3O70A

Phd-type zinc finger of human phd finger protein 13
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
LYFQGLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords PHD finger protein 13
publication title PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o70A00
4AP4A 2QICA 2FUUA 1WEWA 2KWOA 2KWNA 4YADA 1WEMA 4S3OC 3C5KA 1WGMA 2Y43A 2VJEA 1WEOA 3N9PA 5LKUA 2VJFB 3O36A 1JOCA 3O35A 2MUMA 3SOXA 5C11A 5B79A 2YUCA 5G04B 4L58A 3IHPA 3ZVYA 4N3WA 2YW8A 3EB6A 5TBNA 4CCGX 2VPDA 3LQJA 4AVXA 1XWHA 2PNXA 2CKLA 2XB1A 4FK5A 5LKXA 2MT5A 3U5OA 2YYRA 4IC3A 5B8DA 2I50A 4ZUXU 2G43A 2NAAA 1ZBDB 2F42A 4CA1A 2YQLA 1X4JA 2MD7B 4LKAA 4I7CA 4LK9A 4NN2A 4YBMA 3DQVR 2VJEB 3HCSA 4YAXA 2L75A 2JMJA 3SOWA 5AITA 2E6SA 2LGGA 1BORA 2G45A 4AYCB 2CT2A 3GL6A 2VJFA 2ECNA 5H1VA 2E6RA 2LDRA 2K1JA 5D1LB 2DX8A 5D1KB 4R8PK 2MA5A 2CKLB 4Q6FA 2Y1NA 2LRIC 4YBTA 2VNFA 3PHDA 5FEYA 2LGKA 1WEPA 4F52B 3SHBA 4WZ2A 3QZVA 1Z6UA 3O70A 4XI1A 2JMIA 4P5OB 4ZDTA 2ZETC 4PPEA 5G05B 1WENA 2M3HA 2VP7A 2YHNA 4B86C 4R7EA 1HYIA 4FO9A 1T1HA 1MM2A 1X4IA 2C2LA 3O34A 4WA6A 3HCTA 2F6JA 4A0CD 1N87A 2JMDA 5DKAA 3PUQA 3T7LA 1WEVA 4MVTA 3N9MA 3M63A 1WILA 2YSJA 2QJ0A 4L7XA 5JG6A 3L1XA 2M1RA 5KH7A 4AYCA 5KH3A 1LDKC 2MIQA 5DINA 3KV5A 2JRJA 1JM7A 3RPGB 3I2DA 5TABA 1WEQA 5H1UA 5FB0A 2LGVA 4LLBA 1F62A 2FUIA 1DVPA 1FP0A 3RPGC 2CSZA 3KNVA 2LV9A 3ZVZB 2VPBA 1CHCA 5H9MA 5B76A 2BAYA 4UP0A 3FL2A 4MSXA 2K17A 3O7AA 2LGLA 2ECWA 4YBSA 1G25A 2MNZA 2ECGA 2KGIA 2LQ6A 3O37A 1IYMA 4PTBA 5I3LA 4I7DA 3ZPVE 2KREA 2CSYA 2L5UA 3MHHA 1WIMA 2KFTA 4V3KC 1FBVA 1JM7B 3VK6A 2ECVA 2HYED 5D1MB 2K4DA 1WFKA 1VD4A 3N9OA 2L80A 4WZ0A 4FJCA 2YURA 2MA6A 3N9NA 5EYAF 2L43A 4I7BA 1Z60A 3DPLR 4AUQB 2QIZA 2UZGA 5B78A 2YREA 3L1ZB 3O33A 2PUYA 1X4UA 2LXHC 4GB0A 3ZPV1 2KIZA 4LJNA 3MHSA 1WEUA 4GNEA 4C9ZA 1WEEA 2KYUA 3U5PA 1HYJA 1K2FA 2KU3A 4W4UA 2MD8C 4BBQA 1E4UA 2YQMA 2ECTA 2K16A 2EGPA 2AN6A 3HTKC 4GNFA 4R2YA 3SOUA 4A4CA 2Y1MA 3ZTGA 1MM3A 3GV4A 4B7YC 4A49A 4A4BA 2KWKA 2KGGA 2VPEA 4YC9A 3ZYQA 2H0DA 4GNGA 2VPGA 5TRBA 4TKPB 1V87A 4WZ3B 2HDPA 1WESA 3M62A 3N9LA 3RTRB 2EA6A 3KV6A 4YABA 3NG2A 4N4FA 1WE9A 3M99A 5LKTA 5KH9A 2LXPC 4GNDA 2C2VS 2F6NA 5AIUA 4O64A 5LKZA 5H1TA 2EODA 3N9QA 2IDAA 3ASLA 4V3LC 2L0BA 1Z2QA 1LDJB 5J3XA 3U5MA 4QF3A 3U5NA 4X3GA 3V43A 4BHWA 2ECJA 4ZQLA 2KWJA 2YSMA 2YHOA 3C6WA 2G6QA 2RI7A 2H0DB 4IC2A 5FERA 1VYXA 2MNYA 3L11A 2D8SA 2ECIA 2M6MA 5TDWA 4UP5A 2LN0A 2KE1A 3HCUA 2KR4A 5LCWB 4FIPA 4YATA 3LQHA 5G0FA 2RSDA 5TDRA 2FSAA 1U6GB 3KQIA 4UI9B 3EB5A 3LRQA 5B77A 2OXQC 5FB1A 5C13A 2XEUA 2M85A 2YU4A 4QF2A 3ZNIA 4LADB 1VFYA 3PURA 1RMDA 2YT5A 5B75A 3T6RA 4S3OB 3LQIA
