5AITA

A complex of of rnf4-ring domain, ubev2, ubc13-ub (isopeptide crosslink)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
129
structure length
129
Chain Sequence
b'SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYIGSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF4
publication title Structural Basis for the Ring Catalyzed Synthesis of K63 Linked Ubiquitin Chains
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase/signaling protein
total genus 21
structure length 129
sequence length 129
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5aitA00
3KV5A 4BBQA 2YUCA 2ECJA 5FEYA 2LGLA 4FK5A 2C2VS 2LXPC 2ECGA 3NG2A 3GL6A 2IDAA 4S3OC 4PPEA 2H0DA 3C5KA 3N9NA 3VK6A 2LV9A 2KWNA 2Y43A 4B86C 4WZ2A 2MD8C 5H1TA 2F42A 1N87A 4GNFA 1WEUA 5B8DA 2YREA 2D8SA 1VYXA 2Y1NA 2XEUA 1T1HA 5KH7A 2YT5A 3U5NA 2VPDA 2ECVA 5B77A 2FUUA 2CSZA 2LXHC 1Z2QA 1U6GB 4GNEA 3ZPV1 2VJFB 3MHHA 2L75A 5TABA 3PURA 3KQIA 3IHPA 2QICA 3C6WA 4WA6A 5DINA 2L80A 4X3GA 4L7XA 5B75A 2VPGA 2K4DA 2KIZA 1WEQA 4YATA 3ZTGA 3N9OA 4A4BA 5TRBA 2G43A 2KREA 2LRIC 4I7DA 3L1XA 3O7AA 2K1JA 2FUIA 2LN0A 2RI7A 5G04B 1G25A 1WEMA 4V3KC 4UP0A 3M62A 3LQIA 2LDRA 3V43A 3RPGC 2OXQC 2HDPA 2CKLA 3ZVZB 3LRQA 2AN6A 2G6QA 2HYED 3O34A 4I7BA 3N9MA 5AIUA 4LLBA 3SHBA 2F6JA 2YHNA 3O70A 5TBNA 5TDWA 2QIZA 5FB0A 4GB0A 5LCWB 1RMDA 2JRJA 3HCUA 1K2FA 4V3LC 2FSAA 2KWOA 4LKAA 2YQMA 5C11A 5KH3A 2EGPA 4WZ0A 3N9PA 5LKXA 3PHDA 3T6RA 4ZDTA 3ZPVE 5D1MB 2MA6A 4R7EA 4R2YA 4L58A 1VD4A 2YW8A 3RTRB 2RSDA 2LGGA 4A4CA 3EB5A 2LQ6A 2KFTA 2F6NA 4P5OB 1WENA 2KU3A 4GNGA 3QZVA 4MVTA 1FBVA 3SOXA 1WE9A 5C13A 1ZBDB 1BORA 1V87A 4LJNA 5AITA 1F62A 3KV6A 3DQVR 4QF3A 3HCSA 1WEWA 2KR4A 3MHSA 2M6MA 3L1ZB 5LKTA 2VJFA 3U5MA 2M3HA 5H1UA 1X4JA 2ECNA 2K16A 2L0BA 2PNXA 2C2LA 4I7CA 4YC9A 4CCGX 4XI1A 1WEEA 2KGGA 5FERA 4W4UA 3LQHA 3O35A 5G0FA 4BHWA 4O64A 2VP7A 5LKUA 2VPEA 2UZGA 3RPGB 3ASLA 3O33A 2YYRA 2JMDA 4N3WA 1VFYA 1E4UA 2XB1A 3O36A 4MSXA 3HTKC 1WEVA 2BAYA 2YU4A 2QJ0A 2G45A 1X4IA 2YURA 4UI9B 5B78A 5FB1A 2MUMA 1Z60A 5D1KB 2LGKA 3N9QA 1IYMA 2E6RA 2L43A 2JMIA 4LK9A 2KGIA 4A0CD 2ZETC 5H1VA 5H9MA 2YSMA 4S3OB 2MIQA 4N4FA 3SOUA 1CHCA 5EYAF 4PTBA 3L11A 2MT5A 2MNYA 2CSYA 2NAAA 2K17A 1XWHA 1WILA 1WFKA 4YBTA 4TKPB 4FIPA 3KNVA 4ZQLA 2MNZA 2H0DB 2ECTA 3DPLR 2M85A 4AP4A 2I50A 1Z6UA 4YADA 5DKAA 2YHOA 4UP5A 4CA1A 1WGMA 3ZYQA 2JMJA 4R8PK 2ECIA 3ZVYA 4C9ZA 4IC3A 5TDRA 4FO9A 4IC2A 1HYIA 4GNDA 3LQJA 2DX8A 