5AITA

A complex of of rnf4-ring domain, ubev2, ubc13-ub (isopeptide crosslink)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
129
structure length
129
Chain Sequence
SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYIGSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Ring Catalyzed Synthesis of K63 Linked Ubiquitin Chains
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF4
total genus 21
structure length 129
sequence length 129
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5aitA00
1WEMA 1WENA 2C2LA 2FUIA 2LGKA 1MM2A 1Z6UA 5LKXA 2LGVA 3KV5A 5LKUA 4MSXA 5DINA 2CT2A 2KWKA 2YQLA 1U6GB 4Q6FA 2EGPA 4GNFA 1WEVA 3L1XA 2LXPC 2CSYA 1E4UA 2M6MA 3KV6A 2VPBA 1JM7B 4ZUXU 3DQVR 2E6SA 3MHSA 2G6QA 4X3GA 5B76A 4P5OB 4ZQLA 2YHOA 5TABA 3L1ZB 2NAAA 3RPGB 2MUMA 4YBMA 5J3XA 1Z2QA 3N9NA 3HCSA 4CCGX 2ECWA 2LN0A 3T7LA 4L58A 2YURA 2JMJA 1FP0A 4YATA 5B79A 2K16A 4YADA 1WEEA 2YSMA 3C6WA 2ECVA 2H0DB 2F6NA 3SOXA 2VP7A 3DPLR 1IYMA 2QIZA 3N9QA 2M3HA 2MD8C 2FUUA 2PNXA 5EYAF 4A0CD 2KWJA 5FB1A 1HYIA 2MNZA 3N9PA 4F52B 4L7XA 3N9MA 1WFKA 3O35A 2MNYA 5TBNA 2VPEA 5TRBA 1G25A 2F42A 5C11A 4O64A 3I2DA 2G45A 2AN6A 3KNVA 2ZETC 2ECNA 3LQIA 4WZ3B 3VK6A 5LCWB 3LQJA 5TDWA 4XI1A 5G0FA 5H1VA 2KWNA 2LGGA 3V43A 5FERA 2LV9A 3HCUA 2ECGA 4LK9A 2LDRA 2LRIC 2L0BA 2PUYA 2I50A 4UP5A 4W4UA 4CA1A 1WIMA 3EB5A 3M99A 1CHCA 2EA6A 5LKZA 4LKAA 2VJEB 3U5NA 5B77A 3L11A 1VD4A 4YABA 2KGIA 1K2FA 4GNEA 5KH9A 1WEOA 3ZVZB 4YBSA 2JRJA 2QJ0A 4B7YC 2KGGA 5AIUA 2ECTA 1Z60A 3KQIA 4MVTA 3O33A 1RMDA 2YSJA 5FEYA 2HYED 1JOCA 3FL2A 2YYRA 4TKPB 3MHHA 3RTRB 5D1KB 3SOWA 2XB1A 3O37A 4A49A 3GV4A 3O7AA 2G43A 4BBQA 4I7CA 2VPGA 4I7BA 3NG2A 1WEPA 4PPEA 2BAYA 4IC2A 3ZYQA 2K1JA 2M85A 2KYUA 4QF3A 3N9OA 4FJCA 1WEQA 4GNDA 2KREA 2KWOA 1JM7A 2KFTA 2FSAA 1N87A 3PHDA 3U5MA 4N3WA 2L5UA 2KR4A 2Y1NA 1VYXA 3O36A 2YHNA 4V3KC 5H9MA 4C9ZA 4FO9A 4A4BA 2Y1MA 5KH7A 1ZBDB 2CKLB 1HYJA 4GNGA 2E6RA 2QICA 5D1LB 4YBTA 4R2YA 4LJNA 4FIPA 1X4IA 2ECIA 4LLBA 4S3OC 3ZPVE 1V87A 2KE1A 2MT5A 1WEUA 4IC3A 3U5PA 5DKAA 4N4FA 5G05B 1WILA 2Y43A 5H1UA 5AITA 3ZNIA 4UP0A 3ZTGA 5B75A 4AYCB 2YUCA 4AP4A 2EODA 2M1RA 2MD7B 4NN2A 5D1MB 1F62A 5G04B 1WGMA 2L43A 4UI9B 3C5KA 2H0DA 4WZ2A 1BORA 1WE9A 5C13A 4LADB 2UZGA 4ZDTA 1WEWA 5JG6A 3PUQA 3T6RA 5TDRA 3N9LA 3ZVYA 4A4CA 4AYCA 5H1TA 2KU3A 4FK5A 4AVXA 4WZ0A 1LDJB 1WESA 4GB0A 2D8SA 2LXHC 1X4UA 4BHWA 3EB6A 2YQMA 4PTBA 3LRQA 4YAXA 3PURA 4YC9A 2YW8A 3QZVA 