3O70A

Phd-type zinc finger of human phd finger protein 13
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
LYFQGLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 13
publication title PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o70A00
4Q6FA 5AITA 1MM3A 5FB0A 4R7EA 4C9ZA 2F6NA 2VJFA 3PURA 2MT5A 1VFYA 2RSDA 2D8SA 1WEQA 2VP7A 2YHNA 3O37A 4TKPB 2LRIC 5H1UA 3ASLA 3FL2A 2LXPC 2KR4A 4GNEA 4YATA 4I7CA 2YT5A 1FBVA 1WGMA 2MD8C 3ZNIA 2HYED 2YSMA 1K2FA 2F6JA 2XB1A 4L58A 4QF2A 4LADB 4UP0A 2JRJA 4FJCA 2G43A 5C13A 5TABA 3IHPA 5B75A 2H0DB 2CKLA 4IC3A 2ECVA 1G25A 2YSJA 1WEEA 4A0CD 3N9NA 3O36A 5B78A 3MHHA 1X4JA 3LQHA 2FSAA 3HCSA 2FUIA 2LGVA 5EYAF 1WEMA 2VNFA 3EB6A 5B79A 3C5KA 3KNVA 3SHBA 4R8PK 3EB5A 4GB0A 4I7DA 4B86C 1F62A 4N4FA 2MIQA 2C2LA 5B76A 4UI9B 5LKTA 2JMDA 2MA5A 1JM7B 2KWKA 3ZVYA 4YC9A 3SOWA 3N9MA 2KGIA 3T7LA 2H0DA 5FEYA 5LKUA 4YABA 5H1VA 4WA6A 2KU3A 4WZ2A 2G45A 5TBNA 2L0BA 3N9LA 2LGKA 2YHOA 5J3XA 2KWJA 2DX8A 2CSYA 2M3HA 1X4IA 5LCWB 2YYRA 1E4UA 3KQIA 2YURA 1LDKC 3RPGB 3PUQA 2YQMA 5D1KB 1IYMA 3VK6A 1RMDA 2M6MA 2ECJA 1WEPA 4IC2A 2YUCA 4O64A 4FO9A 2QJ0A 4P5OB 4AYCB 3ZVZB 3ZPV1 5D1MB 2ECWA 2QIZA 4WZ3B 2MUMA 3N9QA 2KREA 1JM7A 2VJEB 2CSZA 3U5MA 4X3GA 1WEWA 4A4CA 3N9PA 2Y1MA 1WENA 2LV9A 4LJNA 1WE9A 4V3KC 3GL6A 2LDRA 4S3OC 1CHCA 2ZETC 4A49A 2RI7A 3LQIA 5C11A 1U6GB 4PPEA 3RTRB 4CA1A 3U5OA 4YADA 3M62A 5LKZA 2PUYA 2JMJA 1WEVA 4LKAA 4W4UA 2K17A 2VPBA 3U5NA 5FB1A 3QZVA 1LDJB 1N87A 4PTBA 1WILA 3PHDA 4MSXA 4B7YC 2YREA 3GV4A 1DVPA 2MNYA 3LRQA 2FUUA 2EODA 1X4UA 2ECTA 3L11A 4YAXA 2KFTA 2C2VS 2YU4A 1T1HA 4XI1A 4AYCA 1JOCA 3ZYQA 4LK9A 2G6QA 1WEUA 4GNFA 2IDAA 3ZTGA 5G0FA 2MA6A 4L7XA 2VJEA 2KGGA 5H9MA 1Z60A 2BAYA 2E6SA 4UP5A 2OXQC 3O34A 1WFKA 5DINA 3L1ZB 4AP4A 4N3WA 3ZPVE 4A4BA 2YW8A 5JG6A 2AN6A 2KE1A 3V43A 4GNGA 5B77A 4ZDTA 3U5PA 2I50A 2K1JA 5FERA 3KV6A 2KWNA 5H1TA 2LQ6A 2F42A 4QF3A 5AIUA 2JMIA 5KH3A 4V3LC 3T6RA 2M85A 1VD4A 4BBQA 3O7AA 1Z6UA 2KWOA 1HYJA 5TDWA 2Y1NA 5G05B 3M99A 3C6WA 1ZBDB 4R2YA 2ECGA 2LGGA 2PNXA 4FIPA 