chains in the Genus database with same CATH superfamily
4AP4A 2QICA 2FUUA 1WEWA 3DDTA 2KWOA 2KWNA 4YADA 1WEMA 4S3OC 2CRWA 1WGMA 3C5KA 2Y43A 2VJEA 1WEOA 3N9PA 5LKUA 2VJFB 3O36A 1JOCA 3O35A 2MUMA 3SOXA 5C11A 5B79A 2CRRA 2YUCA 1MBMA 5G04B 4L58A 3IHPA 3ZVYA 4N3WA 2YW8A 3EB6A 2IQJA 5TBNA 4CCGX 2VPDA 3LQJA 4AVXA 1XWHA 2PNXA 2CKLA 2XB1A 4FK5A 3PLWA 5LKXA 2MT5A 3U5OA 4IC3A 2YVRA 2YYRA 5B8DA 2I50A 4ZUXU 2G43A 4OGEA 2NAAA 1ZBDB 2F42A 4CA1A 5K3QA 2YQLA 1X4JA 5SVXA 2MD7B 4LKAA 4I7CA 4LK9A 2XOCA 4Z0RA 4NN2A 4YBMA 3DQVR 2VJEB 3HCSA 4YAXA 3MDBC 2L75A 5SVYA 2JMJA 3SOWA 5AITA 2E6SA 2LGGA 1BORA 2G45A 4AYCB 2CT2A 3GL6A 2VJFA 2ECNA 5H1VA 2E6RA 2LDRA 3KDEC 2K1JA 5D1LB 2DX8A 5D1KB 4R8PK 2MA5A 2CKLB 4Q6FA 3LDYA 2Y1NA 2LRIC 4YBTA 2VNFA 3PHDA 5FEYA 2LGKA 1WEPA 2P57A 4F52B 3SHBA 4WZ2A 3QZVA 1Z6UA 2JM3A 2CSVA 3O70A 4XI1A 2JMIA 4P5OB 5SVIB 4ZDTA 2ZETC 4PPEA 5G05B 1WENA 2M3HA 2VP7A 2YHNA 4B86C 4R7EA 1HYIA 2LAUA 2EGMA 1T1HA 4FO9A 1MM2A 1X4IA 2C2LA 4QQ4A 3O34A 4WA6A 3HCTA 2F6JA 4A0CD 1N87A 2JMDA 5DKAA 3PUQA 3T7LA 1WEVA 3FM8C 4MVTA 3N9MA 3M63A 1WILA 3JUEA 2YSJA 2QJ0A 3E2DA 2RR4A 4L7XA 5JG6A 3L1XA 2M1RA 5KH7A 4AYCA 5KH3A 2E61A 1LDKC 2MIQA 5DINA 3KV5A 2JRJA 1JM7A 3RPGB 3I2DA 5TABA 1WEQA 3SUBA 3FEHA 5H1UA 5FB0A 2LGVA 4LLBA 2KKXA 1F62A 2FUIA 1DVPA 1FP0A 3RPGC 2CSZA 3KNVA 2LV9A 3ZVZB 4H9DA 2VPBA 1CHCA 5H9MA 5B76A 2BAYA 4UP0A 5SVIA 3FL2A 4MSXA 3T9KA 2L7PA 2K17A 3O7AA 2LGLA 2ECWA 4YBSA 1G25A 2MNZA 2ECGA 2KGIA 2LQ6A 3O37A 1IYMA 4PTBA 5I3LA 4I7DA 3ZPVE 2KREA 2CSYA 2L5UA 3MHHA 1WIMA 2KFTA 4V3KC 1FBVA 1JM7B 2DSMA 2XOZA 2OWAA 3VK6A 2ECVA 2HYED 3O47A 5D1MB 2K4DA 1WFKA 1VD4A 3N9OA 2L80A 4WZ0A 4FJCA 2YURA 2MA6A 3N9NA 5EYAF 2L43A 4I7BA 1Z60A 3DPLR 4AUQB 2QIZA 2UZGA 2JUNA 5B78A 2FD4A 2YREA 3L1ZB 3O33A 2PUYA 1X4UA 2LXHC 4GB0A 3ZPV1 2KIZA 4LJNA 3MHSA 1WEUA 4GNEA 3LVQE 4C9ZA 1WEEA 2KYUA 3U5PA 3FANA 1HYJA 1K2FA 2KU3A 2D8UA 4W4UA 2MD8C 4BBQA 1E4UA 3DWDA 2B0OE 2YQMA 2ECTA 2K16A 2EGPA 2AN6A 3HTKC 4GNFA 4R2YA 3SOUA 4A4CA 2Y1MA 3ZTGA 1MM3A 3GV4A 4B7YC 4A49A 4A4BA 2KWKA 2FFWA 2KGGA 2VPEA 3LJUX 4YC9A 3ZYQA 2H0DA 4GNGA 2VPGA 5TRBA 4TKPB 1V87A 2EXUA 4WZ3B 2XP0A 2HDPA 1WESA 2MKEA 3M62A 4Z0OA 3N9LA 