4I7D A;  5TAB A;  4GB0 A;  5G04 B;  2FUI A;  3EB5 A;  2BAY A;  3RPG B;  2XB1 A;  2ECG A;  3SOW A;  1F62 A;  2YHO A;  4R8P K;  1CHC A;  4MSX A;  4GNF A;  3I2D A;  3ZPV 1;  4P5O B;  3KV5 A;  5LKT A;  2ECN A;  5LKU A;  3N9M A;  3ZYQ A;  2YQL A;  2NAA A;  3LQH A;  4IC2 A;  3LQJ A;  5J3X A;  4LLB A;  2KWO A;  5B78 A;  2YHN A;  3DPL R;  4A4C A;  2M85 A;  4FO9 A;  3ZVY A;  5TDW A;  1WEM A;  4BHW A;  2HDP A;  3O7A A;  3N9P A;  2KIZ A;  1K2F A;  2OXQ C;  3QZV A;  2DX8 A;  4A4B A;  2YSM A;  2XEU A;  3U5O A;  2E6S A;  4R2Y A;  2H0D A;  1U6G B;  4GNG A;  2RI7 A;  3SOU A;  2K16 A;  5LKX A;  2ZET C;  4N3W A;  3RPG C;  2JMJ A;  2YT5 A;  4ZQL A;  3ZPV E;  2LGV A;  2VNF A;  2YW8 A; 
#chains in the Genus database with same CATH topology
 4O64 A;  4UP5 A;  4WZ3 B;  2F42 A;  1Z6U A;  3KNV A;  4LK9 A;  3U5M A;  5H1T A;  2KFT A;  1RMD A;  2G45 A;  3O35 A;  2EGP A;  2CRR A;  3M62 A;  5KH7 A;  3IHP A;  2YU4 A;  1X4I A;  4MVT A;  2K17 A;  2Y1N A;  4YC9 A;  2EXU A;  2LGL A;  1JM7 B;  4TKP B;  2YUR A;  2KR4 A;  3HCU A;  1XWH A;  3RTR B;  3VK6 A;  4F52 B;  2HYE D;  3PUR A;  4QF3 A;  2YSJ A;  1ZBD B;  4AP4 A;  5H1V A;  1MM2 A;  4PTB A;  2LN0 A;  4FJC A;  2MNZ A;  2RSD A;  1Z2Q A;  4L7X A;  2VJF A;  2KU3 A;  5FEY A;  5B77 A;  2VJE A;  1HYJ A;  3KDE C;  2CSY A;  2LRI C;  5D1K B;  2MA6 A;  2FUU A;  5B76 A;  1IYM A;  2KWN A;  2F6N A;  2QJ0 A;  4V3K C;  3KV6 A;  5AIT A;  5FB1 A;  2L43 A;  3LVQ E;  2IQJ A;  1JOC A;  1WEV A;  5KH9 A;  5LKZ A;  2M13 A;  2CKL B;  4YAB A;  1WEP A;  2MUM A;  4FIP A;  4R7E A;  1HYI A;  2Y1M A;  3U5P A;  4WA6 A;  5SVI A;  2ECT A;  2MA5 A;  3PUQ A;  3O36 A;  2XP0 A;  4ZUX U;  2MIQ A;  3NG2 A;  1MM3 A;  2RR4 A;  2FSA A;  1VD4 A;  2FD4 A;  5B8D A;  1FP0 A;  1MBM A;  3O70 A;  2VPE A;  3FAN A;  4YAT A;  3ZVZ B;  4L58 A;  2PNX A;  2LV9 A;  1WEO A;  2JMI A;  2CT2 A;  5AIU A;  2EGM A;  2L0B A;  2LXH C;  2ECW A;  4YBT A;  2KE1 A;  2KGG A;  3M7K A;  4GNE A;  2G6Q A;  4C9Z A;  5JG6 A;  2VPD A;  3FL2 A;  3MDB C;  4LKA A;  4GND A;  3L1Z B;  1WEE A;  2CON A;  2M3H A;  4A49 A;  5TBN A;  4ZDT A;  1WIM A;  1T1H A;  2MD7 