3O70A

Phd-type zinc finger of human phd finger protein 13
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
b'LYFQGLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 13
publication title PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o70A00
4WZ0A 1BORA 3HTKC 4F52B 5H9MA 4UP0A 4TKPB 1F62A 4CA1A 4ZQLA 2C2LA 2LXHC 1MM2A 3U5PA 2K1JA 4AYCA 5C11A 3RTRB 2ECNA 2VJFB 4YADA 5TABA 2G6QA 4R2YA 3VK6A 2L5UA 3KV5A 3GV4A 2KIZA 2C2VS 2VPDA 2MUMA 3I2DA 1XWHA 5TRBA 2KGIA 2L0BA 2F42A 5G0FA 5B77A 2E6SA 2ECIA 2LGVA 4UI9B 5TBNA 1FBVA 1JM7A 4GNDA 4L58A 2YUCA 5KH3A 3V43A 4S3OB 1WGMA 3N9QA 1WEPA 4A4CA 1G25A 5B79A 3C6WA 4V3LC 4YAXA 2YHOA 3SHBA 3NG2A 5D1MB 3T7LA 1U6GB 4GNEA 4YATA 4N3WA 1VD4A 1V87A 2ECVA 3ZPVE 2G45A 2K4DA 4C9ZA 2MNYA 5LKUA 5C13A 2KFTA 1LDKC 3LQHA 5D1KB 4I7BA 5B78A 2K16A 3SOXA 4GNGA 2K17A 1WESA 4AYCB 3LRQA 3C5KA 1DVPA 3N9PA 2YSJA 2HYED 4PTBA 3HCSA 2EGPA 2LXPC 2VP7A 4YC9A 2MA6A 2QJ0A 4WA6A 4ZUXU 2YURA 2FUIA 5G04B 2LGLA 3U5OA 3ZTGA 2YW8A 4A49A 2LGKA 2BAYA 2VPBA 3O33A 2EODA 2E6RA 2RI7A 5FB1A 4MVTA 2YYRA 2KWJA 2PUYA 2MD8C 2PNXA 3EB5A 3ZYQA 3O70A 5J3XA 2KU3A 3M99A 4L7XA 3O36A 4LKAA 5FERA 5D1LB 1FP0A 3L1XA 4YABA 1K2FA 2Y1MA 3HCTA 3M62A 4A0CD 5DINA 2YSMA 4I7CA 3GL6A 4O64A 3U5NA 5B76A 4WZ2A 5DKAA 4W4UA 4QF3A 4S3OC 4P5OB 4AUQB 4NN2A 5H1TA 1X4UA 1Z2QA 1E4UA 4GB0A 3U5MA 1T1HA 4I7DA 4AP4A 5EYAF 1HYJA 2CKLA 2G43A 4A4BA 4X3GA 2FUUA 4R8PK 3N9MA 5G05B 2ECGA 3KNVA 5LKTA 2LDRA 4XI1A 3N9LA 5KH7A 2H0DA 3ZVYA 4FIPA 5AIUA 2Y1NA 1RMDA 3O37A 2HDPA 3L1ZB 2KREA 2L75A 4ZDTA 2UZGA 1HYIA 3MHSA 2MIQA 2VJEA 5B8DA 1WILA 3RPGC 2M3HA 1MM3A 4YBMA 2MA5A 5H1VA 2JMIA 4QF2A 2YQMA 3L11A 2MD7B 2JRJA 5JG6A 4MSXA 2XEUA 4PPEA 1WEEA 4IC3A 3SOUA 2LV9A 3M63A 3O7AA 2CT2A 2F6NA 3HCUA 3O35A 3LQJA 3DPLR 3MHHA 5TDRA 2KWNA 1N87A 2M1RA 2M85A 2KGGA 2YREA 2AN6A 2QICA 4Q6FA 3ZPV1 1JM7B 4N4FA 1WENA 2KWOA 1WEOA 4B7YC 1CHCA 5FB0A 3O34A 5AITA 2YHNA 4LADB 5LKZA 1LDJB 5I3LA 2FSAA 4B86C 3N9NA 2KR4A 2MNZA 2VPEA 2CKLB 2YQLA 3ZNIA 2EA6A 4LJNA 2LQ6A 2KYUA 4LK9A 1WEVA 2ZETC 4FJCA 5LKXA 3T6RA 3QZVA 2MT5A 2OXQC 2H0DB 3PURA 3FL2A 4CCGX 4BHWA 1JOCA 2VNFA 3PUQA 5KH9A 1X4JA 3SOWA 1WEMA 4V3KC 2YU4A 3ASLA 3EB6A 2VJEB 1Z60A 2LRIC 3IHPA 1WIMA 2D8SA 3ZVZB 2L80A 5TDWA 5LCWB 1VYXA 1WE9A 2VJFA 4BBQA 2I50A 4FO9A 2XB1A 3KV6A 2L43A 1X4IA 2CSZA 1WFKA 4WZ3B 1WEWA 1ZBDB 2ECWA 4GNFA 2LN0A 2CSYA 2JMDA 2NAAA 2LGGA 2KWKA 4UP5A 2DX8A 1WEQA 4LLBA 1WEUA 1VFYA 3N9OA 4YBSA 2VPGA 2JMJA 4YBTA 4AVXA 3RPGB 4IC2A 2YT5A 3LQIA 2ECTA 1IYMA 3KQIA 1Z6UA 2M6MA 4R7EA 2IDAA 2ECJA 5B75A 3DQVR 2Y43A 4FK5A 5H1UA 2F6JA 3PHDA 2KE1A 2QIZA 5FEYA 2RSDA