2VPBA 1HYJA 2KWKA 1WESA 2VJEB 2YQLA 4B7YC 1JOCA 1X4UA 5KH9A 2VJEA 5I3LA 2Y1MA 4A49A 3M99A 1WEOA 5JG6A 2LGVA 2PUYA 2EA6A 1FP0A 3T7LA 5LKZA 4YBMA 5D1LB 3GV4A 5G05B 4FJCA 1MM3A 2YSJA 2VNFA 1LDKC 3I2DA 3O37A 3PUQA 2E6SA 2KYUA 1JM7B 4NN2A 3FL2A 2CT2A 4QF2A 2CKLB 2KWJA 1JM7A 2EODA 2L5UA 5J3XA 4AYCB 4YAXA 4WZ3B 1MM2A 2KE1A 1DVPA 4F52B 1WIMA 3EB6A 2M1RA 4AYCA 3U5PA 4AVXA 4YABA 2MA5A 2ECWA 4LADB 3ZNIA 3HCTA 4YBSA 5B79A 3U5OA 2MD7B 3M63A 4Q6FA 4ZUXU 1LDJB 3SOWA 4AUQB 5B76A 1WEPA 3N9LA
chains in the Genus database with same CATH superfamily
3KV5A 4BBQA 2YUCA 2ECJA 5FEYA 2LGLA 4FK5A 2C2VS 2LXPC 2ECGA 3NG2A 3GL6A 2IDAA 5SVIA 4S3OC 4PPEA 4Z0RA 3E2DA 2H0DA 3C5KA 3N9NA 2EXUA 3VK6A 2LV9A 2KWNA 2Y43A 4B86C 4WZ2A 2MD8C 5H1TA 2F42A 1N87A 4GNFA 1WEUA 5B8DA 2YREA 2D8SA 2XOZA 4OGCA 1VYXA 2Y1NA 2XEUA 1T1HA 5KH7A 2YT5A 3U5NA 2VPDA 2ECVA 5B77A 2FUUA 2P57A 2CSZA 2LXHC 1Z2QA 2EGMA 1U6GB 4GNEA 3ZPV1 2VJFB 3MHHA 2XOCA 2L75A 5TABA 3PURA 3KQIA 3IHPA 2QICA 3C6WA 4WA6A 5DINA 2L7PA 2L80A 4X3GA 2CSVA 4L7XA 5B75A 2VPGA 3FEHA 2K4DA 2KIZA 1WEQA 4YATA 3ZTGA 3KDEC 3N9OA 2E61A 4A4BA 5TRBA 2G43A 3LVQE 2KREA 2LRIC 4I7DA 3L1XA 3Q1DA 3O7AA 2K1JA 1MBMA 2FUIA 2DSMA 2LN0A 2RI7A 5G04B 1G25A 1WEMA 4V3KC 2LAUA 4UP0A 3M62A 3LQIA 2LDRA 3V43A 3RPGC 2OXQC 2HDPA 2JM3A 2CKLA 3ZVZB 3LRQA 3FM8C 2AN6A 2G6QA 2HYED 3O34A 4I7BA 3N9MA 5AIUA 4LLBA 5SVXA 3SHBA 2IQJA 2F6JA 2YHNA 3O70A 5TBNA 5TDWA 2QIZA 2CRWA 2D8UA 5FB0A 4GB0A 5LCWB 1RMDA 2JRJA 3HCUA 1K2FA 4V3LC 2FSAA 2KWOA 4LKAA 2YQMA 5C11A 3LDYA 4F1PA 5KH3A 2EGPA 4WZ0A 2OWAA 3N9PA 5LKXA 3PHDA 3T6RA 4ZDTA 3ZPVE 5D1MB 2MA6A 4R7EA 4R2YA 4L58A 1VD4A 2YW8A 3RTRB 2RSDA 2LGGA 4A4CA 3EB5A 2LQ6A 2KFTA 2F6NA 4P5OB 1WENA 2KU3A 4GNGA 3QZVA 2KKYA 4MVTA 1FBVA 3SOXA 1WE9A 5C13A 1ZBDB 1BORA 3SUBA 1V87A 4LJNA 2KKXA 5AITA 1F62A 3KV6A 4QF3A 1DCQA 3DQVR 3HCSA 1WEWA 2KR4A 3MHSA 2M6MA 4Z0OA 3L1ZB 3PLWA 3LJUX 5LKTA 2VJFA 3U5MA 2JUNA 2M3HA 5H1UA 1X4JA 2ECNA 2K16A 2L0BA 2PNXA 2C2LA 4I7CA 4YC9A 4CCGX 4XI1A 1WEEA 2KGGA 5FERA 4W4UA 2DJAA 3LQHA 2CRRA 3O35A 5G0FA 4BHWA 4O64A 2VP7A 3M7KA 5LKUA 4H9DA 2VPEA 2MKEA 2UZGA 3RPGB 3ASLA 3O33A 2YYRA 2JMDA 4N3WA 1VFYA 1E4UA 2XB1A 3O36A 4MSXA 3HTKC 1WEVA 2BAYA 2YU4A 2FD4A 2QJ0A 4QQ4A 2G45A 1X4IA 2YURA 4UI9B 5B78A 5FB1A 2MUMA 1Z60A 5D1KB 2LGKA 3N9QA 1IYMA 2E6RA 2L43A 2JMIA 4LK9A 2KGIA 4A0CD 2ZETC 5H1VA 3FJUB 5H9MA 2YSMA 4S3OB 5SVYA 2MIQA 4N4FA 3SOUA 1CHCA 5EYAF 3MDBC 4PTBA 3L11A 2MT5A 2MNYA 