4FK5A 2YQLA 2LXHC 3KV5A 4ZUXU 2Y43A 4YBMA 3DPLR 2L43A 2E6RA 4GNDA 4ZQLA 1FP0A 3SOUA 4WZ0A 3DQVR 2HDPA 4AVXA 2NAAA 4YBSA 4MVTA 3HCUA 2XEUA 2L75A 2VPDA 3O33A 2QICA 3HCTA 1HYIA 1WIMA 5KH9A 2K16A 4I7BA 2VJFB 5G04B 4F52B 3I2DA 4BHWA 5KH7A 2ECNA 5LKXA 2M1RA 1V87A 1Z2QA 2VPGA 2LGLA 3N9OA 3RPGC 3SOXA 3LQJA 3M63A 1WEOA 4LLBA 1XWHA 5DKAA 2L5UA 3L1XA 2VPEA 5TDRA 2KIZA 4NN2A 3MHSA 2K4DA 4S3OB 5TRBA 2CKLB 1MM2A 3NG2A 3O35A 2EGPA 4CCGX 2CT2A 4AUQB 5B8DA 2L80A 2LN0A 2EA6A 5I3LA 1BORA 1VYXA 1WESA 2MD7B 3O70A 2UZGA 4YBTA 2MNZA 3HTKC 5D1LB 2KYUA 2ECIA
chains in the Genus database with same CATH superfamily
4Q6FA 5AITA 2EXUA 1MM3A 5FB0A 4R7EA 4C9ZA 2F6NA 2VJFA 3PURA 2MT5A 1VFYA 2RSDA 2D8SA 1WEQA 2VP7A 2YHNA 3O47A 3O37A 4TKPB 2LRIC 5H1UA 3ASLA 3FL2A 2LXPC 2KR4A 4GNEA 4YATA 4I7CA 2YT5A 1FBVA 1WGMA 2MD8C 3ZNIA 2HYED 2YSMA 1K2FA 2XOCA 2F6JA 2XB1A 4L58A 4QF2A 1MBMA 4LADB 4UP0A 2JRJA 4FJCA 2G43A 5SVIB 5C13A 5TABA 3IHPA 5B75A 2H0DB 2CKLA 3PLWA 4IC3A 2ECVA 4OGCA 1G25A 3DDTA 2YSJA 3SUBA 1WEEA 3FEHA 4A0CD 2RR4A 3N9NA 3LJUX 3O36A 5B78A 3MHHA 1X4JA 3LQHA 2DSMA 2FSAA 3T9KA 2CSVA 3HCSA 2FUIA 2LGVA 5EYAF 1WEMA 2VNFA 2IQJA 3EB6A 4Z0OA 5B79A 3C5KA 3KNVA 3SHBA 4R8PK 3EB5A 4GB0A 4I7DA 4B86C 1F62A 4N4FA 2MIQA 4QQ4A 2C2LA 5B76A 4UI9B 5LKTA 2JMDA 2JM3A 2MA5A 1JM7B 2KWKA 4F1PA 2XOZA 3ZVYA 2KKXA 4YC9A 3SOWA 3N9MA 2KGIA 5SVYA 3T7LA 5SVIA 2H0DA 5FEYA 5LKUA 2E61A 5H1VA 4WA6A 4YABA 4H9DA 2KU3A 4WZ2A 2G45A 5TBNA 2L0BA 3N9LA 2LGKA 2YHOA 5J3XA 2KWJA 2DX8A 2CSYA 2M3HA 1X4IA 5LCWB 2YYRA 1E4UA 2MKEA 2OWAA 3KQIA 2YURA 1LDKC 3RPGB 3PUQA 2YQMA 5D1KB 1IYMA 3VK6A 1RMDA 2M6MA 2ECJA 1WEPA 2XOYA 4IC2A 2YUCA 4O64A 4FO9A 2QJ0A 4P5OB 4AYCB 3ZVZB 2EGMA 3ZPV1 3FAOA 5D1MB 3E2DA 2ECWA 2QIZA 3DWDA 4WZ3B 2MUMA 3N9QA 2YVRA 2KREA 1JM7A 2VJEB 3FM8C 2L7PA 2CSZA 3U5MA 4X3GA 1WEWA 4A4CA 3N9PA 2Y1MA 1WENA 2LV9A 3JUEA 4LJNA 1WE9A 4V3KC 3GL6A 2LDRA 4S3OC 1CHCA 2ZETC 4A49A 2RI7A 3LQIA 5C11A 1U6GB 4PPEA 3RTRB 4CA1A 3U5OA 4YADA 3M62A 5LKZA 2PUYA 2JMJA 1WEVA 4LKAA 4W4UA 2K17A 2VPBA 