chains in the Genus database with same CATH superfamily
4WZ0A 1BORA 3HTKC 4F52B 5H9MA 4UP0A 4TKPB 1F62A 4CA1A 4ZQLA 2DSMA 2C2LA 2LXHC 1MM2A 3U5PA 2K1JA 4OGCA 4AYCA 5C11A 3RTRB 2ECNA 2VJFB 4YADA 5TABA 2G6QA 4R2YA 3VK6A 2L5UA 3KV5A 3GV4A 2KIZA 2C2VS 2VPDA 3I2DA 1XWHA 5TRBA 2KGIA 2L0BA 3LVQE 2F42A 5G0FA 5B77A 2E6SA 2ECIA 2LGVA 4UI9B 5TBNA 1FBVA 1JM7A 4GNDA 3FEHA 4L58A 2YUCA 5KH3A 3V43A 2CONA 4S3OB 1WGMA 3N9QA 4H9DA 1WEPA 2MKEA 4A4CA 1G25A 5B79A 3C6WA 4QQ4A 5FEYA 4V3LC 3E2DA 4YAXA 2YVRA 2YHOA 3SHBA 3NG2A 5D1MB 3T7LA 1U6GB 4GNEA 4YATA 4N3WA 1VD4A 1V87A 2ECVA 3ZPVE 2G45A 2KKYA 2K4DA 4C9ZA 2MNYA 5LKUA 5C13A 2KFTA 1LDKC 2JUNA 3LQHA 3PLWA 5D1KB 4I7BA 5B78A 2K16A 3DWDA 3SOXA 4GNGA 2K17A 1WESA 2EGMA 4AYCB 3LRQA 3C5KA 1DVPA 2XOYA 3N9PA 2YSJA 2HYED 4PTBA 3LDYA 3HCSA 2EXUA 2EGPA 2LXPC 2VP7A 4YC9A 2JM3A 2MA6A 2QJ0A 4WA6A 4ZUXU 2YURA 2FUIA 5G04B 2LGLA 3U5OA 3ZTGA 4F1PA 2YW8A 4A49A 2LGKA 2BAYA 2VPBA 3O33A 3M7KA 2EODA 2E6RA 2RI7A 5FB1A 4MVTA 2YYRA 2KWJA 2PUYA 2CSVA 2MD8C 2PNXA 3EB5A 3Q1DA 3ZYQA 3O70A 2RR4A 5J3XA 2KU3A 3M99A 4L7XA 3O36A 4LKAA 5FERA 5SVYA 5D1LB 1FP0A 3L1XA 4YABA 1K2FA 2Y1MA 3LJUX 3HCTA 3M62A 5SVIA 4A0CD 5DINA 2YSMA 4I7CA 3GL6A 4O64A 3U5NA 5B76A 4WZ2A 5DKAA 4W4UA 3JUEA 4QF3A 4S3OC 4P5OB 4AUQB 4NN2A 5H1TA 1X4UA 1Z2QA 1E4UA 4GB0A 3U5MA 1T1HA 4I7DA 4AP4A 5EYAF 1HYJA 2CKLA 2G43A 2P57A 4A4BA 4X3GA 2FUUA 4R8PK 3N9MA 5G05B 2ECGA 3KNVA 5LKTA 2LDRA 4XI1A 3N9LA 5KH7A 2H0DA 3ZVYA 4FIPA 5AIUA 2Y1NA 1RMDA 3O37A 2HDPA 3L1ZB 2KREA 2L75A 3DDTA 4O62A 2UZGA 4ZDTA 1HYIA 3MHSA 3MDBC 2MIQA 2VJEA 5B8DA 1WILA 2KKXA 3RPGC 2M3HA 1MM3A 4YBMA 2MA5A 5H1VA 2JMIA 4QF2A 2YQMA 3L11A 2MD7B 2JRJA 5JG6A 4MSXA 2XEUA 4PPEA 1WEEA 2XOCA 4IC3A 3SOUA 2LV9A 3M63A 3O7AA 2CT2A 2F6NA 3FAOA 3HCUA 3O35A 3LQJA 3DPLR 3MHHA 5TDRA 2KWNA 1N87A 2M1RA 2M85A 2KGGA 2YREA 2AN6A 1MBMA 2QICA 4Q6FA 3ZPV1 1JM7B 4N4FA 1WENA 3FM8C 2KWOA 3LVRE 5SVXA 1WEOA 4B7YC 2CRRA 1CHCA 5FB0A 3O34A 5AITA 2YHNA 3O47A 4LADB 5LKZA 1LDJB 5I3LA 2FSAA 4B86C 3N9NA 2KR4A 2MNZA 2VPEA 2CKLB 2YQLA 3ZNIA 2EA6A 3FJUB 4LJNA 2LQ6A 2FFWA 2KYUA 4LK9A 1WEVA 2ZETC 4FJCA 5LKXA 3T6RA 3KDEC 3QZVA 2MT5A 2OXQC 2H0DB 2E61A 3PURA 3FL2A 4CCGX 5K3QA 2XOZA 