2CSYA 3FANA 5SVIB 2NAAA 2K17A 1XWHA 1WILA 1WFKA 3JUEA 4YBTA 4TKPB 4FIPA 3KNVA 4ZQLA 2MNZA 2H0DB 2ECTA 3DPLR 2M85A 4AP4A 2I50A 4OGEA 1Z6UA 4YADA 2XOYA 2M13A 5DKAA 2YHOA 4UP5A 4CA1A 1WGMA 3ZYQA 2JMJA 4R8PK 2ECIA 3ZVYA 4C9ZA 4IC3A 5TDRA 4FO9A 4IC2A 1HYIA 4GNDA 3LQJA 2DX8A 2CONA 2YVRA 2RR4A 2XP0A 2VPBA 1HYJA 2KWKA 1WESA 2VJEB 2YQLA 4B7YC 3DWDA 1JOCA 1X4UA 5KH9A 2VJEA 5I3LA 2Y1MA 4A49A 3M99A 1WEOA 5JG6A 2LGVA 3H7HA 2PUYA 2EA6A 1FP0A 3T7LA 5LKZA 4YBMA 5D1LB 3GV4A 5G05B 3T9KA 4FJCA 1MM3A 2B0OE 2YSJA 2VNFA 3LVRE 1LDKC 3I2DA 3O37A 3PUQA 2E6SA 2KYUA 1JM7B 4NN2A 3FL2A 2CT2A 4QF2A 3DDTA 2CKLB 2KWJA 1JM7A 2EODA 2L5UA 3O47A 5J3XA 5K3QA 4AYCB 4YAXA 4WZ3B 1MM2A 2KE1A 1DVPA 4F52B 1WIMA 3EB6A 2M1RA 4AYCA 3U5PA 4AVXA 4YABA 2MA5A 2ECWA 4LADB 3ZNIA 3HCTA 4YBSA 5B79A 3U5OA 2MD7B 3M63A 4Q6FA 4ZUXU 1LDJB 2FFWA 3FAOA 3SOWA 4AUQB 4O62A 5B76A 1WEPA 3N9LA
chains in the Genus database with same CATH topology
3KV5A 4BBQA 2YUCA 2ECJA 5FEYA 2LGLA 4FK5A 2C2VS 2LXPC 2ECGA 3NG2A 3GL6A 2IDAA 4S3OC 4PPEA 2H0DA 3C5KA 3N9NA 3VK6A 2LV9A 2KWNA 2Y43A 4B86C 4WZ2A 2MD8C 5H1TA 2F42A 1N87A 4GNFA 1WEUA 5B8DA 2YREA 2D8SA 1VYXA 2Y1NA 2XEUA 1T1HA 5KH7A 2YT5A 3U5NA 2VPDA 2ECVA 5B77A 2FUUA 2CSZA 2LXHC 1Z2QA 1U6GB 4GNEA 3ZPV1 2VJFB 3MHHA 2L75A 5TABA 3PURA 3KQIA 3IHPA 2QICA 3C6WA 4WA6A 5DINA 2L80A 4X3GA 4L7XA 5B75A 2VPGA 2K4DA 2KIZA 1WEQA 4YATA 3ZTGA 3N9OA 4A4BA 5TRBA 2G43A 2KREA 2LRIC 4I7DA 3L1XA 3O7AA 2K1JA 2FUIA 2LN0A 2RI7A 5G04B 1G25A 1WEMA 4V3KC 4UP0A 3M62A 3LQIA 2LDRA 3V43A 3RPGC 2OXQC 2HDPA 2CKLA 3ZVZB 3LRQA 2AN6A 2G6QA 2HYED 3O34A 4I7BA 3N9MA 5AIUA 4LLBA 3SHBA 2F6JA 2YHNA 3O70A 5TBNA 5TDWA 2QIZA 5FB0A 4GB0A 5LCWB 1RMDA 2JRJA 3HCUA 1K2FA 4V3LC 2FSAA 2KWOA 4LKAA 2YQMA 5C11A 5KH3A 2EGPA 4WZ0A 3N9PA 5LKXA 3PHDA 3T6RA 4ZDTA 3ZPVE 5D1MB 2MA6A 4R7EA 4R2YA 4L58A 1VD4A 2YW8A 3RTRB 2RSDA 2LGGA 4A4CA 3EB5A 2LQ6A 2KFTA 2F6NA 4P5OB 1WENA 2KU3A 4GNGA 3QZVA 4MVTA 1FBVA 3SOXA 1WE9A 5C13A 1ZBDB 1BORA 1V87A 4LJNA 5AITA 1F62A 3KV6A 3DQVR 4QF3A 3HCSA 1WEWA 2KR4A 3MHSA 2M6MA 3L1ZB 5LKTA 2VJFA 3U5MA 2M3HA 5H1UA 1X4JA 2ECNA 2K16A 2L0BA 2PNXA 2C2LA 4I7CA 4YC9A 4CCGX 4XI1A 1WEEA 2KGGA 5FERA 4W4UA 3LQHA 3O35A 5G0FA 4BHWA 4O64A 2VP7A 5LKUA 2VPEA 2UZGA 3RPGB 3ASLA 3O33A 2YYRA 2JMDA 4N3WA 1VFYA 1E4UA 2XB1A 3O36A 4MSXA 3HTKC 1WEVA 2BAYA 2YU4A 2QJ0A 2G45A 1X4IA 2YURA 4UI9B 5B78A 5FB1A 2MUMA 1Z60A 5D1KB 2LGKA 3N9QA 1IYMA 2E6RA 2L43A 2JMIA 4LK9A 2KGIA 4A0CD 