3RTRB 2EA6A 3H7HA 4O62A 3KV6A 4YABA 2KKYA 3NG2A 4N4FA 1WE9A 3M99A 5LKTA 5KH9A 2LXPC 4GNDA 2C2VS 2F6NA 5AIUA 4O64A 3Q1DA 5LKZA 5H1TA 2EODA 3N9QA 2IDAA 3ASLA 4V3LC 2L0BA 1Z2QA 2M13A 1LDJB 5J3XA 3U5MA 4QF3A 3U5NA 4X3GA 2CONA 3V43A 4BHWA 2ECJA 3FAOA 4ZQLA 2KWJA 2YSMA 2YHOA 3C6WA 2G6QA 2RI7A 2H0DB 4IC2A 5FERA 1VYXA 2MNYA 3L11A 2D8SA 2ECIA 2M6MA 3LVRE 5TDWA 1DCQA 4UP5A 2LN0A 2KE1A 3FJUB 4OGCA 3HCUA 2KR4A 5LCWB 4FIPA 4YATA 2DJAA 3LQHA 5G0FA 2RSDA 4F1PA 5TDRA 2FSAA 1U6GB 3KQIA 4UI9B 2XOYA 3EB5A 3LRQA 5B77A 2OXQC 5FB1A 5C13A 2XEUA 2M85A 2YU4A 4QF2A 3ZNIA 4LADB 1VFYA 3PURA 1RMDA 2YT5A 3M7KA 5B75A 3T6RA 4S3OB 3LQIA
chains in the Genus database with same CATH topology
4AP4A 2QICA 2FUUA 1WEWA 2KWOA 2KWNA 4YADA 1WEMA 4S3OC 3C5KA 1WGMA 2Y43A 2VJEA 1WEOA 3N9PA 5LKUA 2VJFB 3O36A 1JOCA 3O35A 2MUMA 3SOXA 5C11A 5B79A 2YUCA 5G04B 4L58A 3IHPA 3ZVYA 4N3WA 2YW8A 3EB6A 5TBNA 4CCGX 2VPDA 3LQJA 4AVXA 1XWHA 2PNXA 2CKLA 2XB1A 4FK5A 5LKXA 2MT5A 3U5OA 2YYRA 4IC3A 5B8DA 2I50A 4ZUXU 2G43A 2NAAA 1ZBDB 2F42A 4CA1A 2YQLA 1X4JA 2MD7B 4LKAA 4I7CA 4LK9A 4NN2A 4YBMA 3DQVR 2VJEB 3HCSA 4YAXA 2L75A 2JMJA 3SOWA 5AITA 2E6SA 2LGGA 1BORA 2G45A 4AYCB 2CT2A 3GL6A 2VJFA 2ECNA 5H1VA 2E6RA 2LDRA 2K1JA 5D1LB 2DX8A 5D1KB 4R8PK 2MA5A 2CKLB 4Q6FA 2Y1NA 2LRIC 4YBTA 2VNFA 3PHDA 5FEYA 2LGKA 1WEPA 4F52B 3SHBA 4WZ2A 3QZVA 1Z6UA 3O70A 4XI1A 2JMIA 4P5OB 4ZDTA 2ZETC 4PPEA 5G05B 1WENA 2M3HA 2VP7A 2YHNA 4B86C 4R7EA 1HYIA 4FO9A 1T1HA 1MM2A 1X4IA 2C2LA 3O34A 4WA6A 3HCTA 2F6JA 4A0CD 1N87A 2JMDA 5DKAA 3PUQA 3T7LA 1WEVA 4MVTA 3N9MA 3M63A 1WILA 2YSJA 2QJ0A 4L7XA 5JG6A 3L1XA 2M1RA 5KH7A 4AYCA 5KH3A 1LDKC 2MIQA 5DINA 3KV5A 2JRJA 1JM7A 3RPGB 3I2DA 5TABA 1WEQA 5H1UA 5FB0A 2LGVA 4LLBA 1F62A 2FUIA 1DVPA 1FP0A 3RPGC 2CSZA 3KNVA 2LV9A 3ZVZB 2VPBA 1CHCA 5H9MA 5B76A 2BAYA 4UP0A 3FL2A 4MSXA 2K17A 3O7AA 2LGLA 2ECWA 4YBSA 1G25A 2MNZA 2ECGA 2KGIA 2LQ6A 3O37A 1IYMA 4PTBA 5I3LA 4I7DA 3ZPVE 2KREA 2CSYA 2L5UA 3MHHA 1WIMA 2KFTA 4V3KC 1FBVA 1JM7B 3VK6A 2ECVA 2HYED 5D1MB 2K4DA 1WFKA 1VD4A 3N9OA 2L80A 4WZ0A 4FJCA 2YURA 2MA6A 3N9NA 5EYAF 2L43A 4I7BA 1Z60A 3DPLR 4AUQB 2QIZA 2UZGA 5B78A 2YREA 3L1ZB 3O33A 2PUYA 1X4UA 2LXHC 4GB0A 3ZPV1 2KIZA 4LJNA 3MHSA 1WEUA 4GNEA 4C9ZA 1WEEA 2KYUA 3U5PA 1HYJA 1K2FA 2KU3A 4W4UA 2MD8C 4BBQA 1E4UA 2YQMA 2ECTA 2K16A 2EGPA 2AN6A 3HTKC 4GNFA 4R2YA 3SOUA 4A4CA 2Y1MA 3ZTGA 1MM3A 3GV4A 4B7YC 4A49A 4A4BA 2KWKA 2KGGA 