4BHWA 2M13A 1JOCA 3FANA 2VNFA 3PUQA 5KH9A 1X4JA 3SOWA 1WEMA 4V3KC 2YU4A 3ASLA 3EB6A 2VJEB 1Z60A 2LRIC 3IHPA 2LAUA 1WIMA 2D8SA 3ZVZB 2L7PA 2L80A 5TDWA 5LCWB 1VYXA 1WE9A 2VJFA 4BBQA 2I50A 4FO9A 2CRWA 2XB1A 3KV6A 3SUBA 2L43A 1X4IA 2CSZA 1WFKA 4WZ3B 1WEWA 1ZBDB 2ECWA 4Z0RA 2DJAA 4GNFA 2LN0A 2CSYA 2JMDA 2NAAA 2LGGA 2B0OE 2KWKA 4UP5A 2DX8A 1WEQA 2IQJA 4LLBA 1WEUA 4Z0OA 2OWAA 1VFYA 3N9OA 4YBSA 3H7HA 2D8UA 2VPGA 2JMJA 4YBTA 4AVXA 3RPGB 4IC2A 2YT5A 3LQIA 2ECTA 1IYMA 3KQIA 1Z6UA 2M6MA 4R7EA 1DCQA 2IDAA 2ECJA 2XP0A 5B75A 3DQVR 2FD4A 2Y43A 4FK5A 4OGEA 2F6JA 5H1UA 3PHDA 3T9KA 2KE1A 5SVIB 2QIZA 2MUMA 2RSDA
chains in the Genus database with same CATH topology
4WZ0A 1BORA 3HTKC 4F52B 5H9MA 4UP0A 4TKPB 1F62A 4CA1A 4ZQLA 2C2LA 2LXHC 1MM2A 3U5PA 2K1JA 4AYCA 5C11A 3RTRB 2ECNA 2VJFB 4YADA 5TABA 2G6QA 4R2YA 3VK6A 2L5UA 3KV5A 3GV4A 2KIZA 2C2VS 2VPDA 2MUMA 3I2DA 1XWHA 5TRBA 2KGIA 2L0BA 2F42A 5G0FA 5B77A 2E6SA 2ECIA 2LGVA 4UI9B 5TBNA 1FBVA 1JM7A 4GNDA 4L58A 2YUCA 5KH3A 3V43A 4S3OB 1WGMA 3N9QA 1WEPA 4A4CA 1G25A 5B79A 3C6WA 4V3LC 4YAXA 2YHOA 3SHBA 3NG2A 5D1MB 3T7LA 1U6GB 4GNEA 4YATA 4N3WA 1VD4A 1V87A 2ECVA 3ZPVE 2G45A 2K4DA 4C9ZA 2MNYA 5LKUA 5C13A 2KFTA 1LDKC 3LQHA 5D1KB 4I7BA 5B78A 2K16A 3SOXA 4GNGA 2K17A 1WESA 4AYCB 3LRQA 3C5KA 1DVPA 3N9PA 2YSJA 2HYED 4PTBA 3HCSA 2EGPA 2LXPC 2VP7A 4YC9A 2MA6A 2QJ0A 4WA6A 4ZUXU 2YURA 2FUIA 5G04B 2LGLA 3U5OA 3ZTGA 2YW8A 4A49A 2LGKA 2BAYA 2VPBA 3O33A 2EODA 2E6RA 2RI7A 5FB1A 4MVTA 2YYRA 2KWJA 2PUYA 2MD8C 2PNXA 3EB5A 3ZYQA 3O70A 5J3XA 2KU3A 3M99A 4L7XA 3O36A 4LKAA 5FERA 5D1LB 1FP0A 3L1XA 4YABA 1K2FA 2Y1MA 3HCTA 3M62A 4A0CD 5DINA 2YSMA 4I7CA 3GL6A 4O64A 3U5NA 5B76A 4WZ2A 5DKAA 4W4UA 4QF3A 4S3OC 4P5OB 4AUQB 4NN2A 5H1TA 1X4UA 1Z2QA 1E4UA 4GB0A 3U5MA 1T1HA 4I7DA 4AP4A 5EYAF 1HYJA 2CKLA 2G43A 4A4BA 4X3GA 2FUUA 4R8PK 3N9MA 5G05B 2ECGA 3KNVA 5LKTA 2LDRA 4XI1A 3N9LA 5KH7A 2H0DA 3ZVYA 4FIPA 5AIUA 2Y1NA 1RMDA 3O37A 2HDPA 3L1ZB 2KREA 2L75A 4ZDTA 2UZGA 1HYIA 3MHSA 2MIQA 2VJEA 5B8DA 1WILA 3RPGC 2M3HA 1MM3A 4YBMA 2MA5A 5H1VA 2JMIA 4QF2A 2YQMA 3L11A 2MD7B 2JRJA 5JG6A 4MSXA 2XEUA 4PPEA 1WEEA 4IC3A 3SOUA 2LV9A 3M63A 3O7AA 2CT2A 2F6NA 3HCUA 3O35A 3LQJA 3DPLR 3MHHA 5TDRA 2KWNA 1N87A 2M1RA 2M85A 2KGGA 2YREA 2AN6A 2QICA 4Q6FA 3ZPV1 1JM7B 4N4FA 1WENA 2KWOA 1WEOA 4B7YC 1CHCA 5FB0A 3O34A 5AITA 2YHNA 4LADB 5LKZA 1LDJB 5I3LA 2FSAA 4B86C 3N9NA 2KR4A 2MNZA 2VPEA 2CKLB 