2ZETC 5H1VA 5H9MA 2YSMA 4S3OB 2MIQA 4N4FA 3SOUA 1CHCA 5EYAF 4PTBA 3L11A 2MT5A 2MNYA 2CSYA 2NAAA 2K17A 1XWHA 1WILA 1WFKA 4YBTA 4TKPB 4FIPA 3KNVA 4ZQLA 2MNZA 2H0DB 2ECTA 3DPLR 2M85A 4AP4A 2I50A 1Z6UA 4YADA 5DKAA 2YHOA 4UP5A 4CA1A 1WGMA 3ZYQA 2JMJA 4R8PK 2ECIA 3ZVYA 4C9ZA 4IC3A 5TDRA 4FO9A 4IC2A 1HYIA 4GNDA 3LQJA 2DX8A 2VPBA 1HYJA 2KWKA 1WESA 2VJEB 2YQLA 4B7YC 1JOCA 1X4UA 5KH9A 2VJEA 5I3LA 2Y1MA 4A49A 3M99A 1WEOA 5JG6A 2LGVA 2PUYA 2EA6A 1FP0A 3T7LA 5LKZA 4YBMA 5D1LB 3GV4A 5G05B 4FJCA 1MM3A 2YSJA 2VNFA 1LDKC 3I2DA 3O37A 3PUQA 2E6SA 2KYUA 1JM7B 4NN2A 3FL2A 2CT2A 4QF2A 2CKLB 2KWJA 1JM7A 2EODA 2L5UA 5J3XA 4AYCB 4YAXA 4WZ3B 1MM2A 2KE1A 1DVPA 4F52B 1WIMA 3EB6A 2M1RA 4AYCA 3U5PA 4AVXA 4YABA 2MA5A 2ECWA 4LADB 3ZNIA 3HCTA 4YBSA 5B79A 3U5OA 2MD7B 3M63A 4Q6FA 4ZUXU 1LDJB 3SOWA 4AUQB 5B76A 1WEPA 3N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV5 A;  4BBQ A;  2YUC A;  2ECJ A;  5FEY A;  2LGL A;  4FK5 A;  2C2V S;  2LXP C;  2ECG A;  3NG2 A;  3GL6 A;  2IDA A;  4S3O C;  4PPE A;  2H0D A;  3C5K A;  3N9N A;  3VK6 A;  2LV9 A;  2KWN A;  2Y43 A;  4B86 C;  4WZ2 A;  2MD8 C;  5H1T A;  2F42 A;  1N87 A;  4GNF A;  1WEU A;  5B8D A;  2YRE A;  2D8S A;  1VYX A;  2Y1N A;  2XEU A;  1T1H A;  5KH7 A;  2YT5 A;  3U5N A;  2VPD A;  2ECV A;  5B77 A;  2FUU A;  2CSZ A;  2LXH C;  1Z2Q A;  1U6G B;  4GNE A;  3ZPV 1;  2VJF B;  3MHH A;  2L75 A;  5TAB A;  3PUR A;  3KQI A;  3IHP A;  2QIC A;  3C6W A;  4WA6 A;  5DIN A;  2L80 A;  4X3G A;  4L7X A;  5B75 A;  2VPG A;  2K4D A;  2KIZ A;  1WEQ A;  4YAT A;  3ZTG A;  3N9O A;  4A4B A;  5TRB A;  2G43 A;  2KRE A;  2LRI C;  4I7D A;  3L1X A;  3O7A A;  2K1J A;  2FUI A;  2LN0 A;  2RI7 A;  5G04 B;  1G25 A;  1WEM A;  4V3K C;  4UP0 A;  3M62 A;  3LQI A;  2LDR A;  3V43 A;  3RPG C;  2OXQ C;  2HDP A;  2CKL A;  3ZVZ B;  3LRQ A;  2AN6 A;  2G6Q A;  2HYE D;  3O34 A;  4I7B A;  3N9M A;  5AIU A;  4LLB A;  3SHB A;  2F6J A;  2YHN A;  3O70 A;  5TBN A;  5TDW A;  2QIZ A;  5FB0 A;  4GB0 A;  5LCW B;  1RMD A;  2JRJ A;  3HCU A;  1K2F A;  4V3L C;  2FSA A;  2KWO A;  4LKA A;  2YQM A;  5C11 A;  5KH3 A;  2EGP A;  4WZ0 A;  3N9P A;  5LKX A;  3PHD A;  3T6R A;  4ZDT A;  3ZPV E;  5D1M B;  2MA6 A;  4R7E A;  4R2Y A;  4L58 A;  1VD4 A;  2YW8 A;  3RTR B;  2RSD A;  2LGG A;  4A4C A;  3EB5 A;  2LQ6 A;  2KFT A;  2F6N A;  4P5O B;  1WEN A;  2KU3 A;  4GNG A;  3QZV A;  4MVT A;  1FBV A;  3SOX A;  1WE9 A;  5C13 A;  1ZBD B;  1BOR A;  1V87 A;  4LJN