2MA6A 3RPGC 3IHPA 2L75A 3SOUA 2ECJA 3O70A 3ASLA 3U5OA 2JMDA 2K17A 2K4DA 4R8PK 2IDAA 2MIQA 2XEUA 2MA5A 2VJFB 3M63A 2HDPA 2RI7A 5B78A 3SHBA 2YU4A 3HCTA 1LDKC 2L80A 2C2VS 4S3OB 4QF2A 1MM3A 3GL6A 2OXQC 2VJEA 2VNFA 5I3LA 4B86C 4AUQB 3M62A 2CSZA 2VJFA 1XWHA 4I7DA 3ZPV1 5B8DA 2RSDA 4WA6A 3HTKC 2LGLA 2LQ6A 2JMIA 1X4JA 2YREA 1T1HA 2KIZA 2F6JA 4V3LC 2DX8A 1VFYA 5LKTA 2VPDA 1DVPA 1FBVA 4R7EA 2YT5A 3LQHA 2CKLA 3O34A 5FB0A 5KH3A
chains in the Genus database with same CATH superfamily
1WEMA 2XP0A 1WENA 2C2LA 2XOZA 2FUIA 2LGKA 1MM2A 1Z6UA 5LKXA 2LGVA 3KV5A 5LKUA 4MSXA 5DINA 2CT2A 2KWKA 2YQLA 3E2DA 1U6GB 4Q6FA 2EGPA 4GNFA 1WEVA 3L1XA 4OGEA 2LXPC 2CSYA 1E4UA 2M6MA 3KV6A 2VPBA 1JM7B 4ZUXU 3FEHA 3DQVR 2E6SA 3MHSA 3MDBC 2G6QA 4X3GA 2IQJA 5B76A 2KKXA 4P5OB 4ZQLA 2E61A 2YHOA 5TABA 3L1ZB 2NAAA 3RPGB 2MUMA 4YBMA 2RR4A 5J3XA 1Z2QA 3N9NA 3HCSA 4CCGX 2ECWA 2CRRA 2LN0A 3T7LA 4L58A 2YURA 2JMJA 1FP0A 2FFWA 4YATA 2B0OE 5B79A 2K16A 4YADA 1WEEA 2YSMA 2EXUA 3C6WA 2ECVA 2H0DB 3H7HA 2F6NA 3SOXA 2VP7A 3DPLR 1IYMA 2QIZA 3N9QA 2M3HA 2MD8C 2FUUA 2PNXA 5EYAF 2KWJA 4A0CD 5FB1A 1HYIA 2MNZA 3N9PA 4F52B 4L7XA 3N9MA 1WFKA 3O35A 3T9KA 1DCQA 2MNYA 5TBNA 2VPEA 5TRBA 1G25A 2F42A 5C11A 4O64A 3I2DA 2G45A 2AN6A 3KNVA 2ZETC 2ECNA 3LQIA 4WZ3B 3VK6A 5LCWB 3LQJA 5TDWA 4XI1A 5G0FA 5H1VA 5SVXA 2JUNA 2KWNA 2LGGA 3V43A 5FERA 2LV9A 3HCUA 3LVQE 2ECGA 4LK9A 2LDRA 2CSVA 2LRIC 2L0BA 2PUYA 2I50A 4UP5A 4W4UA 4CA1A 1WIMA 3EB5A 3M99A 4Z0OA 1CHCA 2EA6A 3LVRE 5LKZA 4LKAA 2VJEB 3U5NA 5B77A 3L11A 1VD4A 4YABA 2KGIA 1K2FA 4GNEA 5KH9A 1MBMA 1WEOA 2CRWA 3ZVZB 4YBSA 2XOYA 2JRJA 2QJ0A 4B7YC 2KGGA 3O47A 3Q1DA 5AIUA 2ECTA 1Z60A 3KQIA 4MVTA 2JM3A 2XOCA 3FAOA 3O33A 1RMDA 2YSJA 5FEYA 2HYED 1JOCA 3FL2A 2YYRA 4TKPB 3MHHA 3FANA 3RTRB 5D1KB 3SOWA 2XB1A 3O37A 3SUBA 4A49A 3PLWA 3GV4A 3O7AA 2G43A 4BBQA 4OGCA 3KDEC 4I7CA 2VPGA 4I7BA 3NG2A 1WEPA 4PPEA 2BAYA 3DWDA 4IC2A 2EGMA 3ZYQA 2K1JA 2M85A 2KYUA 3LDYA 4QF3A 2CONA 3N9OA 4FJCA 1WEQA 4GNDA 2KREA 2KWOA 1JM7A 2KFTA 2FSAA 1N87A 3PHDA 3U5MA 4N3WA 2L5UA 4H9DA 2KR4A 2Y1NA 1VYXA 3O36A 2YHNA 2P57A 4V3KC 2DJAA 2D8UA 3LJUX 5H9MA 4C9ZA 2KKYA 4FO9A 4A4BA 2Y1MA 2L7PA 3JUEA 5KH7A 1ZBDB 2CKLB 5K3QA 1HYJA 2M13A 4GNGA 2E6RA 2QICA 5D1LB 4YBTA 4R2YA 4LJNA 4FIPA 1X4IA 2ECIA 4LLBA 4S3OC 3ZPVE 1V87A 2KE1A 2MT5A 1WEUA 2OWAA 4IC3A 3U5PA 5DKAA 4N4FA 5G05B 1WILA 5SVYA 2Y43A 5H1UA 5AITA 3ZNIA 4UP0A 3ZTGA 5B75A 4AYCB 2YUCA 4Z0RA 4AP4A 2MKEA 