2VPEA 4YC9A 3ZYQA 2H0DA 4GNGA 2VPGA 5TRBA 4TKPB 1V87A 4WZ3B 2HDPA 1WESA 3M62A 3N9LA 3RTRB 2EA6A 3KV6A 4YABA 3NG2A 4N4FA 1WE9A 3M99A 5LKTA 5KH9A 2LXPC 4GNDA 2C2VS 2F6NA 5AIUA 4O64A 5LKZA 5H1TA 2EODA 3N9QA 2IDAA 3ASLA 4V3LC 2L0BA 1Z2QA 1LDJB 5J3XA 3U5MA 4QF3A 3U5NA 4X3GA 3V43A 4BHWA 2ECJA 4ZQLA 2KWJA 2YSMA 2YHOA 3C6WA 2G6QA 2RI7A 2H0DB 4IC2A 5FERA 1VYXA 2MNYA 3L11A 2D8SA 2ECIA 2M6MA 5TDWA 4UP5A 2LN0A 2KE1A 3HCUA 2KR4A 5LCWB 4FIPA 4YATA 3LQHA 5G0FA 2RSDA 5TDRA 2FSAA 1U6GB 3KQIA 4UI9B 3EB5A 3LRQA 5B77A 2OXQC 5FB1A 5C13A 2XEUA 2M85A 2YU4A 4QF2A 3ZNIA 4LADB 1VFYA 3PURA 1RMDA 2YT5A 5B75A 3T6RA 4S3OB 3LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP4 A;  2QIC A;  2FUU A;  1WEW A;  2KWO A;  2KWN A;  4YAD A;  1WEM A;  4S3O C;  3C5K A;  1WGM A;  2Y43 A;  2VJE A;  1WEO A;  3N9P A;  5LKU A;  2VJF B;  3O36 A;  1JOC A;  3O35 A;  2MUM A;  3SOX A;  5C11 A;  5B79 A;  2YUC A;  5G04 B;  4L58 A;  3IHP A;  3ZVY A;  4N3W A;  2YW8 A;  3EB6 A;  5TBN A;  4CCG X;  2VPD A;  3LQJ A;  4AVX A;  1XWH A;  2PNX A;  2CKL A;  2XB1 A;  4FK5 A;  5LKX A;  2MT5 A;  3U5O A;  2YYR A;  4IC3 A;  5B8D A;  2I50 A;  4ZUX U;  2G43 A;  2NAA A;  1ZBD B;  2F42 A;  4CA1 A;  2YQL A;  1X4J A;  2MD7 B;  4LKA A;  4I7C A;  4LK9 A;  4NN2 A;  4YBM A;  3DQV R;  2VJE B;  3HCS A;  4YAX A;  2L75 A;  2JMJ A;  3SOW A;  5AIT A;  2E6S A;  2LGG A;  1BOR A;  2G45 A;  4AYC B;  2CT2 A;  3GL6 A;  2VJF A;  2ECN A;  5H1V A;  2E6R A;  2LDR A;  2K1J A;  5D1L B;  2DX8 A;  5D1K B;  4R8P K;  2MA5 A;  2CKL B;  4Q6F A;  2Y1N A;  2LRI C;  4YBT A;  2VNF A;  3PHD A;  5FEY A;  2LGK A;  1WEP A;  4F52 B;  3SHB A;  4WZ2 A;  3QZV A;  1Z6U A;  3O70 A;  4XI1 A;  2JMI A;  4P5O B;  4ZDT A;  2ZET C;  4PPE A;  5G05 B;  1WEN A;  2M3H A;  2VP7 A;  2YHN A;  4B86 C;  4R7E A;  1HYI A;  4FO9 A;  1T1H A;  1MM2 A;  1X4I A;  2C2L A;  3O34 A;  4WA6 A;  3HCT A;  2F6J A;  4A0C D;  1N87 A;  2JMD A;  5DKA A;  3PUQ A;  3T7L A;  1WEV A;  4MVT A;  3N9M A;  3M63 A;  1WIL A;  2YSJ A;  2QJ0 A;  4L7X A;  5JG6 A;  3L1X A;  2M1R A;  5KH7 A;  4AYC A;  5KH3 A;  1LDK C;  2MIQ A;  5DIN A;  3KV5 A;  2JRJ A;  1JM7 A;  3RPG B;  3I2D A;  5TAB A;  1WEQ A;  5H1U A;  5FB0 A;  2LGV A;  4LLB A;  1F62 A;  2FUI A;  1DVP A;  1FP0 A;  3RPG C;  2CSZ A;  3KNV A;  2LV9 A;  3ZVZ B;  2VPB A;  1CHC A;  5H9M A;  5B76 A;  2BAY A;  4UP0 A;  3FL2 A;  4MSX A;  2K17 A;  3O7A A;  2LGL