3U5NA 5FB1A 3QZVA 1LDJB 1N87A 5SVXA 4PTBA 1WILA 3PHDA 4MSXA 4B7YC 2YREA 2JUNA 3FJUB 2DJAA 4O62A 3GV4A 1DVPA 2MNYA 3LRQA 2FUUA 2EODA 1X4UA 2ECTA 3L11A 4YAXA 2KFTA 2C2VS 2YU4A 1T1HA 4XI1A 4AYCA 1JOCA 3ZYQA 4LK9A 2B0OE 2G6QA 1WEUA 3MDBC 4GNFA 2IDAA 3ZTGA 5G0FA 2MA6A 4L7XA 2VJEA 2KGGA 5H9MA 1Z60A 2BAYA 2E6SA 2CONA 4UP5A 2OXQC 3O34A 1WFKA 5DINA 3L1ZB 4AP4A 4N3WA 3ZPVE 4A4BA 2YW8A 5JG6A 2AN6A 2M13A 3FANA 2KKYA 2KE1A 3V43A 2D8UA 2CRRA 4GNGA 5B77A 4ZDTA 3U5PA 2I50A 2K1JA 2P57A 5FERA 3KV6A 2KWNA 5H1TA 2LQ6A 2F42A 4QF3A 5AIUA 2JMIA 5KH3A 4V3LC 3LVQE 3T6RA 2M85A 5K3QA 1VD4A 4BBQA 2FFWA 3O7AA 1Z6UA 3KDEC 2XP0A 2KWOA 1HYJA 5TDWA 2Y1NA 5G05B 3M99A 3C6WA 1ZBDB 4R2YA 2ECGA 2LGGA 2PNXA 4FIPA 4FK5A 1DCQA 2YQLA 2LXHC 3KV5A 4ZUXU 2Y43A 4OGEA 4YBMA 3DPLR 2L43A 2E6RA 4GNDA 4ZQLA 1FP0A 3SOUA 4WZ0A 3DQVR 2HDPA 4AVXA 2NAAA 4YBSA 4MVTA 3HCUA 2XEUA 4Z0RA 2L75A 3H7HA 3M7KA 2VPDA 3O33A 2QICA 3HCTA 1HYIA 3Q1DA 1WIMA 5KH9A 2K16A 4I7BA 2VJFB 5G04B 4F52B 3I2DA 4BHWA 5KH7A 2ECNA 5LKXA 2FD4A 2M1RA 3LVRE 1V87A 1Z2QA 2VPGA 2LGLA 3N9OA 2LAUA 3RPGC 3LDYA 3SOXA 3LQJA 3M63A 1WEOA 4LLBA 1XWHA 5DKAA 2L5UA 3L1XA 2VPEA 5TDRA 2KIZA 4NN2A 3MHSA 2K4DA 4S3OB 5TRBA 2CKLB 1MM2A 3NG2A 3O35A 2EGPA 4CCGX 2CT2A 4AUQB 5B8DA 2L80A 2LN0A 2EA6A 5I3LA 1BORA 1VYXA 1WESA 2MD7B 3O70A 2UZGA 4YBTA 2MNZA 3HTKC 5D1LB 2KYUA 2CRWA 2ECIA
chains in the Genus database with same CATH topology
4Q6FA 5AITA 1MM3A 5FB0A 4R7EA 4C9ZA 2F6NA 2VJFA 3PURA 2MT5A 1VFYA 2RSDA 2D8SA 1WEQA 2VP7A 2YHNA 3O37A 4TKPB 2LRIC 5H1UA 3ASLA 3FL2A 2LXPC 2KR4A 4GNEA 4YATA 4I7CA 2YT5A 1FBVA 1WGMA 2MD8C 3ZNIA 2HYED 2YSMA 1K2FA 2F6JA 2XB1A 4L58A 4QF2A 4LADB 4UP0A 2JRJA 4FJCA 2G43A 5C13A 5TABA 3IHPA 5B75A 2H0DB 2CKLA 4IC3A 2ECVA 1G25A 2YSJA 1WEEA 4A0CD 3N9NA 3O36A 5B78A 3MHHA 1X4JA 3LQHA 2FSAA 3HCSA 2FUIA 2LGVA 5EYAF 1WEMA 2VNFA 3EB6A 5B79A 3C5KA 3KNVA 3SHBA 4R8PK 3EB5A 4GB0A 4I7DA 4B86C 1F62A 4N4FA 2MIQA 2C2LA 5B76A 4UI9B 5LKTA 2JMDA 2MA5A 1JM7B 2KWKA 3ZVYA 4YC9A 3SOWA 3N9MA 2KGIA 3T7LA 2H0DA 5FEYA 5LKUA 4YABA 