2EODA 2M1RA 2MD7B 4NN2A 5D1MB 2DSMA 1F62A 5G04B 1WGMA 2L43A 4UI9B 3C5KA 2H0DA 4WZ2A 1BORA 1WE9A 5C13A 2YVRA 4LADB 2UZGA 4ZDTA 1WEWA 5JG6A 3PUQA 3T6RA 5TDRA 3N9LA 3ZVYA 4A4CA 4AYCA 5H1TA 2KU3A 4FK5A 4AVXA 3FM8C 4WZ0A 1LDJB 1WESA 4GB0A 2D8SA 2LXHC 1X4UA 4BHWA 3EB6A 2YQMA 4QQ4A 4PTBA 3LRQA 4YAXA 3PURA 3DDTA 4YC9A 2YW8A 3QZVA 2MA6A 3RPGC 3IHPA 2L75A 3SOUA 2ECJA 3O70A 5SVIB 3ASLA 4F1PA 3U5OA 2JMDA 2K17A 2K4DA 4R8PK 2IDAA 2MIQA 2XEUA 2MA5A 2VJFB 3M63A 2HDPA 2RI7A 5B78A 3SHBA 2YU4A 3HCTA 1LDKC 2L80A 2C2VS 4S3OB 4QF2A 3FJUB 1MM3A 3GL6A 5SVIA 2LAUA 2OXQC 2VJEA 2VNFA 5I3LA 4B86C 4AUQB 3M62A 2CSZA 2VJFA 1XWHA 4I7DA 3ZPV1 4O62A 2RSDA 5B8DA 4WA6A 3M7KA 3HTKC 2LGLA 2LQ6A 2JMIA 2FD4A 1X4JA 2YREA 1T1HA 2KIZA 2F6JA 4V3LC 2DX8A 1VFYA 5LKTA 2VPDA 1DVPA 1FBVA 4R7EA 2YT5A 3LQHA 2CKLA 3O34A 5FB0A 5KH3A
chains in the Genus database with same CATH topology
1WEMA 1WENA 2C2LA 2FUIA 2LGKA 1MM2A 1Z6UA 5LKXA 2LGVA 3KV5A 5LKUA 4MSXA 5DINA 2CT2A 2KWKA 2YQLA 1U6GB 4Q6FA 2EGPA 4GNFA 1WEVA 3L1XA 2LXPC 2CSYA 1E4UA 2M6MA 3KV6A 2VPBA 1JM7B 4ZUXU 3DQVR 2E6SA 3MHSA 2G6QA 4X3GA 5B76A 4P5OB 4ZQLA 2YHOA 5TABA 3L1ZB 2NAAA 3RPGB 2MUMA 4YBMA 5J3XA 1Z2QA 3N9NA 3HCSA 4CCGX 2ECWA 2LN0A 3T7LA 4L58A 2YURA 2JMJA 1FP0A 4YATA 5B79A 2K16A 4YADA 1WEEA 2YSMA 3C6WA 2ECVA 2H0DB 2F6NA 3SOXA 2VP7A 3DPLR 1IYMA 2QIZA 3N9QA 2M3HA 2MD8C 2FUUA 2PNXA 5EYAF 4A0CD 2KWJA 5FB1A 1HYIA 2MNZA 3N9PA 4F52B 4L7XA 3N9MA 1WFKA 3O35A 2MNYA 5TBNA 2VPEA 5TRBA 1G25A 2F42A 5C11A 4O64A 3I2DA 2G45A 2AN6A 3KNVA 2ZETC 2ECNA 3LQIA 4WZ3B 3VK6A 5LCWB 3LQJA 5TDWA 4XI1A 5G0FA 5H1VA 2KWNA 2LGGA 3V43A 5FERA 2LV9A 3HCUA 2ECGA 4LK9A 2LDRA 2LRIC 2L0BA 2PUYA 2I50A 4UP5A 4W4UA 4CA1A 1WIMA 3EB5A 3M99A 1CHCA 2EA6A 5LKZA 4LKAA 2VJEB 3U5NA 5B77A 3L11A 1VD4A 4YABA 2KGIA 1K2FA 4GNEA 5KH9A 1WEOA 3ZVZB 4YBSA 2JRJA 2QJ0A 4B7YC 2KGGA 5AIUA 2ECTA 1Z60A 3KQIA 4MVTA 3O33A 1RMDA 2YSJA 5FEYA 2HYED 1JOCA 3FL2A 2YYRA 4TKPB 3MHHA 3RTRB 5D1KB 3SOWA 2XB1A 3O37A 4A49A 3GV4A 3O7AA 2G43A 4BBQA 4I7CA 2VPGA 4I7BA 3NG2A 1WEPA 4PPEA 2BAYA 4IC2A 3ZYQA 2K1JA 2M85A 2KYUA 4QF3A 3N9OA 4FJCA 1WEQA 4GNDA 2KREA 2KWOA 1JM7A 2KFTA 2FSAA 1N87A 3PHDA 3U5MA 4N3WA 2L5UA 2KR4A 2Y1NA 1VYXA 3O36A 2YHNA 4V3KC 5H9MA 4C9ZA 4FO9A 4A4BA 2Y1MA 5KH7A 1ZBDB 2CKLB 1HYJA 4GNGA 2E6RA 2QICA 5D1LB 4YBTA 4R2YA 4LJNA 4FIPA 1X4IA 2ECIA 4LLBA 4S3OC 3ZPVE 1V87A 2KE1A 2MT5A 1WEUA 4IC3A 3U5PA 5DKAA 4N4FA 5G05B 1WILA 2Y43A 5H1UA 5AITA 