A;  5AIT A;  1F62 A;  3KV6 A;  3DQV R;  4QF3 A;  3HCS A;  1WEW A;  2KR4 A;  3MHS A;  2M6M A;  3L1Z B;  5LKT A;  2VJF A;  3U5M A;  2M3H A;  5H1U A;  1X4J A;  2ECN A;  2K16 A;  2L0B A;  2PNX A;  2C2L A;  4I7C A;  4YC9 A;  4CCG X;  4XI1 A;  1WEE A;  2KGG A;  5FER A;  4W4U A;  3LQH A;  3O35 A;  5G0F A;  4BHW A;  4O64 A;  2VP7 A;  5LKU A;  2VPE A;  2UZG A;  3RPG B;  3ASL A;  3O33 A;  2YYR A;  2JMD A;  4N3W A;  1VFY A;  1E4U A;  2XB1 A;  3O36 A;  4MSX A;  3HTK C;  1WEV A;  2BAY A;  2YU4 A;  2QJ0 A;  2G45 A;  1X4I A;  2YUR A;  4UI9 B;  5B78 A;  5FB1 A;  2MUM A;  1Z60 A;  5D1K B;  2LGK A;  3N9Q A;  1IYM A;  2E6R A;  2L43 A;  2JMI A;  4LK9 A;  2KGI A;  4A0C D;  2ZET C;  5H1V A;  5H9M A;  2YSM A;  4S3O B;  2MIQ A;  4N4F A;  3SOU A;  1CHC A;  5EYA F;  4PTB A;  3L11 A;  2MT5 A;  2MNY A;  2CSY A;  2NAA A;  2K17 A;  1XWH A;  1WIL A;  1WFK A;  4YBT A;  4TKP B;  4FIP A;  3KNV A;  4ZQL A;  2MNZ A;  2H0D B;  2ECT A;  3DPL R;  2M85 A;  4AP4 A;  2I50 A;  1Z6U A;  4YAD A;  5DKA A;  2YHO A;  4UP5 A;  4CA1 A;  1WGM A;  3ZYQ A;  2JMJ A;  4R8P K;  2ECI A;  3ZVY A;  4C9Z A;  4IC3 A;  5TDR A;  4FO9 A;  4IC2 A;  1HYI A;  4GND A;  3LQJ A;  2DX8 A;  2VPB A;  1HYJ A;  2KWK A;  1WES A;  2VJE B;  2YQL A;  4B7Y C;  1JOC A;  1X4U A;  5KH9 A;  2VJE A;  5I3L A;  2Y1M A;  4A49 A;  3M99 A;  1WEO A;  5JG6 A;  2LGV A;  2PUY A;  2EA6 A;  1FP0 A;  3T7L A;  5LKZ A;  4YBM A;  5D1L B;  3GV4 A;  5G05 B;  4FJC A;  1MM3 A;  2YSJ A;  2VNF A;  1LDK C;  3I2D A;  3O37 A;  3PUQ A;  2E6S A;  2KYU A;  1JM7 B;  4NN2 A;  3FL2 A;  2CT2 A;  4QF2 A;  2CKL B;  2KWJ A;  1JM7 A;  2EOD A;  2L5U A;  5J3X A;  4AYC B;  4YAX A;  4WZ3 B;  1MM2 A;  2KE1 A;  1DVP A;  4F52 B;  1WIM A;  3EB6 A;  2M1R A;  4AYC A;  3U5P A;  4AVX A;  4YAB A;  2MA5 A;  2ECW A;  4LAD B;  3ZNI A;  3HCT A;  4YBS A;  5B79 A;  3U5O A;  2MD7 B;  3M63 A;  4Q6F A;  4ZUX U;  1LDJ B;  3SOW A;  4AUQ B;  5B76 A;  1WEP A;  3N9L A; 
#chains in the Genus database with same CATH topology
 3KV5 A;  4BBQ A;  2YUC A;  2ECJ A;  5FEY A;  2LGL A;  4FK5 A;  2C2V S;  2LXP C;  2ECG A;  3NG2 A;  3GL6 A;  2IDA A;  5SVI A;  4S3O C;  4PPE A;  4Z0R A;  3E2D A;  2H0D A;  3C5K A;  3N9N A;  2EXU A;  3VK6 A;  2LV9 A;  2KWN A;  2Y43 A;  4B86 C;  4WZ2 A;  2MD8 C;  5H1T A;  2F42 A;  1N87 A;  4GNF A;  1WEU A;  5B8D A;  2YRE A;  2D8S A;  2XOZ A;  4OGC A;  1VYX A;  2Y1N A;  2XEU A;  1T1H A;  5KH7 A;  2YT5 A;  3U5N