5H1VA 4WA6A 2KU3A 4WZ2A 2G45A 5TBNA 2L0BA 3N9LA 2LGKA 2YHOA 5J3XA 2KWJA 2DX8A 2CSYA 2M3HA 1X4IA 5LCWB 2YYRA 1E4UA 3KQIA 2YURA 1LDKC 3RPGB 3PUQA 2YQMA 5D1KB 1IYMA 3VK6A 1RMDA 2M6MA 2ECJA 1WEPA 4IC2A 2YUCA 4O64A 4FO9A 2QJ0A 4P5OB 4AYCB 3ZVZB 3ZPV1 5D1MB 2ECWA 2QIZA 4WZ3B 2MUMA 3N9QA 2KREA 1JM7A 2VJEB 2CSZA 3U5MA 4X3GA 1WEWA 4A4CA 3N9PA 2Y1MA 1WENA 2LV9A 4LJNA 1WE9A 4V3KC 3GL6A 2LDRA 4S3OC 1CHCA 2ZETC 4A49A 2RI7A 3LQIA 5C11A 1U6GB 4PPEA 3RTRB 4CA1A 3U5OA 4YADA 3M62A 5LKZA 2PUYA 2JMJA 1WEVA 4LKAA 4W4UA 2K17A 2VPBA 3U5NA 5FB1A 3QZVA 1LDJB 1N87A 4PTBA 1WILA 3PHDA 4MSXA 4B7YC 2YREA 3GV4A 1DVPA 2MNYA 3LRQA 2FUUA 2EODA 1X4UA 2ECTA 3L11A 4YAXA 2KFTA 2C2VS 2YU4A 1T1HA 4XI1A 4AYCA 1JOCA 3ZYQA 4LK9A 2G6QA 1WEUA 4GNFA 2IDAA 3ZTGA 5G0FA 2MA6A 4L7XA 2VJEA 2KGGA 5H9MA 1Z60A 2BAYA 2E6SA 4UP5A 2OXQC 3O34A 1WFKA 5DINA 3L1ZB 4AP4A 4N3WA 3ZPVE 4A4BA 2YW8A 5JG6A 2AN6A 2KE1A 3V43A 4GNGA 5B77A 4ZDTA 3U5PA 2I50A 2K1JA 5FERA 3KV6A 2KWNA 5H1TA 2LQ6A 2F42A 4QF3A 5AIUA 2JMIA 5KH3A 4V3LC 3T6RA 2M85A 1VD4A 4BBQA 3O7AA 1Z6UA 2KWOA 1HYJA 5TDWA 2Y1NA 5G05B 3M99A 3C6WA 1ZBDB 4R2YA 2ECGA 2LGGA 2PNXA 4FIPA 4FK5A 2YQLA 2LXHC 3KV5A 4ZUXU 2Y43A 4YBMA 3DPLR 2L43A 2E6RA 4GNDA 4ZQLA 1FP0A 3SOUA 4WZ0A 3DQVR 2HDPA 4AVXA 2NAAA 4YBSA 4MVTA 3HCUA 2XEUA 2L75A 2VPDA 3O33A 2QICA 3HCTA 1HYIA 1WIMA 5KH9A 2K16A 4I7BA 2VJFB 5G04B 4F52B 3I2DA 4BHWA 5KH7A 2ECNA 5LKXA 2M1RA 1V87A 1Z2QA 2VPGA 2LGLA 3N9OA 3RPGC 3SOXA 3LQJA 3M63A 1WEOA 4LLBA 1XWHA 5DKAA 2L5UA 3L1XA 2VPEA 5TDRA 2KIZA 4NN2A 3MHSA 2K4DA 4S3OB 5TRBA 2CKLB 1MM2A 3NG2A 3O35A 2EGPA 4CCGX 2CT2A 4AUQB 5B8DA 2L80A 2LN0A 2EA6A 5I3LA 1BORA 1VYXA 1WESA 2MD7B 3O70A 2UZGA 4YBTA 2MNZA 3HTKC 5D1LB 2KYUA 2ECIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q6F A;  5AIT A;  1MM3 A;  5FB0 A;  4R7E A;  4C9Z A;  2F6N A;  2VJF A;  3PUR A;  2MT5 A;  1VFY A;  2RSD A;  2D8S A;  1WEQ A;  2VP7 A;  2YHN A;  3O37 A;  4TKP B;  2LRI C;  5H1U A;  3ASL A;  3FL2 A;  2LXP C;  2KR4 A;  4GNE A;  4YAT A;  4I7C A;  2YT5 A;  1FBV A;  