3ZNIA 4UP0A 3ZTGA 5B75A 4AYCB 2YUCA 4AP4A 2EODA 2M1RA 2MD7B 4NN2A 5D1MB 1F62A 5G04B 1WGMA 2L43A 4UI9B 3C5KA 2H0DA 4WZ2A 1BORA 1WE9A 5C13A 4LADB 2UZGA 4ZDTA 1WEWA 5JG6A 3PUQA 3T6RA 5TDRA 3N9LA 3ZVYA 4A4CA 4AYCA 5H1TA 2KU3A 4FK5A 4AVXA 4WZ0A 1LDJB 1WESA 4GB0A 2D8SA 2LXHC 1X4UA 4BHWA 3EB6A 2YQMA 4PTBA 3LRQA 4YAXA 3PURA 4YC9A 2YW8A 3QZVA 2MA6A 3RPGC 3IHPA 2L75A 3SOUA 2ECJA 3O70A 3ASLA 3U5OA 2JMDA 2K17A 2K4DA 4R8PK 2IDAA 2MIQA 2XEUA 2MA5A 2VJFB 3M63A 2HDPA 2RI7A 5B78A 3SHBA 2YU4A 3HCTA 1LDKC 2L80A 2C2VS 4S3OB 4QF2A 1MM3A 3GL6A 2OXQC 2VJEA 2VNFA 5I3LA 4B86C 4AUQB 3M62A 2CSZA 2VJFA 1XWHA 4I7DA 3ZPV1 5B8DA 2RSDA 4WA6A 3HTKC 2LGLA 2LQ6A 2JMIA 1X4JA 2YREA 1T1HA 2KIZA 2F6JA 4V3LC 2DX8A 1VFYA 5LKTA 2VPDA 1DVPA 1FBVA 4R7EA 2YT5A 3LQHA 2CKLA 3O34A 5FB0A 5KH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEM A;  1WEN A;  2C2L A;  2FUI A;  2LGK A;  1MM2 A;  1Z6U A;  5LKX A;  2LGV A;  3KV5 A;  5LKU A;  4MSX A;  5DIN A;  2CT2 A;  2KWK A;  2YQL A;  1U6G B;  4Q6F A;  2EGP A;  4GNF A;  1WEV A;  3L1X A;  2LXP C;  2CSY A;  1E4U A;  2M6M A;  3KV6 A;  2VPB A;  1JM7 B;  4ZUX U;  3DQV R;  2E6S A;  3MHS A;  2G6Q A;  4X3G A;  5B76 A;  4P5O B;  4ZQL A;  2YHO A;  5TAB A;  3L1Z B;  2NAA A;  3RPG B;  2MUM A;  4YBM A;  5J3X A;  1Z2Q A;  3N9N A;  3HCS A;  4CCG X;  2ECW A;  2LN0 A;  3T7L A;  4L58 A;  2YUR A;  2JMJ A;  1FP0 A;  4YAT A;  5B79 A;  2K16 A;  4YAD A;  1WEE A;  2YSM A;  3C6W A;  2ECV A;  2H0D B;  2F6N A;  3SOX A;  2VP7 A;  3DPL R;  1IYM A;  2QIZ A;  3N9Q A;  2M3H A;  2MD8 C;  2FUU A;  2PNX A;  5EYA F;  4A0C D;  2KWJ A;  5FB1 A;  1HYI A;  2MNZ A;  3N9P A;  4F52 B;  4L7X A;  3N9M A;  1WFK A;  3O35 A;  2MNY A;  5TBN A;  2VPE A;  5TRB A;  1G25 A;  2F42 A;  5C11 A;  4O64 A;  3I2D A;  2G45 A;  2AN6 A;  3KNV A;  2ZET C;  2ECN A;  3LQI A;  4WZ3 B;  3VK6 A;  5LCW B;  3LQJ A;  5TDW A;  4XI1 A;  5G0F A;  5H1V A;  2KWN A;  2LGG A;  3V43 A;  5FER A;  2LV9 A;  3HCU A;  2ECG A;  4LK9 A;  2LDR A;  2LRI C;  2L0B A;  2PUY A;  2I50 A;  4UP5 A;  4W4U A;  4CA1 A;  1WIM A;  3EB5 A;  3M99 A;  1CHC A;  2EA6 A;  5LKZ A;  4LKA A;  2VJE B;  3U5N A;  5B77 A;  3L11 A;  1VD4 A;  4YAB A;  2KGI A;  1K2F A;  4GNE A;  5KH9 A;  1WEO A;  3ZVZ B;  4YBS A;  2JRJ A;  2QJ0 A;  4B7Y C;  2KGG A;  5AIU A;  2ECT A;  1Z60 A;  3KQI A;  4MVT A;  3O33 A;  1RMD A;  2YSJ A;  5FEY A;  2HYE D;  1JOC A;  3FL2 A;  2YYR A;  4TKP B;  3MHH A;  3RTR B;  5D1K