A;  2ECW A;  4YBS A;  1G25 A;  2MNZ A;  2ECG A;  2KGI A;  2LQ6 A;  3O37 A;  1IYM A;  4PTB A;  5I3L A;  4I7D A;  3ZPV E;  2KRE A;  2CSY A;  2L5U A;  3MHH A;  1WIM A;  2KFT A;  4V3K C;  1FBV A;  1JM7 B;  3VK6 A;  2ECV A;  2HYE D;  5D1M B;  2K4D A;  1WFK A;  1VD4 A;  3N9O A;  2L80 A;  4WZ0 A;  4FJC A;  2YUR A;  2MA6 A;  3N9N A;  5EYA F;  2L43 A;  4I7B A;  1Z60 A;  3DPL R;  4AUQ B;  2QIZ A;  2UZG A;  5B78 A;  2YRE A;  3L1Z B;  3O33 A;  2PUY A;  1X4U A;  2LXH C;  4GB0 A;  3ZPV 1;  2KIZ A;  4LJN A;  3MHS A;  1WEU A;  4GNE A;  4C9Z A;  1WEE A;  2KYU A;  3U5P A;  1HYJ A;  1K2F A;  2KU3 A;  4W4U A;  2MD8 C;  4BBQ A;  1E4U A;  2YQM A;  2ECT A;  2K16 A;  2EGP A;  2AN6 A;  3HTK C;  4GNF A;  4R2Y A;  3SOU A;  4A4C A;  2Y1M A;  3ZTG A;  1MM3 A;  3GV4 A;  4B7Y C;  4A49 A;  4A4B A;  2KWK A;  2KGG A;  2VPE A;  4YC9 A;  3ZYQ A;  2H0D A;  4GNG A;  2VPG A;  5TRB A;  4TKP B;  1V87 A;  4WZ3 B;  2HDP A;  1WES A;  3M62 A;  3N9L A;  3RTR B;  2EA6 A;  3KV6 A;  4YAB A;  3NG2 A;  4N4F A;  1WE9 A;  3M99 A;  5LKT A;  5KH9 A;  2LXP C;  4GND A;  2C2V S;  2F6N A;  5AIU A;  4O64 A;  5LKZ A;  5H1T A;  2EOD A;  3N9Q A;  2IDA A;  3ASL A;  4V3L C;  2L0B A;  1Z2Q A;  1LDJ B;  5J3X A;  3U5M A;  4QF3 A;  3U5N A;  4X3G A;  3V43 A;  4BHW A;  2ECJ A;  4ZQL A;  2KWJ A;  2YSM A;  2YHO A;  3C6W A;  2G6Q A;  2RI7 A;  2H0D B;  4IC2 A;  5FER A;  1VYX A;  2MNY A;  3L11 A;  2D8S A;  2ECI A;  2M6M A;  5TDW A;  4UP5 A;  2LN0 A;  2KE1 A;  3HCU A;  2KR4 A;  5LCW B;  4FIP A;  4YAT A;  3LQH A;  5G0F A;  2RSD A;  5TDR A;  2FSA A;  1U6G B;  3KQI A;  4UI9 B;  3EB5 A;  3LRQ A;  5B77 A;  2OXQ C;  5FB1 A;  5C13 A;  2XEU A;  2M85 A;  2YU4 A;  4QF2 A;  3ZNI A;  4LAD B;  1VFY A;  3PUR A;  1RMD A;  2YT5 A;  5B75 A;  3T6R A;  4S3O B;  3LQI A; 
#chains in the Genus database with same CATH topology
 4AP4 A;  2QIC A;  2FUU A;  1WEW A;  3DDT A;  2KWO A;  2KWN A;  4YAD A;  1WEM A;  4S3O C;  2CRW A;  1WGM A;  3C5K A;  2Y43 A;  2VJE A;  1WEO A;  3N9P A;  5LKU A;  2VJF B;  3O36 A;  1JOC A;  3O35 A;  2MUM A;  3SOX A;  5C11 A;  5B79 A;  2CRR A;  2YUC A;  1MBM A;  5G04 B;  4L58 A;  3IHP A;  3ZVY A;  4N3W A;  2YW8 A;  3EB6 A;  2IQJ A;  5TBN A;  4CCG X;  2VPD A;  3LQJ A;  4AVX A;  1XWH A;  2PNX A;  2CKL A;  2XB1 A;  4FK5 A;  3PLW A;  5LKX A;  2MT5 A;  3U5O A;  4IC3 A;  2YVR A;  2YYR A;  5B8D A;  2I50 A;  4ZUX U;  2G43 A;  4OGE