B;  2KGI A;  2Y43 A;  5SVX A;  4AYC B;  3N9L A;  5D1M B;  1WEU A;  4YAX A;  5TDR A;  3DWD A;  2DSM A;  4H9D A;  3HCT A;  2B0O E;  3N9N A;  3SOX A;  3O37 A;  2CSV A;  2LXP C;  5EYA F;  2YYR A;  4WZ0 A;  4BBQ A;  4CA1 A;  2XOY A;  3N9Q A;  2QIZ A;  2CSZ A;  1E4U A;  1WGM A;  1WEN A;  4B86 C;  4AUQ B;  2LGK A;  5DIN A;  4I7C A;  3ZTG A;  4W4U A;  2K1J A;  2DJA A;  3GV4 A;  1LDJ B;  2VP7 A;  1JM7 A;  3T7L A;  4AYC A;  3M63 A;  2VPG A;  2K4D A;  2YQM A;  2JRJ A;  2C2L A;  5D1L B;  1Z60 A;  2C2V S;  2E61 A;  4B7Y C;  3FEH A;  5DKA A;  5H1U A;  3HTK C;  3L11 A;  4Z0O A;  5H9M A;  5TRB A;  2H0D B;  3MHH A;  4OGC A;  2YVR A;  2L80 A;  1V87 A;  1BOR A;  2AN6 A;  2CRW A;  2YUC A;  4LAD B;  4PPE A;  3T9K A;  2E6R A;  3MHS A;  3C6W A;  3EB6 A;  2P57 A;  2EA6 A;  2VPB A;  2KKY A;  3LVR E;  1WEQ A;  3LQI A;  3FM8 C;  1X4J A;  5G0F A;  5C13 A;  1VFY A;  3E2D A;  3GL6 A;  2UZG A;  5C11 A;  2LQ6 A;  3ASL A;  3SUB A;  1WIL A;  4CCG X;  4O62 A;  2KWJ A;  4N4F A;  4YBM A;  4S3O B;  2MD8 C;  3ZNI A;  3DDT A;  2YRE A;  1G25 A;  2CKL A;  4IC3 A;  3PHD A;  4F1P A;  2JMD A;  3O34 A;  4V3L C;  4Q6F A;  4LJN A;  3PLW A;  2ECI A;  4Z0R A;  2L75 A;  3L1X A;  2ECV A;  3V43 A;  2LGG A;  1WES A;  4WZ2 A;  1VYX A;  2EOD A;  3O47 A;  5G05 B;  2IDA A;  2QIC A;  1LDK C;  2FFW A;  2OWA A;  2XOC A;  4A0C D;  2KYU A;  3N9O A;  3FAO A;  4X3G A;  2M6M A;  4YBS A;  5KH3 A;  2I50 A;  2ECJ A;  3KQI A;  2KRE A;  5LCW B;  4XI1 A;  3T6R A;  2JUN A;  4I7B A;  2D8S A;  4NN2 A;  3M99 A;  4QF2 A;  4UI9 B;  2MNY A;  1DCQ A;  2VJF B;  4AVX A;  4FK5 A;  2G43 A;  3LRQ A;  2F6J A;  3C5K A;  1WFK A;  5FB0 A;  2VJE B;  2MT5 A;  5B75 A;  2XOZ A;  4S3O C;  3O33 A;  3Q1D A;  1WEW A;  3HCS A;  3LDY A;  1WE9 A;  3SHB A;  2KWK A;  4YAD A;  2M1R A;  5SVY A;  2PUY A;  1N87 A;  5B79 A;  3U5N A;  1DVP A;  1X4U A;  2LDR A;  3DQV R;  1FBV A;  5FER A;  5I3L A;  4UP0 A;  2L5U A;  4I7D A;  5TAB A;  4GB0 A;  5SVI B;  5K3Q A;  5G04 B;  2FUI A;  3EB5 A;  2BAY A;  3H7H A;  3RPG B;  2XB1 A;  2ECG A;  3SOW A;  1F62 A;  2YHO A;  4R8P K;  1CHC A;  4MSX A;  4GNF A;  3I2D