1WGM A;  2MD8 C;  3ZNI A;  2HYE D;  2YSM A;  1K2F A;  2F6J A;  2XB1 A;  4L58 A;  4QF2 A;  4LAD B;  4UP0 A;  2JRJ A;  4FJC A;  2G43 A;  5C13 A;  5TAB A;  3IHP A;  5B75 A;  2H0D B;  2CKL A;  4IC3 A;  2ECV A;  1G25 A;  2YSJ A;  1WEE A;  4A0C D;  3N9N A;  3O36 A;  5B78 A;  3MHH A;  1X4J A;  3LQH A;  2FSA A;  3HCS A;  2FUI A;  2LGV A;  5EYA F;  1WEM A;  2VNF A;  3EB6 A;  5B79 A;  3C5K A;  3KNV A;  3SHB A;  4R8P K;  3EB5 A;  4GB0 A;  4I7D A;  4B86 C;  1F62 A;  4N4F A;  2MIQ A;  2C2L A;  5B76 A;  4UI9 B;  5LKT A;  2JMD A;  2MA5 A;  1JM7 B;  2KWK A;  3ZVY A;  4YC9 A;  3SOW A;  3N9M A;  2KGI A;  3T7L A;  2H0D A;  5FEY A;  5LKU A;  4YAB A;  5H1V A;  4WA6 A;  2KU3 A;  4WZ2 A;  2G45 A;  5TBN A;  2L0B A;  3N9L A;  2LGK A;  2YHO A;  5J3X A;  2KWJ A;  2DX8 A;  2CSY A;  2M3H A;  1X4I A;  5LCW B;  2YYR A;  1E4U A;  3KQI A;  2YUR A;  1LDK C;  3RPG B;  3PUQ A;  2YQM A;  5D1K B;  1IYM A;  3VK6 A;  1RMD A;  2M6M A;  2ECJ A;  1WEP A;  4IC2 A;  2YUC A;  4O64 A;  4FO9 A;  2QJ0 A;  4P5O B;  4AYC B;  3ZVZ B;  3ZPV 1;  5D1M B;  2ECW A;  2QIZ A;  4WZ3 B;  2MUM A;  3N9Q A;  2KRE A;  1JM7 A;  2VJE B;  2CSZ A;  3U5M A;  4X3G A;  1WEW A;  4A4C A;  3N9P A;  2Y1M A;  1WEN A;  2LV9 A;  4LJN A;  1WE9 A;  4V3K C;  3GL6 A;  2LDR A;  4S3O C;  1CHC A;  2ZET C;  4A49 A;  2RI7 A;  3LQI A;  5C11 A;  1U6G B;  4PPE A;  3RTR B;  4CA1 A;  3U5O A;  4YAD A;  3M62 A;  5LKZ A;  2PUY A;  2JMJ A;  1WEV A;  4LKA A;  4W4U A;  2K17 A;  2VPB A;  3U5N A;  5FB1 A;  3QZV A;  1LDJ B;  1N87 A;  4PTB A;  1WIL A;  3PHD A;  4MSX A;  4B7Y C;  2YRE A;  3GV4 A;  1DVP A;  2MNY A;  3LRQ A;  2FUU A;  2EOD A;  1X4U A;  2ECT A;  3L11 A;  4YAX A;  2KFT A;  2C2V S;  2YU4 A;  1T1H A;  4XI1 A;  4AYC A;  1JOC A;  3ZYQ A;  4LK9 A;  2G6Q A;  1WEU A;  4GNF A;  2IDA A;  3ZTG A;  5G0F A;  2MA6 A;  4L7X A;  2VJE A;  2KGG A;  5H9M A;  1Z60 A;  2BAY A;  2E6S A;  4UP5 A;  2OXQ C;  3O34 A;  1WFK A;  5DIN A;  3L1Z B;  4AP4 A;  4N3W A;  3ZPV E;  4A4B A;  2YW8 A;  5JG6 A;  2AN6 A;  2KE1 A;  3V43 