B;  3SOW A;  2XB1 A;  3O37 A;  4A49 A;  3GV4 A;  3O7A A;  2G43 A;  4BBQ A;  4I7C A;  2VPG A;  4I7B A;  3NG2 A;  1WEP A;  4PPE A;  2BAY A;  4IC2 A;  3ZYQ A;  2K1J A;  2M85 A;  2KYU A;  4QF3 A;  3N9O A;  4FJC A;  1WEQ A;  4GND A;  2KRE A;  2KWO A;  1JM7 A;  2KFT A;  2FSA A;  1N87 A;  3PHD A;  3U5M A;  4N3W A;  2L5U A;  2KR4 A;  2Y1N A;  1VYX A;  3O36 A;  2YHN A;  4V3K C;  5H9M A;  4C9Z A;  4FO9 A;  4A4B A;  2Y1M A;  5KH7 A;  1ZBD B;  2CKL B;  1HYJ A;  4GNG A;  2E6R A;  2QIC A;  5D1L B;  4YBT A;  4R2Y A;  4LJN A;  4FIP A;  1X4I A;  2ECI A;  4LLB A;  4S3O C;  3ZPV E;  1V87 A;  2KE1 A;  2MT5 A;  1WEU A;  4IC3 A;  3U5P A;  5DKA A;  4N4F A;  5G05 B;  1WIL A;  2Y43 A;  5H1U A;  5AIT A;  3ZNI A;  4UP0 A;  3ZTG A;  5B75 A;  4AYC B;  2YUC A;  4AP4 A;  2EOD A;  2M1R A;  2MD7 B;  4NN2 A;  5D1M B;  1F62 A;  5G04 B;  1WGM A;  2L43 A;  4UI9 B;  3C5K A;  2H0D A;  4WZ2 A;  1BOR A;  1WE9 A;  5C13 A;  4LAD B;  2UZG A;  4ZDT A;  1WEW A;  5JG6 A;  3PUQ A;  3T6R A;  5TDR A;  3N9L A;  3ZVY A;  4A4C A;  4AYC A;  5H1T A;  2KU3 A;  4FK5 A;  4AVX A;  4WZ0 A;  1LDJ B;  1WES A;  4GB0 A;  2D8S A;  2LXH C;  1X4U A;  4BHW A;  3EB6 A;  2YQM A;  4PTB A;  3LRQ A;  4YAX A;  3PUR A;  4YC9 A;  2YW8 A;  3QZV A;  2MA6 A;  3RPG C;  3IHP A;  2L75 A;  3SOU A;  2ECJ A;  3O70 A;  3ASL A;  3U5O A;  2JMD A;  2K17 A;  2K4D A;  4R8P K;  2IDA A;  2MIQ A;  2XEU A;  2MA5 A;  2VJF B;  3M63 A;  2HDP A;  2RI7 A;  5B78 A;  3SHB A;  2YU4 A;  3HCT A;  1LDK C;  2L80 A;  2C2V S;  4S3O B;  4QF2 A;  1MM3 A;  3GL6 A;  2OXQ C;  2VJE A;  2VNF A;  5I3L A;  4B86 C;  4AUQ B;  3M62 A;  2CSZ A;  2VJF A;  1XWH A;  4I7D A;  3ZPV 1;  5B8D A;  2RSD A;  4WA6 A;  3HTK C;  2LGL A;  2LQ6 A;  2JMI A;  1X4J A;  2YRE A;  1T1H A;  2KIZ A;  2F6J A;  4V3L C;  2DX8 A;  1VFY A;  5LKT A;  2VPD A;  1DVP A;  1FBV A;  4R7E A;  2YT5 A;  3LQH A;  2CKL A;  3O34 A;  5FB0 A;  5KH3 A; 
#chains in the Genus database with same CATH topology
 1WEM A;  2XP0 A;  1WEN A;  2C2L A;  2XOZ A;  2FUI A;  2LGK A;  1MM2 A;  1Z6U A;  5LKX A;  2LGV A;  3KV5 A;  5LKU A;  4MSX A;  5DIN A;  2CT2 A;  2KWK A;  2YQL A;  3E2D A;  1U6G B;  4Q6F A;  2EGP A;  4GNF A;  1WEV A;  3L1X A;  4OGE A;  2LXP C;  2CSY A;  1E4U A;  2M6M A;  3KV6 A;  2VPB A;  1JM7 B;  4ZUX U;  3FEH A;  3DQV R;  2E6S A;  3MHS A;  3MDB C;  2G6Q A;  4X3G A;  2IQJ A;  5B76 A;  2KKX A;  4P5O B;  4ZQL A;  2E61 A;  2YHO A;  5TAB