2YQLA 3ZNIA 2EA6A 4LJNA 2LQ6A 2KYUA 4LK9A 1WEVA 2ZETC 4FJCA 5LKXA 3T6RA 3QZVA 2MT5A 2OXQC 2H0DB 3PURA 3FL2A 4CCGX 4BHWA 1JOCA 2VNFA 3PUQA 5KH9A 1X4JA 3SOWA 1WEMA 4V3KC 2YU4A 3ASLA 3EB6A 2VJEB 1Z60A 2LRIC 3IHPA 1WIMA 2D8SA 3ZVZB 2L80A 5TDWA 5LCWB 1VYXA 1WE9A 2VJFA 4BBQA 2I50A 4FO9A 2XB1A 3KV6A 2L43A 1X4IA 2CSZA 1WFKA 4WZ3B 1WEWA 1ZBDB 2ECWA 4GNFA 2LN0A 2CSYA 2JMDA 2NAAA 2LGGA 2KWKA 4UP5A 2DX8A 1WEQA 4LLBA 1WEUA 1VFYA 3N9OA 4YBSA 2VPGA 2JMJA 4YBTA 4AVXA 3RPGB 4IC2A 2YT5A 3LQIA 2ECTA 1IYMA 3KQIA 1Z6UA 2M6MA 4R7EA 2IDAA 2ECJA 5B75A 3DQVR 2Y43A 4FK5A 5H1UA 2F6JA 3PHDA 2KE1A 2QIZA 5FEYA 2RSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ0 A;  1BOR A;  3HTK C;  4F52 B;  5H9M A;  4UP0 A;  4TKP B;  1F62 A;  4CA1 A;  4ZQL A;  2C2L A;  2LXH C;  1MM2 A;  3U5P A;  2K1J A;  4AYC A;  5C11 A;  3RTR B;  2ECN A;  2VJF B;  4YAD A;  5TAB A;  2G6Q A;  4R2Y A;  3VK6 A;  2L5U A;  3KV5 A;  3GV4 A;  2KIZ A;  2C2V S;  2VPD A;  2MUM A;  3I2D A;  1XWH A;  5TRB A;  2KGI A;  2L0B A;  2F42 A;  5G0F A;  5B77 A;  2E6S A;  2ECI A;  2LGV A;  4UI9 B;  5TBN A;  1FBV A;  1JM7 A;  4GND A;  4L58 A;  2YUC A;  5KH3 A;  3V43 A;  4S3O B;  1WGM A;  3N9Q A;  1WEP A;  4A4C A;  1G25 A;  5B79 A;  3C6W A;  4V3L C;  4YAX A;  2YHO A;  3SHB A;  3NG2 A;  5D1M B;  3T7L A;  1U6G B;  4GNE A;  4YAT A;  4N3W A;  1VD4 A;  1V87 A;  2ECV A;  3ZPV E;  2G45 A;  2K4D A;  4C9Z A;  2MNY A;  5LKU A;  5C13 A;  2KFT A;  1LDK C;  3LQH A;  5D1K B;  4I7B A;  5B78 A;  2K16 A;  3SOX A;  4GNG A;  2K17 A;  1WES A;  4AYC B;  3LRQ A;  3C5K A;  1DVP A;  3N9P A;  2YSJ A;  2HYE D;  4PTB A;  3HCS A;  2EGP A;  2LXP C;  2VP7 A;  4YC9 A;  2MA6 A;  2QJ0 A;  4WA6 A;  4ZUX U;  2YUR A;  2FUI A;  5G04 B;  2LGL A;  3U5O A;  3ZTG A;  2YW8 A;  4A49 A;  2LGK A;  2BAY A;  2VPB A;  3O33 A;  2EOD A;  2E6R A;  2RI7 A;  5FB1 A;  4MVT A;  2YYR A;  2KWJ A;  2PUY A;  2MD8 C;  2PNX A;  3EB5 A;  3ZYQ A;  3O70 A;  5J3X A;  2KU3 A;  3M99 A;  4L7X A;  3O36 A;  4LKA A;  5FER A;  5D1L B;  1FP0 A;  3L1X A;  4YAB A;  1K2F A;  2Y1M A;  3HCT A;  3M62 A;  4A0C D;  5DIN A;  2YSM A;  4I7C A;  3GL6 A;  4O64 A;  3U5N A;  5B76 A;  4WZ2 A;  5DKA A;  4W4U A;  4QF3 A;  4S3O C;  4P5O B;  4AUQ B;  4NN2 A;  5H1T A;  1X4U A;  1Z2Q A;  1E4U A;  4GB0 A;  3U5M A;  1T1H A;  4I7D A;  4AP4 A;  5EYA F;  1HYJ A;  2CKL A;  2G43 A;  4A4B A;  4X3G A;  2FUU A;  4R8P K;  3N9M