A;  3ZPV 1;  4P5O B;  3KV5 A;  5LKT A;  2ECN A;  5LKU A;  3N9M A;  3ZYQ A;  2JM3 A;  2NAA A;  2YQL A;  3LQH A;  2LAU A;  4IC2 A;  3LQJ A;  5J3X A;  4LLB A;  2KWO A;  5B78 A;  2YHN A;  3DPL R;  4A4C A;  2M85 A;  4FO9 A;  3FJU B;  3ZVY A;  5TDW A;  1WEM A;  4BHW A;  4QQ4 A;  2HDP A;  3O7A A;  3N9P A;  2KIZ A;  1K2F A;  2OXQ C;  3QZV A;  2DX8 A;  2D8U A;  4A4B A;  2YSM A;  2XEU A;  3U5O A;  2E6S A;  4OGE A;  4R2Y A;  2H0D A;  1U6G B;  4GNG A;  2KKX A;  2RI7 A;  3SOU A;  3JUE A;  2K16 A;  5LKX A;  2ZET C;  4N3W A;  3RPG C;  2MKE A;  2JMJ A;  3LJU X;  2YT5 A;  4ZQL A;  3ZPV E;  2LGV A;  2VNF A;  2L7P A;  2YW8 A; 
#chains in the Genus database with same CATH homology
 4O64 A;  4UP5 A;  4WZ3 B;  2F42 A;  1Z6U A;  3KNV A;  4LK9 A;  3U5M A;  5H1T A;  2KFT A;  1RMD A;  2G45 A;  3O35 A;  2EGP A;  3M62 A;  5KH7 A;  3IHP A;  2YU4 A;  1X4I A;  4MVT A;  2K17 A;  2Y1N A;  4YC9 A;  2LGL A;  1JM7 B;  4TKP B;  2YUR A;  2KR4 A;  3HCU A;  1XWH A;  3RTR B;  3VK6 A;  4F52 B;  2HYE D;  3PUR A;  4QF3 A;  2YSJ A;  1ZBD B;  4AP4 A;  5H1V A;  1MM2 A;  4PTB A;  2LN0 A;  4FJC A;  2MNZ A;  2RSD A;  1Z2Q A;  4L7X A;  2VJF A;  2KU3 A;  5FEY A;  5B77 A;  2VJE A;  1HYJ A;  2CSY A;  2LRI C;  5D1K B;  2MA6 A;  2FUU A;  5B76 A;  1IYM A;  2KWN A;  2F6N A;  2QJ0 A;  4V3K C;  3KV6 A;  5AIT A;  5FB1 A;  2L43 A;  1JOC A;  1WEV A;  5KH9 A;  5LKZ A;  2CKL B;  4YAB A;  1WEP A;  2MUM A;  4FIP A;  4R7E A;  1HYI A;  2Y1M A;  3U5P A;  4WA6 A;  2ECT A;  2MA5 A;  3PUQ A;  3O36 A;  4ZUX U;  2MIQ A;  3NG2 A;  1MM3 A;  2FSA A;  1VD4 A;  5B8D A;  1FP0 A;  3O70 A;  2VPE A;  4YAT A;  3ZVZ B;  4L58 A;  2PNX A;  2LV9 A;  1WEO A;  2JMI A;  2CT2 A;  5AIU A;  2L0B A;  2LXH C;  2ECW A;  4YBT A;  2KE1 A;  2KGG A;  4GNE A;  2G6Q A;  4C9Z A;  5JG6 A;  2VPD A;  3FL2 A;  4LKA A;  4GND A;  3L1Z B;  1WEE A;  2M3H A;  4A49 A;  5TBN A;  4ZDT A;  1WIM A;  1T1H A;  2MD7 B;  2KGI A;  2Y43 A;  4AYC B;  3N9L A;  5D1M B;  1WEU A;  4YAX A;  5TDR A;  3HCT A;  3N9N A;  3SOX A;  3O37 A;  2LXP C;  5EYA F;  2YYR A;  4WZ0 A;  4BBQ A;  4CA1 A;  3N9Q A;  2QIZ A;  2CSZ A;  1E4U A;  