A;  2VPD A;  2ECV A;  5B77 A;  2FUU A;  2P57 A;  2CSZ A;  2LXH C;  1Z2Q A;  2EGM A;  1U6G B;  4GNE A;  3ZPV 1;  2VJF B;  3MHH A;  2XOC A;  2L75 A;  5TAB A;  3PUR A;  3KQI A;  3IHP A;  2QIC A;  3C6W A;  4WA6 A;  5DIN A;  2L7P A;  2L80 A;  4X3G A;  2CSV A;  4L7X A;  5B75 A;  2VPG A;  3FEH A;  2K4D A;  2KIZ A;  1WEQ A;  4YAT A;  3ZTG A;  3KDE C;  3N9O A;  2E61 A;  4A4B A;  5TRB A;  2G43 A;  3LVQ E;  2KRE A;  2LRI C;  4I7D A;  3L1X A;  3Q1D A;  3O7A A;  2K1J A;  1MBM A;  2FUI A;  2DSM A;  2LN0 A;  2RI7 A;  5G04 B;  1G25 A;  1WEM A;  4V3K C;  2LAU A;  4UP0 A;  3M62 A;  3LQI A;  2LDR A;  3V43 A;  3RPG C;  2OXQ C;  2HDP A;  2JM3 A;  2CKL A;  3ZVZ B;  3LRQ A;  3FM8 C;  2AN6 A;  2G6Q A;  2HYE D;  3O34 A;  4I7B A;  3N9M A;  5AIU A;  4LLB A;  5SVX A;  3SHB A;  2IQJ A;  2F6J A;  2YHN A;  3O70 A;  5TBN A;  5TDW A;  2QIZ A;  2CRW A;  2D8U A;  5FB0 A;  4GB0 A;  5LCW B;  1RMD A;  2JRJ A;  3HCU A;  1K2F A;  4V3L C;  2FSA A;  2KWO A;  4LKA A;  2YQM A;  5C11 A;  3LDY A;  4F1P A;  5KH3 A;  2EGP A;  4WZ0 A;  2OWA A;  3N9P A;  5LKX A;  3PHD A;  3T6R A;  4ZDT A;  3ZPV E;  5D1M B;  2MA6 A;  4R7E A;  4R2Y A;  4L58 A;  1VD4 A;  2YW8 A;  3RTR B;  2RSD A;  2LGG A;  4A4C A;  3EB5 A;  2LQ6 A;  2KFT A;  2F6N A;  4P5O B;  1WEN A;  2KU3 A;  4GNG A;  3QZV A;  2KKY A;  4MVT A;  1FBV A;  3SOX A;  1WE9 A;  5C13 A;  1ZBD B;  1BOR A;  3SUB A;  1V87 A;  4LJN A;  2KKX A;  5AIT A;  1F62 A;  3KV6 A;  4QF3 A;  1DCQ A;  3DQV R;  3HCS A;  1WEW A;  2KR4 A;  3MHS A;  2M6M A;  4Z0O A;  3L1Z B;  3PLW A;  3LJU X;  5LKT A;  2VJF A;  3U5M A;  2JUN A;  2M3H A;  5H1U A;  1X4J A;  2ECN A;  2K16 A;  2L0B A;  2PNX A;  2C2L A;  4I7C A;  4YC9 A;  4CCG X;  4XI1 A;  1WEE A;  2KGG A;  5FER A;  4W4U A;  2DJA A;  3LQH A;  2CRR A;  3O35 A;  5G0F A;  4BHW A;  4O64 A;  2VP7 A;  3M7K A;  5LKU A;  4H9D A;  2VPE A;  2MKE A;  2UZG A;  3RPG B;  3ASL A;  3O33 A;  2YYR A;  2JMD A;  4N3W A;  1VFY A;  1E4U A;  2XB1 A;  3O36 A;  4MSX A;  3HTK C;  1WEV A;  2BAY A;  2YU4 A;  2FD4 A;  2QJ0 A;  4QQ4 A;  2G45 A;  1X4I A;  2YUR A;  4UI9 B;  5B78 A;  5FB1 A;  2MUM A;  1Z60 A;  5D1K B;  2LGK A;  3N9Q A;  1IYM A;  2E6R A;  2L43 A;  2JMI A;  4LK9 A;  2KGI A;  4A0C D;  2ZET C;  5H1V A;  3FJU B;  5H9M A;  2YSM A;  4S3O B;  5SVY A;  2MIQ A;  4N4F A;  3SOU A;  1CHC A;  5EYA F;  3MDB C;  4PTB A;  3L11 A;  2MT5 A;  2MNY A;  2CSY A;  3FAN A;  5SVI B;  2NAA A;  2K17 A;  1XWH A;  