A;  5G05 B;  2ECG A;  3KNV A;  5LKT A;  2LDR A;  4XI1 A;  3N9L A;  5KH7 A;  2H0D A;  3ZVY A;  4FIP A;  5AIU A;  2Y1N A;  1RMD A;  3O37 A;  2HDP A;  3L1Z B;  2KRE A;  2L75 A;  4ZDT A;  2UZG A;  1HYI A;  3MHS A;  2MIQ A;  2VJE A;  5B8D A;  1WIL A;  3RPG C;  2M3H A;  1MM3 A;  4YBM A;  2MA5 A;  5H1V A;  2JMI A;  4QF2 A;  2YQM A;  3L11 A;  2MD7 B;  2JRJ A;  5JG6 A;  4MSX A;  2XEU A;  4PPE A;  1WEE A;  4IC3 A;  3SOU A;  2LV9 A;  3M63 A;  3O7A A;  2CT2 A;  2F6N A;  3HCU A;  3O35 A;  3LQJ A;  3DPL R;  3MHH A;  5TDR A;  2KWN A;  1N87 A;  2M1R A;  2M85 A;  2KGG A;  2YRE A;  2AN6 A;  2QIC A;  4Q6F A;  3ZPV 1;  1JM7 B;  4N4F A;  1WEN A;  2KWO A;  1WEO A;  4B7Y C;  1CHC A;  5FB0 A;  3O34 A;  5AIT A;  2YHN A;  4LAD B;  5LKZ A;  1LDJ B;  5I3L A;  2FSA A;  4B86 C;  3N9N A;  2KR4 A;  2MNZ A;  2VPE A;  2CKL B;  2YQL A;  3ZNI A;  2EA6 A;  4LJN A;  2LQ6 A;  2KYU A;  4LK9 A;  1WEV A;  2ZET C;  4FJC A;  5LKX A;  3T6R A;  3QZV A;  2MT5 A;  2OXQ C;  2H0D B;  3PUR A;  3FL2 A;  4CCG X;  4BHW A;  1JOC A;  2VNF A;  3PUQ A;  5KH9 A;  1X4J A;  3SOW A;  1WEM A;  4V3K C;  2YU4 A;  3ASL A;  3EB6 A;  2VJE B;  1Z60 A;  2LRI C;  3IHP A;  1WIM A;  2D8S A;  3ZVZ B;  2L80 A;  5TDW A;  5LCW B;  1VYX A;  1WE9 A;  2VJF A;  4BBQ A;  2I50 A;  4FO9 A;  2XB1 A;  3KV6 A;  2L43 A;  1X4I A;  2CSZ A;  1WFK A;  4WZ3 B;  1WEW A;  1ZBD B;  2ECW A;  4GNF A;  2LN0 A;  2CSY A;  2JMD A;  2NAA A;  2LGG A;  2KWK A;  4UP5 A;  2DX8 A;  1WEQ A;  4LLB A;  1WEU A;  1VFY A;  3N9O A;  4YBS A;  2VPG A;  2JMJ A;  4YBT A;  4AVX A;  3RPG B;  4IC2 A;  2YT5 A;  3LQI A;  2ECT A;  1IYM A;  3KQI A;  1Z6U A;  2M6M A;  4R7E A;  2IDA A;  2ECJ A;  5B75 A;  3DQV R;  2Y43 A;  4FK5 A;  5H1U A;  2F6J A;  3PHD A;  2KE1 A;  2QIZ A;  5FEY A;  2RSD A; 
#chains in the Genus database with same CATH topology
 4WZ0 A;  1BOR A;  3HTK C;  4F52 B;  5H9M A;  4UP0 A;  4TKP B;  1F62 A;  4CA1 A;  4ZQL A;  2DSM A;  2C2L A;  2LXH C;  1MM2 A;  3U5P A;  2K1J A;  4OGC A;  4AYC A;  5C11 A;  3RTR B;  2ECN A;  2VJF B;  4YAD A;  5TAB A;  2G6Q A;  4R2Y A;  3VK6 A;  2L5U A;  3KV5 A;  3GV4 A;  2KIZ A;  2C2V S;  2VPD A;  3I2D A;  1XWH A;  5TRB A;  2KGI A;  2L0B A;  3LVQ E;  2F42 A;  5G0F A;  5B77 A;  2E6S A;  2ECI A;  2LGV A;  4UI9 B;  5TBN A;  1FBV A;  1JM7 A;  4GND A;  3FEH A;  4L58 A;  2YUC A;  5KH3 A;  3V43 A;  2CON A;  4S3O B;  1WGM A;  3N9Q A;  4H9D