A;  2NAA A;  1ZBD B;  2F42 A;  4CA1 A;  5K3Q A;  2YQL A;  1X4J A;  5SVX A;  2MD7 B;  4LKA A;  4I7C A;  4LK9 A;  2XOC A;  4Z0R A;  4NN2 A;  4YBM A;  3DQV R;  2VJE B;  3HCS A;  4YAX A;  3MDB C;  2L75 A;  5SVY A;  2JMJ A;  3SOW A;  5AIT A;  2E6S A;  2LGG A;  1BOR A;  2G45 A;  4AYC B;  2CT2 A;  3GL6 A;  2VJF A;  2ECN A;  5H1V A;  2E6R A;  2LDR A;  3KDE C;  2K1J A;  5D1L B;  2DX8 A;  5D1K B;  4R8P K;  2MA5 A;  2CKL B;  4Q6F A;  3LDY A;  2Y1N A;  2LRI C;  4YBT A;  2VNF A;  3PHD A;  5FEY A;  2LGK A;  1WEP A;  2P57 A;  4F52 B;  3SHB A;  4WZ2 A;  3QZV A;  1Z6U A;  2JM3 A;  2CSV A;  3O70 A;  4XI1 A;  2JMI A;  4P5O B;  5SVI B;  4ZDT A;  2ZET C;  4PPE A;  5G05 B;  1WEN A;  2M3H A;  2VP7 A;  2YHN A;  4B86 C;  4R7E A;  1HYI A;  2LAU A;  2EGM A;  1T1H A;  4FO9 A;  1MM2 A;  1X4I A;  2C2L A;  4QQ4 A;  3O34 A;  4WA6 A;  3HCT A;  2F6J A;  4A0C D;  1N87 A;  2JMD A;  5DKA A;  3PUQ A;  3T7L A;  1WEV A;  3FM8 C;  4MVT A;  3N9M A;  3M63 A;  1WIL A;  3JUE A;  2YSJ A;  2QJ0 A;  3E2D A;  2RR4 A;  4L7X A;  5JG6 A;  3L1X A;  2M1R A;  5KH7 A;  4AYC A;  5KH3 A;  2E61 A;  1LDK C;  2MIQ A;  5DIN A;  3KV5 A;  2JRJ A;  1JM7 A;  3RPG B;  3I2D A;  5TAB A;  1WEQ A;  3SUB A;  3FEH A;  5H1U A;  5FB0 A;  2LGV A;  4LLB A;  2KKX A;  1F62 A;  2FUI A;  1DVP A;  1FP0 A;  3RPG C;  2CSZ A;  3KNV A;  2LV9 A;  3ZVZ B;  4H9D A;  2VPB A;  1CHC A;  5H9M A;  5B76 A;  2BAY A;  4UP0 A;  5SVI A;  3FL2 A;  4MSX A;  3T9K A;  2L7P A;  2K17 A;  3O7A A;  2LGL A;  2ECW A;  4YBS A;  1G25 A;  2MNZ A;  2ECG A;  2KGI A;  2LQ6 A;  3O37 A;  1IYM A;  4PTB A;  5I3L A;  4I7D A;  3ZPV E;  2KRE A;  2CSY A;  2L5U A;  3MHH A;  1WIM A;  2KFT A;  4V3K C;  1FBV A;  1JM7 B;  2DSM A;  2XOZ A;  2OWA A;  3VK6 A;  2ECV A;  2HYE D;  3O47 A;  5D1M B;  2K4D A;  1WFK A;  1VD4 A;  3N9O A;  2L80 A;  4WZ0 A;  4FJC A;  2YUR A;  2MA6 A;  3N9N A;  5EYA F;  2L43 A;  4I7B A;  1Z60 A;  3DPL R;  4AUQ B;  2QIZ A;  2UZG A;  2JUN A;  5B78 A;  2FD4 A;  2YRE A;  3L1Z B;  3O33 A;  2PUY A;  1X4U A;  2LXH C;  4GB0 A;  3ZPV 1;  2KIZ A;  4LJN A;  3MHS A;  1WEU A;  4GNE A;  3LVQ E;  4C9Z A;  1WEE A;  2KYU A;  3U5P A;  3FAN A;  1HYJ A;  1K2F A;  2KU3 A;  2D8U A;  4W4U A;  2MD8 C;  4BBQ A;  1E4U A;  3DWD A;  2B0O E;  2YQM A;  2ECT A;  2K16 A;  2EGP A;  2AN6 A;  3HTK C;  4GNF A;  4R2Y A;  3SOU A;  4A4C A;  2Y1M A;  3ZTG A;  1MM3 A;  3GV4 A;  4B7Y C;  4A49 