A;  3L1Z B;  2NAA A;  3RPG B;  2MUM A;  4YBM A;  2RR4 A;  5J3X A;  1Z2Q A;  3N9N A;  3HCS A;  4CCG X;  2ECW A;  2CRR A;  2LN0 A;  3T7L A;  4L58 A;  2YUR A;  2JMJ A;  1FP0 A;  2FFW A;  4YAT A;  2B0O E;  5B79 A;  2K16 A;  4YAD A;  1WEE A;  2YSM A;  2EXU A;  3C6W A;  2ECV A;  2H0D B;  3H7H A;  2F6N A;  3SOX A;  2VP7 A;  3DPL R;  1IYM A;  2QIZ A;  3N9Q A;  2M3H A;  2MD8 C;  2FUU A;  2PNX A;  5EYA F;  2KWJ A;  4A0C D;  5FB1 A;  1HYI A;  2MNZ A;  3N9P A;  4F52 B;  4L7X A;  3N9M A;  1WFK A;  3O35 A;  3T9K A;  1DCQ A;  2MNY A;  5TBN A;  2VPE A;  5TRB A;  1G25 A;  2F42 A;  5C11 A;  4O64 A;  3I2D A;  2G45 A;  2AN6 A;  3KNV A;  2ZET C;  2ECN A;  3LQI A;  4WZ3 B;  3VK6 A;  5LCW B;  3LQJ A;  5TDW A;  4XI1 A;  5G0F A;  5H1V A;  5SVX A;  2JUN A;  2KWN A;  2LGG A;  3V43 A;  5FER A;  2LV9 A;  3HCU A;  3LVQ E;  2ECG A;  4LK9 A;  2LDR A;  2CSV A;  2LRI C;  2L0B A;  2PUY A;  2I50 A;  4UP5 A;  4W4U A;  4CA1 A;  1WIM A;  3EB5 A;  3M99 A;  4Z0O A;  1CHC A;  2EA6 A;  3LVR E;  5LKZ A;  4LKA A;  2VJE B;  3U5N A;  5B77 A;  3L11 A;  1VD4 A;  4YAB A;  2KGI A;  1K2F A;  4GNE A;  5KH9 A;  1MBM A;  1WEO A;  2CRW A;  3ZVZ B;  4YBS A;  2XOY A;  2JRJ A;  2QJ0 A;  4B7Y C;  2KGG A;  3O47 A;  3Q1D A;  5AIU A;  2ECT A;  1Z60 A;  3KQI A;  4MVT A;  2JM3 A;  2XOC A;  3FAO A;  3O33 A;  1RMD A;  2YSJ A;  5FEY A;  2HYE D;  1JOC A;  3FL2 A;  2YYR A;  4TKP B;  3MHH A;  3FAN A;  3RTR B;  5D1K B;  3SOW A;  2XB1 A;  3O37 A;  3SUB A;  4A49 A;  3PLW A;  3GV4 A;  3O7A A;  2G43 A;  4BBQ A;  4OGC A;  3KDE C;  4I7C A;  2VPG A;  4I7B A;  3NG2 A;  1WEP A;  4PPE A;  2BAY A;  3DWD A;  4IC2 A;  2EGM A;  3ZYQ A;  2K1J A;  2M85 A;  2KYU A;  3LDY A;  4QF3 A;  2CON A;  3N9O A;  4FJC A;  1WEQ A;  4GND A;  2KRE A;  2KWO A;  1JM7 A;  2KFT A;  2FSA A;  1N87 A;  3PHD A;  3U5M A;  4N3W A;  2L5U A;  4H9D A;  2KR4 A;  2Y1N A;  1VYX A;  3O36 A;  2YHN A;  2P57 A;  4V3K C;  2DJA A;  2D8U A;  3LJU X;  5H9M A;  4C9Z A;  2KKY A;  4FO9 A;  4A4B A;  2Y1M A;  2L7P A;  3JUE A;  5KH7 A;  1ZBD B;  2CKL B;  5K3Q A;  1HYJ A;  2M13 A;  4GNG A;  2E6R A;  2QIC A;  5D1L B;  4YBT A;  4R2Y A;  4LJN A;  4FIP A;  1X4I A;  2ECI A;  4LLB A;  4S3O C;  3ZPV E;  1V87 A;  2KE1 A;  2MT5 A;  1WEU A;  2OWA A;  4IC3 A;  3U5P A;  5DKA A;  4N4F A;  5G05 B;  1WIL A;  5SVY A;  2Y43 A;  5H1U A;  5AIT A;  3ZNI A;  4UP0 A;  3ZTG A;  5B75 A;  4AYC B;  2YUC A;  4Z0R A;  4AP4 A;  2MKE A;  