A;  4GNG A;  5B77 A;  4ZDT A;  3U5P A;  2I50 A;  2K1J A;  5FER A;  3KV6 A;  2KWN A;  5H1T A;  2LQ6 A;  2F42 A;  4QF3 A;  5AIU A;  2JMI A;  5KH3 A;  4V3L C;  3T6R A;  2M85 A;  1VD4 A;  4BBQ A;  3O7A A;  1Z6U A;  2KWO A;  1HYJ A;  5TDW A;  2Y1N A;  5G05 B;  3M99 A;  3C6W A;  1ZBD B;  4R2Y A;  2ECG A;  2LGG A;  2PNX A;  4FIP A;  4FK5 A;  2YQL A;  2LXH C;  3KV5 A;  4ZUX U;  2Y43 A;  4YBM A;  3DPL R;  2L43 A;  2E6R A;  4GND A;  4ZQL A;  1FP0 A;  3SOU A;  4WZ0 A;  3DQV R;  2HDP A;  4AVX A;  2NAA A;  4YBS A;  4MVT A;  3HCU A;  2XEU A;  2L75 A;  2VPD A;  3O33 A;  2QIC A;  3HCT A;  1HYI A;  1WIM A;  5KH9 A;  2K16 A;  4I7B A;  2VJF B;  5G04 B;  4F52 B;  3I2D A;  4BHW A;  5KH7 A;  2ECN A;  5LKX A;  2M1R A;  1V87 A;  1Z2Q A;  2VPG A;  2LGL A;  3N9O A;  3RPG C;  3SOX A;  3LQJ A;  3M63 A;  1WEO A;  4LLB A;  1XWH A;  5DKA A;  2L5U A;  3L1X A;  2VPE A;  5TDR A;  2KIZ A;  4NN2 A;  3MHS A;  2K4D A;  4S3O B;  5TRB A;  2CKL B;  1MM2 A;  3NG2 A;  3O35 A;  2EGP A;  4CCG X;  2CT2 A;  4AUQ B;  5B8D A;  2L80 A;  2LN0 A;  2EA6 A;  5I3L A;  1BOR A;  1VYX A;  1WES A;  2MD7 B;  3O70 A;  2UZG A;  4YBT A;  2MNZ A;  3HTK C;  5D1L B;  2KYU A;  2ECI A; 
#chains in the Genus database with same CATH topology
 4Q6F A;  5AIT A;  2EXU A;  1MM3 A;  5FB0 A;  4R7E A;  4C9Z A;  2F6N A;  2VJF A;  3PUR A;  2MT5 A;  1VFY A;  2RSD A;  2D8S A;  1WEQ A;  2VP7 A;  2YHN A;  3O47 A;  3O37 A;  4TKP B;  2LRI C;  5H1U A;  3ASL A;  3FL2 A;  2LXP C;  2KR4 A;  4GNE A;  4YAT A;  4I7C A;  2YT5 A;  1FBV A;  1WGM A;  2MD8 C;  3ZNI A;  2HYE D;  2YSM A;  1K2F A;  2XOC A;  2F6J A;  2XB1 A;  4L58 A;  4QF2 A;  1MBM A;  4LAD B;  4UP0 A;  2JRJ A;  4FJC A;  2G43 A;  5SVI B;  5C13 A;  5TAB A;  3IHP A;  5B75 A;  2H0D B;  2CKL A;  3PLW A;  4IC3 A;  2ECV A;  4OGC A;  1G25 A;  3DDT A;  2YSJ A;  3SUB A;  1WEE A;  3FEH A;  4A0C D;  2RR4 A;  3N9N A;  3LJU X;  3O36 A;  5B78 A;  3MHH A;  1X4J A;  3LQH A;  2DSM A;  2FSA A;  3T9K A;  2CSV A;  3HCS A;  2FUI A;  2LGV A;  5EYA F;  1WEM A;  