A;  4A4B A;  2KWK A;  2FFW A;  2KGG A;  2VPE A;  3LJU X;  4YC9 A;  3ZYQ A;  2H0D A;  4GNG A;  2VPG A;  5TRB A;  4TKP B;  1V87 A;  2EXU A;  4WZ3 B;  2XP0 A;  2HDP A;  1WES A;  2MKE A;  3M62 A;  4Z0O A;  3N9L A;  3RTR B;  2EA6 A;  3H7H A;  4O62 A;  3KV6 A;  4YAB A;  2KKY A;  3NG2 A;  4N4F A;  1WE9 A;  3M99 A;  5LKT A;  5KH9 A;  2LXP C;  4GND A;  2C2V S;  2F6N A;  5AIU A;  4O64 A;  3Q1D A;  5LKZ A;  5H1T A;  2EOD A;  3N9Q A;  2IDA A;  3ASL A;  4V3L C;  2L0B A;  1Z2Q A;  2M13 A;  1LDJ B;  5J3X A;  3U5M A;  4QF3 A;  3U5N A;  4X3G A;  2CON A;  3V43 A;  4BHW A;  2ECJ A;  3FAO A;  4ZQL A;  2KWJ A;  2YSM A;  2YHO A;  3C6W A;  2G6Q A;  2RI7 A;  2H0D B;  4IC2 A;  5FER A;  1VYX A;  2MNY A;  3L11 A;  2D8S A;  2ECI A;  2M6M A;  3LVR E;  5TDW A;  1DCQ A;  4UP5 A;  2LN0 A;  2KE1 A;  3FJU B;  4OGC A;  3HCU A;  2KR4 A;  5LCW B;  4FIP A;  4YAT A;  2DJA A;  3LQH A;  5G0F A;  2RSD A;  4F1P A;  5TDR A;  2FSA A;  1U6G B;  3KQI A;  4UI9 B;  2XOY A;  3EB5 A;  3LRQ A;  5B77 A;  2OXQ C;  5FB1 A;  5C13 A;  2XEU A;  2M85 A;  2YU4 A;  4QF2 A;  3ZNI A;  4LAD B;  1VFY A;  3PUR A;  1RMD A;  2YT5 A;  3M7K A;  5B75 A;  3T6R A;  4S3O B;  3LQI A; 
#chains in the Genus database with same CATH homology
 4AP4 A;  2QIC A;  2FUU A;  1WEW A;  2KWO A;  2KWN A;  4YAD A;  1WEM A;  4S3O C;  3C5K A;  1WGM A;  2Y43 A;  2VJE A;  1WEO A;  3N9P A;  5LKU A;  2VJF B;  3O36 A;  1JOC A;  3O35 A;  2MUM A;  3SOX A;  5C11 A;  5B79 A;  2YUC A;  5G04 B;  4L58 A;  3IHP A;  3ZVY A;  4N3W A;  2YW8 A;  3EB6 A;  5TBN A;  4CCG X;  2VPD A;  3LQJ A;  4AVX A;  1XWH A;  2PNX A;  2CKL A;  2XB1 A;  4FK5 A;  5LKX A;  2MT5 A;  3U5O A;  2YYR A;  4IC3 A;  5B8D A;  2I50 A;  4ZUX U;  2G43 A;  2NAA A;  1ZBD B;  2F42 A;  4CA1 A;  2YQL A;  1X4J A;  2MD7 B;  4LKA A;  4I7C A;  4LK9 A;  4NN2 A;  4YBM A;  3DQV R;  2VJE B;  3HCS A;  4YAX A;  2L75 A;  2JMJ A;  3SOW A;  5AIT A;  2E6S A;  2LGG A;  1BOR A;  2G45 A;  4AYC B;  2CT2 A;  3GL6 A;  2VJF A;  2ECN A;  5H1V A;  2E6R A;  2LDR A;  2K1J A;  5D1L B;  2DX8 A;  5D1K B;  4R8P K;  2MA5 A;  2CKL B;  4Q6F A;  2Y1N A;  2LRI C;  4YBT A;  2VNF A;  3PHD A;  5FEY A;  2LGK A;  1WEP A;  4F52 B;  3SHB A;  4WZ2 A;  3QZV A;  1Z6U A;  3O70 A;  4XI1 A;  2JMI A;  4P5O B;  4ZDT A;  2ZET C;  4PPE A;  5G05 B;  1WEN A;  2M3H A;  2VP7 A;  2YHN A;  4B86 C;  4R7E A;  1HYI A;  4FO9 A;  1T1H A;  1MM2 A;  1X4I