1WIL A;  1WFK A;  3JUE A;  4YBT A;  4TKP B;  4FIP A;  3KNV A;  4ZQL A;  2MNZ A;  2H0D B;  2ECT A;  3DPL R;  2M85 A;  4AP4 A;  2I50 A;  4OGE A;  1Z6U A;  4YAD A;  2XOY A;  2M13 A;  5DKA A;  2YHO A;  4UP5 A;  4CA1 A;  1WGM A;  3ZYQ A;  2JMJ A;  4R8P K;  2ECI A;  3ZVY A;  4C9Z A;  4IC3 A;  5TDR A;  4FO9 A;  4IC2 A;  1HYI A;  4GND A;  3LQJ A;  2DX8 A;  2CON A;  2YVR A;  2RR4 A;  2XP0 A;  2VPB A;  1HYJ A;  2KWK A;  1WES A;  2VJE B;  2YQL A;  4B7Y C;  3DWD A;  1JOC A;  1X4U A;  5KH9 A;  2VJE A;  5I3L A;  2Y1M A;  4A49 A;  3M99 A;  1WEO A;  5JG6 A;  2LGV A;  3H7H A;  2PUY A;  2EA6 A;  1FP0 A;  3T7L A;  5LKZ A;  4YBM A;  5D1L B;  3GV4 A;  5G05 B;  3T9K A;  4FJC A;  1MM3 A;  2B0O E;  2YSJ A;  2VNF A;  3LVR E;  1LDK C;  3I2D A;  3O37 A;  3PUQ A;  2E6S A;  2KYU A;  1JM7 B;  4NN2 A;  3FL2 A;  2CT2 A;  4QF2 A;  3DDT A;  2CKL B;  2KWJ A;  1JM7 A;  2EOD A;  2L5U A;  3O47 A;  5J3X A;  5K3Q A;  4AYC B;  4YAX A;  4WZ3 B;  1MM2 A;  2KE1 A;  1DVP A;  4F52 B;  1WIM A;  3EB6 A;  2M1R A;  4AYC A;  3U5P A;  4AVX A;  4YAB A;  2MA5 A;  2ECW A;  4LAD B;  3ZNI A;  3HCT A;  4YBS A;  5B79 A;  3U5O A;  2MD7 B;  3M63 A;  4Q6F A;  4ZUX U;  1LDJ B;  2FFW A;  3FAO A;  3SOW A;  4AUQ B;  4O62 A;  5B76 A;  1WEP A;  3N9L A; 
#chains in the Genus database with same CATH homology
 3KV5 A;  4BBQ A;  2YUC A;  2ECJ A;  5FEY A;  2LGL A;  4FK5 A;  2C2V S;  2LXP C;  2ECG A;  3NG2 A;  3GL6 A;  2IDA A;  4S3O C;  4PPE A;  2H0D A;  3C5K A;  3N9N A;  3VK6 A;  2LV9 A;  2KWN A;  2Y43 A;  4B86 C;  4WZ2 A;  2MD8 C;  5H1T A;  2F42 A;  1N87 A;  4GNF A;  1WEU A;  5B8D A;  2YRE A;  2D8S A;  1VYX A;  2Y1N A;  2XEU A;  1T1H A;  5KH7 A;  2YT5 A;  3U5N A;  2VPD A;  2ECV A;  5B77 A;  2FUU A;  2CSZ A;  2LXH C;  1Z2Q A;  1U6G B;  4GNE A;  3ZPV 1;  2VJF B;  3MHH A;  2L75 A;  5TAB A;  3PUR A;  3KQI A;  3IHP A;  2QIC A;  3C6W A;  4WA6 A;  5DIN A;  2L80 A;  4X3G A;  4L7X A;  5B75 A;  2VPG A;  2K4D A;  2KIZ A;  1WEQ A;  4YAT A;  3ZTG A;  3N9O A;  4A4B A;  5TRB A;  2G43 A;  2KRE A;  2LRI C;  4I7D A;  3L1X A;  3O7A A;  2K1J A;  2FUI A;  2LN0 A;  2RI7 A;  5G04 B;  1G25 A;  1WEM A;  4V3K C;  4UP0 A;  3M62 A;  3LQI A;  2LDR A;  3V43 A;  3RPG C;  2OXQ C;  2HDP A;  2CKL A;  3ZVZ B;  3LRQ A;  2AN6 A;  2G6Q A;  2HYE D;  3O34 A;  4I7B A;  3N9M A;  5AIU A;  4LLB A;  3SHB A;  2F6J A;  2YHN A;  3O70 A;  5TBN A;  5TDW A;  2QIZ A;  5FB0 A;  4GB0 A;  5LCW B;  1RMD A;  