2VNF A;  2IQJ A;  3EB6 A;  4Z0O A;  5B79 A;  3C5K A;  3KNV A;  3SHB A;  4R8P K;  3EB5 A;  4GB0 A;  4I7D A;  4B86 C;  1F62 A;  4N4F A;  2MIQ A;  4QQ4 A;  2C2L A;  5B76 A;  4UI9 B;  5LKT A;  2JMD A;  2JM3 A;  2MA5 A;  1JM7 B;  2KWK A;  4F1P A;  2XOZ A;  3ZVY A;  2KKX A;  4YC9 A;  3SOW A;  3N9M A;  2KGI A;  5SVY A;  3T7L A;  5SVI A;  2H0D A;  5FEY A;  5LKU A;  2E61 A;  5H1V A;  4WA6 A;  4YAB A;  4H9D A;  2KU3 A;  4WZ2 A;  2G45 A;  5TBN A;  2L0B A;  3N9L A;  2LGK A;  2YHO A;  5J3X A;  2KWJ A;  2DX8 A;  2CSY A;  2M3H A;  1X4I A;  5LCW B;  2YYR A;  1E4U A;  2MKE A;  2OWA A;  3KQI A;  2YUR A;  1LDK C;  3RPG B;  3PUQ A;  2YQM A;  5D1K B;  1IYM A;  3VK6 A;  1RMD A;  2M6M A;  2ECJ A;  1WEP A;  2XOY A;  4IC2 A;  2YUC A;  4O64 A;  4FO9 A;  2QJ0 A;  4P5O B;  4AYC B;  3ZVZ B;  2EGM A;  3ZPV 1;  3FAO A;  5D1M B;  3E2D A;  2ECW A;  2QIZ A;  3DWD A;  4WZ3 B;  2MUM A;  3N9Q A;  2YVR A;  2KRE A;  1JM7 A;  2VJE B;  3FM8 C;  2L7P A;  2CSZ A;  3U5M A;  4X3G A;  1WEW A;  4A4C A;  3N9P A;  2Y1M A;  1WEN A;  2LV9 A;  3JUE A;  4LJN A;  1WE9 A;  4V3K C;  3GL6 A;  2LDR A;  4S3O C;  1CHC A;  2ZET C;  4A49 A;  2RI7 A;  3LQI A;  5C11 A;  1U6G B;  4PPE A;  3RTR B;  4CA1 A;  3U5O A;  4YAD A;  3M62 A;  5LKZ A;  2PUY A;  2JMJ A;  1WEV A;  4LKA A;  4W4U A;  2K17 A;  2VPB A;  3U5N A;  5FB1 A;  3QZV A;  1LDJ B;  1N87 A;  5SVX A;  4PTB A;  1WIL A;  3PHD A;  4MSX A;  4B7Y C;  2YRE A;  2JUN A;  3FJU B;  2DJA A;  4O62 A;  3GV4 A;  1DVP A;  2MNY A;  3LRQ A;  2FUU A;  2EOD A;  1X4U A;  2ECT A;  3L11 A;  4YAX A;  2KFT A;  2C2V S;  2YU4 A;  1T1H A;  4XI1 A;  4AYC A;  1JOC A;  3ZYQ A;  4LK9 A;  2B0O E;  2G6Q A;  1WEU A;  3MDB C;  4GNF A;  2IDA A;  3ZTG A;  5G0F A;  2MA6 A;  4L7X A;  2VJE A;  2KGG A;  5H9M A;  1Z60 A;  2BAY A;  2E6S A;  2CON A;  4UP5 A;  2OXQ C;  3O34 A;  1WFK A;  5DIN A;  3L1Z B;  4AP4 A;  4N3W A;  3ZPV E;  4A4B A;  2YW8 A;  5JG6 A;  2AN6 A;  2M13 A;  3FAN A;  2KKY A;  2KE1 A;  3V43 A;  2D8U A;  2CRR A;  4GNG A;  5B77 A;  4ZDT A;  