A;  2C2L A;  3O34 A;  4WA6 A;  3HCT A;  2F6J A;  4A0C D;  1N87 A;  2JMD A;  5DKA A;  3PUQ A;  3T7L A;  1WEV A;  4MVT A;  3N9M A;  3M63 A;  1WIL A;  2YSJ A;  2QJ0 A;  4L7X A;  5JG6 A;  3L1X A;  2M1R A;  5KH7 A;  4AYC A;  5KH3 A;  1LDK C;  2MIQ A;  5DIN A;  3KV5 A;  2JRJ A;  1JM7 A;  3RPG B;  3I2D A;  5TAB A;  1WEQ A;  5H1U A;  5FB0 A;  2LGV A;  4LLB A;  1F62 A;  2FUI A;  1DVP A;  1FP0 A;  3RPG C;  2CSZ A;  3KNV A;  2LV9 A;  3ZVZ B;  2VPB A;  1CHC A;  5H9M A;  5B76 A;  2BAY A;  4UP0 A;  3FL2 A;  4MSX A;  2K17 A;  3O7A A;  2LGL A;  2ECW A;  4YBS A;  1G25 A;  2MNZ A;  2ECG A;  2KGI A;  2LQ6 A;  3O37 A;  1IYM A;  4PTB A;  5I3L A;  4I7D A;  3ZPV E;  2KRE A;  2CSY A;  2L5U A;  3MHH A;  1WIM A;  2KFT A;  4V3K C;  1FBV A;  1JM7 B;  3VK6 A;  2ECV A;  2HYE D;  5D1M B;  2K4D A;  1WFK A;  1VD4 A;  3N9O A;  2L80 A;  4WZ0 A;  4FJC A;  2YUR A;  2MA6 A;  3N9N A;  5EYA F;  2L43 A;  4I7B A;  1Z60 A;  3DPL R;  4AUQ B;  2QIZ A;  2UZG A;  5B78 A;  2YRE A;  3L1Z B;  3O33 A;  2PUY A;  1X4U A;  2LXH C;  4GB0 A;  3ZPV 1;  2KIZ A;  4LJN A;  3MHS A;  1WEU A;  4GNE A;  4C9Z A;  1WEE A;  2KYU A;  3U5P A;  1HYJ A;  1K2F A;  2KU3 A;  4W4U A;  2MD8 C;  4BBQ A;  1E4U A;  2YQM A;  2ECT A;  2K16 A;  2EGP A;  2AN6 A;  3HTK C;  4GNF A;  4R2Y A;  3SOU A;  4A4C A;  2Y1M A;  3ZTG A;  1MM3 A;  3GV4 A;  4B7Y C;  4A49 A;  4A4B A;  2KWK A;  2KGG A;  2VPE A;  4YC9 A;  3ZYQ A;  2H0D A;  4GNG A;  2VPG A;  5TRB A;  4TKP B;  1V87 A;  4WZ3 B;  2HDP A;  1WES A;  3M62 A;  3N9L A;  3RTR B;  2EA6 A;  3KV6 A;  4YAB A;  3NG2 A;  4N4F A;  1WE9 A;  3M99 A;  5LKT A;  5KH9 A;  2LXP C;  4GND A;  2C2V S;  2F6N A;  5AIU A;  4O64 A;  5LKZ A;  5H1T A;  2EOD A;  3N9Q A;  2IDA A;  3ASL A;  4V3L C;  2L0B A;  1Z2Q A;  1LDJ B;  5J3X A;  3U5M A;  4QF3 A;  3U5N A;  4X3G A;  3V43 A;  4BHW A;  2ECJ A;  4ZQL A;  2KWJ A;  2YSM A;  2YHO A;  3C6W A;  2G6Q A;  2RI7 A;  2H0D B;  4IC2 A;  5FER A;  1VYX A;  2MNY A;  3L11 A;  2D8S A;  2ECI A;  2M6M A;  5TDW A;  4UP5 A;  2LN0 A;  2KE1 A;  3HCU A;  2KR4 A;  5LCW B;  4FIP A;  4YAT A;  3LQH A;  5G0F A;  2RSD A;  5TDR A;  2FSA A;  1U6G B;  3KQI A;  4UI9 B;  3EB5 A;  3LRQ A;  5B77 A;  2OXQ C;  5FB1 A;  5C13 A;  2XEU A;  2M85 A;  2YU4 A;  4QF2 A;  3ZNI A;  4LAD B;  1VFY A;  3PUR A;  1RMD A;  2YT5 A;  5B75 A;  3T6R A;  4S3O B;  3LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...