A;  1WEP A;  2MKE A;  4A4C A;  1G25 A;  5B79 A;  3C6W A;  4QQ4 A;  5FEY A;  4V3L C;  3E2D A;  4YAX A;  2YVR A;  2YHO A;  3SHB A;  3NG2 A;  5D1M B;  3T7L A;  1U6G B;  4GNE A;  4YAT A;  4N3W A;  1VD4 A;  1V87 A;  2ECV A;  3ZPV E;  2G45 A;  2KKY A;  2K4D A;  4C9Z A;  2MNY A;  5LKU A;  5C13 A;  2KFT A;  1LDK C;  2JUN A;  3LQH A;  3PLW A;  5D1K B;  4I7B A;  5B78 A;  2K16 A;  3DWD A;  3SOX A;  4GNG A;  2K17 A;  1WES A;  2EGM A;  4AYC B;  3LRQ A;  3C5K A;  1DVP A;  2XOY A;  3N9P A;  2YSJ A;  2HYE D;  4PTB A;  3LDY A;  3HCS A;  2EXU A;  2EGP A;  2LXP C;  2VP7 A;  4YC9 A;  2JM3 A;  2MA6 A;  2QJ0 A;  4WA6 A;  4ZUX U;  2YUR A;  2FUI A;  5G04 B;  2LGL A;  3U5O A;  3ZTG A;  4F1P A;  2YW8 A;  4A49 A;  2LGK A;  2BAY A;  2VPB A;  3O33 A;  3M7K A;  2EOD A;  2E6R A;  2RI7 A;  5FB1 A;  4MVT A;  2YYR A;  2KWJ A;  2PUY A;  2CSV A;  2MD8 C;  2PNX A;  3EB5 A;  3Q1D A;  3ZYQ A;  3O70 A;  2RR4 A;  5J3X A;  2KU3 A;  3M99 A;  4L7X A;  3O36 A;  4LKA A;  5FER A;  5SVY A;  5D1L B;  1FP0 A;  3L1X A;  4YAB A;  1K2F A;  2Y1M A;  3LJU X;  3HCT A;  3M62 A;  5SVI A;  4A0C D;  5DIN A;  2YSM A;  4I7C A;  3GL6 A;  4O64 A;  3U5N A;  5B76 A;  4WZ2 A;  5DKA A;  4W4U A;  3JUE A;  4QF3 A;  4S3O C;  4P5O B;  4AUQ B;  4NN2 A;  5H1T A;  1X4U A;  1Z2Q A;  1E4U A;  4GB0 A;  3U5M A;  1T1H A;  4I7D A;  4AP4 A;  5EYA F;  1HYJ A;  2CKL A;  2G43 A;  2P57 A;  4A4B A;  4X3G A;  2FUU A;  4R8P K;  3N9M A;  5G05 B;  2ECG A;  3KNV A;  5LKT A;  2LDR A;  4XI1 A;  3N9L A;  5KH7 A;  2H0D A;  3ZVY A;  4FIP A;  5AIU A;  2Y1N A;  1RMD A;  3O37 A;  2HDP A;  3L1Z B;  2KRE A;  2L75 A;  3DDT A;  4O62 A;  2UZG A;  4ZDT A;  1HYI A;  3MHS A;  3MDB C;  2MIQ A;  2VJE A;  5B8D A;  1WIL A;  2KKX A;  3RPG C;  2M3H A;  1MM3 A;  4YBM A;  2MA5 A;  5H1V A;  2JMI A;  4QF2 A;  2YQM A;  3L11 A;  2MD7 B;  2JRJ A;  5JG6 A;  4MSX A;  2XEU A;  4PPE A;  1WEE A;  2XOC A;  4IC3 A;  3SOU A;  2LV9 A;  3M63 A;  3O7A A;  2CT2 A;  2F6N A;  3FAO A;  3HCU A;  3O35 A;  3LQJ A;  3DPL R;  3MHH A;  5TDR A;  2KWN A;  1N87 A;  2M1R A;  2M85 A;  2KGG A;  2YRE A;  2AN6 A;  1MBM A;  2QIC A;  4Q6F A;  3ZPV 1;  1JM7 B;  4N4F A;  1WEN A;  3FM8 C;  2KWO A;  3LVR E;  5SVX A;  1WEO A;  4B7Y C;  2CRR A;  1CHC A;  5FB0 A;  3O34 A;  5AIT A;  2YHN A;  3O47 A;  4LAD B;  5LKZ A;  1LDJ B;  5I3L A;  2FSA A;  4B86 C;  3N9N A;  2KR4 A;  2MNZ A;  2VPE A;  2CKL B;  