2EOD A;  2M1R A;  2MD7 B;  4NN2 A;  5D1M B;  2DSM A;  1F62 A;  5G04 B;  1WGM A;  2L43 A;  4UI9 B;  3C5K A;  2H0D A;  4WZ2 A;  1BOR A;  1WE9 A;  5C13 A;  2YVR A;  4LAD B;  2UZG A;  4ZDT A;  1WEW A;  5JG6 A;  3PUQ A;  3T6R A;  5TDR A;  3N9L A;  3ZVY A;  4A4C A;  4AYC A;  5H1T A;  2KU3 A;  4FK5 A;  4AVX A;  3FM8 C;  4WZ0 A;  1LDJ B;  1WES A;  4GB0 A;  2D8S A;  2LXH C;  1X4U A;  4BHW A;  3EB6 A;  2YQM A;  4QQ4 A;  4PTB A;  3LRQ A;  4YAX A;  3PUR A;  3DDT A;  4YC9 A;  2YW8 A;  3QZV A;  2MA6 A;  3RPG C;  3IHP A;  2L75 A;  3SOU A;  2ECJ A;  3O70 A;  5SVI B;  3ASL A;  4F1P A;  3U5O A;  2JMD A;  2K17 A;  2K4D A;  4R8P K;  2IDA A;  2MIQ A;  2XEU A;  2MA5 A;  2VJF B;  3M63 A;  2HDP A;  2RI7 A;  5B78 A;  3SHB A;  2YU4 A;  3HCT A;  1LDK C;  2L80 A;  2C2V S;  4S3O B;  4QF2 A;  3FJU B;  1MM3 A;  3GL6 A;  5SVI A;  2LAU A;  2OXQ C;  2VJE A;  2VNF A;  5I3L A;  4B86 C;  4AUQ B;  3M62 A;  2CSZ A;  2VJF A;  1XWH A;  4I7D A;  3ZPV 1;  4O62 A;  2RSD A;  5B8D A;  4WA6 A;  3M7K A;  3HTK C;  2LGL A;  2LQ6 A;  2JMI A;  2FD4 A;  1X4J A;  2YRE A;  1T1H A;  2KIZ A;  2F6J A;  4V3L C;  2DX8 A;  1VFY A;  5LKT A;  2VPD A;  1DVP A;  1FBV A;  4R7E A;  2YT5 A;  3LQH A;  2CKL A;  3O34 A;  5FB0 A;  5KH3 A; 
#chains in the Genus database with same CATH homology
 1WEM A;  1WEN A;  2C2L A;  2FUI A;  2LGK A;  1MM2 A;  1Z6U A;  5LKX A;  2LGV A;  3KV5 A;  5LKU A;  4MSX A;  5DIN A;  2CT2 A;  2KWK A;  2YQL A;  1U6G B;  4Q6F A;  2EGP A;  4GNF A;  1WEV A;  3L1X A;  2LXP C;  2CSY A;  1E4U A;  2M6M A;  3KV6 A;  2VPB A;  1JM7 B;  4ZUX U;  3DQV R;  2E6S A;  3MHS A;  2G6Q A;  4X3G A;  5B76 A;  4P5O B;  4ZQL A;  2YHO A;  5TAB A;  3L1Z B;  2NAA A;  3RPG B;  2MUM A;  4YBM A;  5J3X A;  1Z2Q A;  3N9N A;  3HCS A;  4CCG X;  2ECW A;  2LN0 A;  3T7L A;  4L58 A;  2YUR A;  2JMJ A;  1FP0 A;  4YAT A;  5B79 A;  2K16 A;  4YAD A;  1WEE A;  2YSM A;  3C6W A;  2ECV A;  2H0D B;  2F6N A;  3SOX A;  2VP7 A;  3DPL R;  1IYM A;  2QIZ A;  3N9Q A;  2M3H A;  2MD8 C;  2FUU A;  2PNX A;  5EYA F;  4A0C D;  2KWJ A;  5FB1 A;  1HYI A;  2MNZ A;  3N9P A;  4F52 B;  4L7X A;  3N9M A;  1WFK A;  3O35 A;  2MNY A;  5TBN A;  2VPE A;  5TRB A;  1G25 A;  2F42 A;  5C11 A;  4O64 A;  3I2D A;  2G45 A;  2AN6 A;  3KNV A;  2ZET C;  2ECN A;  3LQI A;  4WZ3 B;  3VK6 A;  5LCW B;  3LQJ A;  5TDW A;  4XI1 A;  5G0F A;  5H1V A;  2KWN A;  2LGG A;  3V43 A;  5FER A;  2LV9 A;  3HCU A;  2ECG A;  