1WGM A;  1WEN A;  4B86 C;  4AUQ B;  2LGK A;  5DIN A;  4I7C A;  3ZTG A;  4W4U A;  2K1J A;  3GV4 A;  1LDJ B;  2VP7 A;  1JM7 A;  3T7L A;  4AYC A;  3M63 A;  2VPG A;  2K4D A;  2YQM A;  2JRJ A;  2C2L A;  5D1L B;  1Z60 A;  2C2V S;  4B7Y C;  5DKA A;  5H1U A;  3HTK C;  3L11 A;  5H9M A;  5TRB A;  2H0D B;  3MHH A;  2L80 A;  1V87 A;  1BOR A;  2AN6 A;  2YUC A;  4LAD B;  4PPE A;  2E6R A;  3MHS A;  3C6W A;  3EB6 A;  2EA6 A;  2VPB A;  1WEQ A;  3LQI A;  1X4J A;  5G0F A;  5C13 A;  1VFY A;  3GL6 A;  5C11 A;  2UZG A;  2LQ6 A;  3ASL A;  1WIL A;  4CCG X;  2KWJ A;  4N4F A;  4YBM A;  4S3O B;  2MD8 C;  3ZNI A;  2YRE A;  1G25 A;  2CKL A;  4IC3 A;  3PHD A;  2JMD A;  3O34 A;  4V3L C;  4Q6F A;  4LJN A;  2ECI A;  2L75 A;  3L1X A;  2ECV A;  3V43 A;  2LGG A;  1WES A;  4WZ2 A;  1VYX A;  2EOD A;  5G05 B;  2IDA A;  2QIC A;  1LDK C;  4A0C D;  2KYU A;  3N9O A;  4X3G A;  2M6M A;  4YBS A;  5KH3 A;  2I50 A;  2ECJ A;  3KQI A;  2KRE A;  5LCW B;  4XI1 A;  3T6R A;  4I7B A;  2D8S A;  4NN2 A;  3M99 A;  4QF2 A;  4UI9 B;  2MNY A;  2VJF B;  4AVX A;  4FK5 A;  2G43 A;  3LRQ A;  2F6J A;  3C5K A;  1WFK A;  5FB0 A;  2VJE B;  2MT5 A;  5B75 A;  4S3O C;  3O33 A;  1WEW A;  3HCS A;  1WE9 A;  3SHB A;  2KWK A;  4YAD A;  2M1R A;  2PUY A;  1N87 A;  5B79 A;  3U5N A;  1DVP A;  1X4U A;  2LDR A;  3DQV R;  1FBV A;  5FER A;  5I3L A;  4UP0 A;  2L5U A;  4I7D A;  5TAB A;  4GB0 A;  5G04 B;  2FUI A;  3EB5 A;  2BAY A;  3RPG B;  2XB1 A;  2ECG A;  3SOW A;  1F62 A;  2YHO A;  4R8P K;  1CHC A;  4MSX A;  4GNF A;  3I2D A;  3ZPV 1;  4P5O B;  3KV5 A;  5LKT A;  2ECN A;  5LKU A;  3N9M A;  3ZYQ A;  2YQL A;  2NAA A;  3LQH A;  4IC2 A;  3LQJ A;  5J3X A;  4LLB A;  2KWO A;  5B78 A;  2YHN A;  3DPL R;  4A4C A;  2M85 A;  4FO9 A;  3ZVY A;  5TDW A;  1WEM A;  4BHW A;  2HDP A;  3O7A A;  3N9P A;  2KIZ A;  1K2F A;  2OXQ C;  3QZV A;  2DX8 A;  4A4B A;  2YSM A;  2XEU A;  3U5O A;  2E6S A;  4R2Y A;  2H0D A;  1U6G B;  4GNG A;  2RI7 A;  3SOU A;  2K16 A;  5LKX A;  2ZET C;  4N3W A;  3RPG C;  2JMJ A;  2YT5 A;  4ZQL A;  3ZPV E;  2LGV A;  2VNF A;  2YW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...