2YQL A;  3ZNI A;  2EA6 A;  3FJU B;  4LJN A;  2LQ6 A;  2FFW A;  2KYU A;  4LK9 A;  1WEV A;  2ZET C;  4FJC A;  5LKX A;  3T6R A;  3KDE C;  3QZV A;  2MT5 A;  2OXQ C;  2H0D B;  2E61 A;  3PUR A;  3FL2 A;  4CCG X;  5K3Q A;  2XOZ A;  4BHW A;  2M13 A;  1JOC A;  3FAN A;  2VNF A;  3PUQ A;  5KH9 A;  1X4J A;  3SOW A;  1WEM A;  4V3K C;  2YU4 A;  3ASL A;  3EB6 A;  2VJE B;  1Z60 A;  2LRI C;  3IHP A;  2LAU A;  1WIM A;  2D8S A;  3ZVZ B;  2L7P A;  2L80 A;  5TDW A;  5LCW B;  1VYX A;  1WE9 A;  2VJF A;  4BBQ A;  2I50 A;  4FO9 A;  2CRW A;  2XB1 A;  3KV6 A;  3SUB A;  2L43 A;  1X4I A;  2CSZ A;  1WFK A;  4WZ3 B;  1WEW A;  1ZBD B;  2ECW A;  4Z0R A;  2DJA A;  4GNF A;  2LN0 A;  2CSY A;  2JMD A;  2NAA A;  2LGG A;  2B0O E;  2KWK A;  4UP5 A;  2DX8 A;  1WEQ A;  2IQJ A;  4LLB A;  1WEU A;  4Z0O A;  2OWA A;  1VFY A;  3N9O A;  4YBS A;  3H7H A;  2D8U A;  2VPG A;  2JMJ A;  4YBT A;  4AVX A;  3RPG B;  4IC2 A;  2YT5 A;  3LQI A;  2ECT A;  1IYM A;  3KQI A;  1Z6U A;  2M6M A;  4R7E A;  1DCQ A;  2IDA A;  2ECJ A;  2XP0 A;  5B75 A;  3DQV R;  2FD4 A;  2Y43 A;  4FK5 A;  4OGE A;  2F6J A;  5H1U A;  3PHD A;  3T9K A;  2KE1 A;  5SVI B;  2QIZ A;  2MUM A;  2RSD A; 
#chains in the Genus database with same CATH homology
 4WZ0 A;  1BOR A;  3HTK C;  4F52 B;  5H9M A;  4UP0 A;  4TKP B;  1F62 A;  4CA1 A;  4ZQL A;  2C2L A;  2LXH C;  1MM2 A;  3U5P A;  2K1J A;  4AYC A;  5C11 A;  3RTR B;  2ECN A;  2VJF B;  4YAD A;  5TAB A;  2G6Q A;  4R2Y A;  3VK6 A;  2L5U A;  3KV5 A;  3GV4 A;  2KIZ A;  2C2V S;  2VPD A;  2MUM A;  3I2D A;  1XWH A;  5TRB A;  2KGI A;  2L0B A;  2F42 A;  5G0F A;  5B77 A;  2E6S A;  2ECI A;  2LGV A;  4UI9 B;  5TBN A;  1FBV A;  1JM7 A;  4GND A;  4L58 A;  2YUC A;  5KH3 A;  3V43 A;  4S3O B;  1WGM A;  3N9Q A;  1WEP A;  4A4C A;  1G25 A;  5B79 A;  3C6W A;  4V3L C;  4YAX A;  2YHO A;  3SHB A;  3NG2 A;  5D1M B;  3T7L A;  1U6G B;  4GNE A;  4YAT A;  4N3W A;  1VD4 A;  1V87 A;  2ECV A;  3ZPV E;  2G45 A;  2K4D A;  4C9Z A;  2MNY A;  5LKU A;  5C13 A;  2KFT A;  1LDK C;  3LQH A;  5D1K B;  4I7B A;  5B78 A;  2K16 A;  3SOX A;  4GNG A;  2K17 A;  1WES A;  4AYC B;  3LRQ A;  3C5K A;  1DVP A;  3N9P A;  2YSJ A;  2HYE D;  4PTB A;  3HCS A;  2EGP A;  2LXP C;  2VP7 A;  4YC9 A;  2MA6 A;  2QJ0 A;  4WA6 A;  4ZUX U;  2YUR A;  2FUI A;  5G04 B;  2LGL A;  3U5O A;  3ZTG A;  2YW8 A;  4A49 A;  2LGK A;  2BAY A;  2VPB A;  3O33 A;  2EOD A;  2E6R