2JRJ A;  3HCU A;  1K2F A;  4V3L C;  2FSA A;  2KWO A;  4LKA A;  2YQM A;  5C11 A;  5KH3 A;  2EGP A;  4WZ0 A;  3N9P A;  5LKX A;  3PHD A;  3T6R A;  4ZDT A;  3ZPV E;  5D1M B;  2MA6 A;  4R7E A;  4R2Y A;  4L58 A;  1VD4 A;  2YW8 A;  3RTR B;  2RSD A;  2LGG A;  4A4C A;  3EB5 A;  2LQ6 A;  2KFT A;  2F6N A;  4P5O B;  1WEN A;  2KU3 A;  4GNG A;  3QZV A;  4MVT A;  1FBV A;  3SOX A;  1WE9 A;  5C13 A;  1ZBD B;  1BOR A;  1V87 A;  4LJN A;  5AIT A;  1F62 A;  3KV6 A;  3DQV R;  4QF3 A;  3HCS A;  1WEW A;  2KR4 A;  3MHS A;  2M6M A;  3L1Z B;  5LKT A;  2VJF A;  3U5M A;  2M3H A;  5H1U A;  1X4J A;  2ECN A;  2K16 A;  2L0B A;  2PNX A;  2C2L A;  4I7C A;  4YC9 A;  4CCG X;  4XI1 A;  1WEE A;  2KGG A;  5FER A;  4W4U A;  3LQH A;  3O35 A;  5G0F A;  4BHW A;  4O64 A;  2VP7 A;  5LKU A;  2VPE A;  2UZG A;  3RPG B;  3ASL A;  3O33 A;  2YYR A;  2JMD A;  4N3W A;  1VFY A;  1E4U A;  2XB1 A;  3O36 A;  4MSX A;  3HTK C;  1WEV A;  2BAY A;  2YU4 A;  2QJ0 A;  2G45 A;  1X4I A;  2YUR A;  4UI9 B;  5B78 A;  5FB1 A;  2MUM A;  1Z60 A;  5D1K B;  2LGK A;  3N9Q A;  1IYM A;  2E6R A;  2L43 A;  2JMI A;  4LK9 A;  2KGI A;  4A0C D;  2ZET C;  5H1V A;  5H9M A;  2YSM A;  4S3O B;  2MIQ A;  4N4F A;  3SOU A;  1CHC A;  5EYA F;  4PTB A;  3L11 A;  2MT5 A;  2MNY A;  2CSY A;  2NAA A;  2K17 A;  1XWH A;  1WIL A;  1WFK A;  4YBT A;  4TKP B;  4FIP A;  3KNV A;  4ZQL A;  2MNZ A;  2H0D B;  2ECT A;  3DPL R;  2M85 A;  4AP4 A;  2I50 A;  1Z6U A;  4YAD A;  5DKA A;  2YHO A;  4UP5 A;  4CA1 A;  1WGM A;  3ZYQ A;  2JMJ A;  4R8P K;  2ECI A;  3ZVY A;  4C9Z A;  4IC3 A;  5TDR A;  4FO9 A;  4IC2 A;  1HYI A;  4GND A;  3LQJ A;  2DX8 A;  2VPB A;  1HYJ A;  2KWK A;  1WES A;  2VJE B;  2YQL A;  4B7Y C;  1JOC A;  1X4U A;  5KH9 A;  2VJE A;  5I3L A;  2Y1M A;  4A49 A;  3M99 A;  1WEO A;  5JG6 A;  2LGV A;  2PUY A;  2EA6 A;  1FP0 A;  3T7L A;  5LKZ A;  4YBM A;  5D1L B;  3GV4 A;  5G05 B;  4FJC A;  1MM3 A;  2YSJ A;  2VNF A;  1LDK C;  3I2D A;  3O37 A;  3PUQ A;  2E6S A;  2KYU A;  1JM7 B;  4NN2 A;  3FL2 A;  2CT2 A;  4QF2 A;  2CKL B;  2KWJ A;  1JM7 A;  2EOD A;  2L5U A;  5J3X A;  4AYC B;  4YAX A;  4WZ3 B;  1MM2 A;  2KE1 A;  1DVP A;  4F52 B;  1WIM A;  3EB6 A;  2M1R A;  4AYC A;  3U5P A;  4AVX A;  4YAB A;  2MA5 A;  2ECW A;  4LAD B;  3ZNI A;  3HCT A;  4YBS A;  5B79 A;  3U5O A;  2MD7 B;  3M63 A;  4Q6F A;  4ZUX U;  1LDJ B;  3SOW A;  4AUQ B;  5B76 A;  1WEP A;  3N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...