4LK9 A;  2LDR A;  2LRI C;  2L0B A;  2PUY A;  2I50 A;  4UP5 A;  4W4U A;  4CA1 A;  1WIM A;  3EB5 A;  3M99 A;  1CHC A;  2EA6 A;  5LKZ A;  4LKA A;  2VJE B;  3U5N A;  5B77 A;  3L11 A;  1VD4 A;  4YAB A;  2KGI A;  1K2F A;  4GNE A;  5KH9 A;  1WEO A;  3ZVZ B;  4YBS A;  2JRJ A;  2QJ0 A;  4B7Y C;  2KGG A;  5AIU A;  2ECT A;  1Z60 A;  3KQI A;  4MVT A;  3O33 A;  1RMD A;  2YSJ A;  5FEY A;  2HYE D;  1JOC A;  3FL2 A;  2YYR A;  4TKP B;  3MHH A;  3RTR B;  5D1K B;  3SOW A;  2XB1 A;  3O37 A;  4A49 A;  3GV4 A;  3O7A A;  2G43 A;  4BBQ A;  4I7C A;  2VPG A;  4I7B A;  3NG2 A;  1WEP A;  4PPE A;  2BAY A;  4IC2 A;  3ZYQ A;  2K1J A;  2M85 A;  2KYU A;  4QF3 A;  3N9O A;  4FJC A;  1WEQ A;  4GND A;  2KRE A;  2KWO A;  1JM7 A;  2KFT A;  2FSA A;  1N87 A;  3PHD A;  3U5M A;  4N3W A;  2L5U A;  2KR4 A;  2Y1N A;  1VYX A;  3O36 A;  2YHN A;  4V3K C;  5H9M A;  4C9Z A;  4FO9 A;  4A4B A;  2Y1M A;  5KH7 A;  1ZBD B;  2CKL B;  1HYJ A;  4GNG A;  2E6R A;  2QIC A;  5D1L B;  4YBT A;  4R2Y A;  4LJN A;  4FIP A;  1X4I A;  2ECI A;  4LLB A;  4S3O C;  3ZPV E;  1V87 A;  2KE1 A;  2MT5 A;  1WEU A;  4IC3 A;  3U5P A;  5DKA A;  4N4F A;  5G05 B;  1WIL A;  2Y43 A;  5H1U A;  5AIT A;  3ZNI A;  4UP0 A;  3ZTG A;  5B75 A;  4AYC B;  2YUC A;  4AP4 A;  2EOD A;  2M1R A;  2MD7 B;  4NN2 A;  5D1M B;  1F62 A;  5G04 B;  1WGM A;  2L43 A;  4UI9 B;  3C5K A;  2H0D A;  4WZ2 A;  1BOR A;  1WE9 A;  5C13 A;  4LAD B;  2UZG A;  4ZDT A;  1WEW A;  5JG6 A;  3PUQ A;  3T6R A;  5TDR A;  3N9L A;  3ZVY A;  4A4C A;  4AYC A;  5H1T A;  2KU3 A;  4FK5 A;  4AVX A;  4WZ0 A;  1LDJ B;  1WES A;  4GB0 A;  2D8S A;  2LXH C;  1X4U A;  4BHW A;  3EB6 A;  2YQM A;  4PTB A;  3LRQ A;  4YAX A;  3PUR A;  4YC9 A;  2YW8 A;  3QZV A;  2MA6 A;  3RPG C;  3IHP A;  2L75 A;  3SOU A;  2ECJ A;  3O70 A;  3ASL A;  3U5O A;  2JMD A;  2K17 A;  2K4D A;  4R8P K;  2IDA A;  2MIQ A;  2XEU A;  2MA5 A;  2VJF B;  3M63 A;  2HDP A;  2RI7 A;  5B78 A;  3SHB A;  2YU4 A;  3HCT A;  1LDK C;  2L80 A;  2C2V S;  4S3O B;  4QF2 A;  1MM3 A;  3GL6 A;  2OXQ C;  2VJE A;  2VNF A;  5I3L A;  4B86 C;  4AUQ B;  3M62 A;  2CSZ A;  2VJF A;  1XWH A;  4I7D A;  3ZPV 1;  5B8D A;  2RSD A;  4WA6 A;  3HTK C;  2LGL A;  2LQ6 A;  2JMI A;  1X4J A;  2YRE A;  1T1H A;  2KIZ A;  2F6J A;  4V3L C;  2DX8 A;  1VFY A;  5LKT A;  2VPD A;  1DVP A;  1FBV A;  4R7E A;  2YT5 A;  3LQH A;  2CKL A;  3O34 A;  5FB0 A;  5KH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...