A;  2RI7 A;  5FB1 A;  4MVT A;  2YYR A;  2KWJ A;  2PUY A;  2MD8 C;  2PNX A;  3EB5 A;  3ZYQ A;  3O70 A;  5J3X A;  2KU3 A;  3M99 A;  4L7X A;  3O36 A;  4LKA A;  5FER A;  5D1L B;  1FP0 A;  3L1X A;  4YAB A;  1K2F A;  2Y1M A;  3HCT A;  3M62 A;  4A0C D;  5DIN A;  2YSM A;  4I7C A;  3GL6 A;  4O64 A;  3U5N A;  5B76 A;  4WZ2 A;  5DKA A;  4W4U A;  4QF3 A;  4S3O C;  4P5O B;  4AUQ B;  4NN2 A;  5H1T A;  1X4U A;  1Z2Q A;  1E4U A;  4GB0 A;  3U5M A;  1T1H A;  4I7D A;  4AP4 A;  5EYA F;  1HYJ A;  2CKL A;  2G43 A;  4A4B A;  4X3G A;  2FUU A;  4R8P K;  3N9M A;  5G05 B;  2ECG A;  3KNV A;  5LKT A;  2LDR A;  4XI1 A;  3N9L A;  5KH7 A;  2H0D A;  3ZVY A;  4FIP A;  5AIU A;  2Y1N A;  1RMD A;  3O37 A;  2HDP A;  3L1Z B;  2KRE A;  2L75 A;  4ZDT A;  2UZG A;  1HYI A;  3MHS A;  2MIQ A;  2VJE A;  5B8D A;  1WIL A;  3RPG C;  2M3H A;  1MM3 A;  4YBM A;  2MA5 A;  5H1V A;  2JMI A;  4QF2 A;  2YQM A;  3L11 A;  2MD7 B;  2JRJ A;  5JG6 A;  4MSX A;  2XEU A;  4PPE A;  1WEE A;  4IC3 A;  3SOU A;  2LV9 A;  3M63 A;  3O7A A;  2CT2 A;  2F6N A;  3HCU A;  3O35 A;  3LQJ A;  3DPL R;  3MHH A;  5TDR A;  2KWN A;  1N87 A;  2M1R A;  2M85 A;  2KGG A;  2YRE A;  2AN6 A;  2QIC A;  4Q6F A;  3ZPV 1;  1JM7 B;  4N4F A;  1WEN A;  2KWO A;  1WEO A;  4B7Y C;  1CHC A;  5FB0 A;  3O34 A;  5AIT A;  2YHN A;  4LAD B;  5LKZ A;  1LDJ B;  5I3L A;  2FSA A;  4B86 C;  3N9N A;  2KR4 A;  2MNZ A;  2VPE A;  2CKL B;  2YQL A;  3ZNI A;  2EA6 A;  4LJN A;  2LQ6 A;  2KYU A;  4LK9 A;  1WEV A;  2ZET C;  4FJC A;  5LKX A;  3T6R A;  3QZV A;  2MT5 A;  2OXQ C;  2H0D B;  3PUR A;  3FL2 A;  4CCG X;  4BHW A;  1JOC A;  2VNF A;  3PUQ A;  5KH9 A;  1X4J A;  3SOW A;  1WEM A;  4V3K C;  2YU4 A;  3ASL A;  3EB6 A;  2VJE B;  1Z60 A;  2LRI C;  3IHP A;  1WIM A;  2D8S A;  3ZVZ B;  2L80 A;  5TDW A;  5LCW B;  1VYX A;  1WE9 A;  2VJF A;  4BBQ A;  2I50 A;  4FO9 A;  2XB1 A;  3KV6 A;  2L43 A;  1X4I A;  2CSZ A;  1WFK A;  4WZ3 B;  1WEW A;  1ZBD B;  2ECW A;  4GNF A;  2LN0 A;  2CSY A;  2JMD A;  2NAA A;  2LGG A;  2KWK A;  4UP5 A;  2DX8 A;  1WEQ A;  4LLB A;  1WEU A;  1VFY A;  3N9O A;  4YBS A;  2VPG A;  2JMJ A;  4YBT A;  4AVX A;  3RPG B;  4IC2 A;  2YT5 A;  3LQI A;  2ECT A;  1IYM A;  3KQI A;  1Z6U A;  2M6M A;  4R7E A;  2IDA A;  2ECJ A;  5B75 A;  3DQV R;  2Y43 A;  4FK5 A;  5H1U A;  2F6J A;  3PHD A;  2KE1 A;  2QIZ A;  5FEY A;  2RSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...