3U5P A;  2I50 A;  2K1J A;  2P57 A;  5FER A;  3KV6 A;  2KWN A;  5H1T A;  2LQ6 A;  2F42 A;  4QF3 A;  5AIU A;  2JMI A;  5KH3 A;  4V3L C;  3LVQ E;  3T6R A;  2M85 A;  5K3Q A;  1VD4 A;  4BBQ A;  2FFW A;  3O7A A;  1Z6U A;  3KDE C;  2XP0 A;  2KWO A;  1HYJ A;  5TDW A;  2Y1N A;  5G05 B;  3M99 A;  3C6W A;  1ZBD B;  4R2Y A;  2ECG A;  2LGG A;  2PNX A;  4FIP A;  4FK5 A;  1DCQ A;  2YQL A;  2LXH C;  3KV5 A;  4ZUX U;  2Y43 A;  4OGE A;  4YBM A;  3DPL R;  2L43 A;  2E6R A;  4GND A;  4ZQL A;  1FP0 A;  3SOU A;  4WZ0 A;  3DQV R;  2HDP A;  4AVX A;  2NAA A;  4YBS A;  4MVT A;  3HCU A;  2XEU A;  4Z0R A;  2L75 A;  3H7H A;  3M7K A;  2VPD A;  3O33 A;  2QIC A;  3HCT A;  1HYI A;  3Q1D A;  1WIM A;  5KH9 A;  2K16 A;  4I7B A;  2VJF B;  5G04 B;  4F52 B;  3I2D A;  4BHW A;  5KH7 A;  2ECN A;  5LKX A;  2FD4 A;  2M1R A;  3LVR E;  1V87 A;  1Z2Q A;  2VPG A;  2LGL A;  3N9O A;  2LAU A;  3RPG C;  3LDY A;  3SOX A;  3LQJ A;  3M63 A;  1WEO A;  4LLB A;  1XWH A;  5DKA A;  2L5U A;  3L1X A;  2VPE A;  5TDR A;  2KIZ A;  4NN2 A;  3MHS A;  2K4D A;  4S3O B;  5TRB A;  2CKL B;  1MM2 A;  3NG2 A;  3O35 A;  2EGP A;  4CCG X;  2CT2 A;  4AUQ B;  5B8D A;  2L80 A;  2LN0 A;  2EA6 A;  5I3L A;  1BOR A;  1VYX A;  1WES A;  2MD7 B;  3O70 A;  2UZG A;  4YBT A;  2MNZ A;  3HTK C;  5D1L B;  2KYU A;  2CRW A;  2ECI A; 
#chains in the Genus database with same CATH homology
 4Q6F A;  5AIT A;  1MM3 A;  5FB0 A;  4R7E A;  4C9Z A;  2F6N A;  2VJF A;  3PUR A;  2MT5 A;  1VFY A;  2RSD A;  2D8S A;  1WEQ A;  2VP7 A;  2YHN A;  3O37 A;  4TKP B;  2LRI C;  5H1U A;  3ASL A;  3FL2 A;  2LXP C;  2KR4 A;  4GNE A;  4YAT A;  4I7C A;  2YT5 A;  1FBV A;  1WGM A;  2MD8 C;  3ZNI A;  2HYE D;  2YSM A;  1K2F A;  2F6J A;  2XB1 A;  4L58 A;  4QF2 A;  4LAD B;  4UP0 A;  2JRJ A;  4FJC A;  2G43 A;  5C13 A;  5TAB A;  3IHP A;  5B75 A;  2H0D B;  2CKL A;  4IC3 A;  2ECV A;  1G25 A;  2YSJ A;  1WEE A;  4A0C D;  3N9N A;  3O36 A;  5B78 A;  3MHH A;  1X4J A;  3LQH A;  2FSA A;  3HCS A;  2FUI A;  2LGV A;  5EYA F;  1WEM A;  2VNF A;  3EB6 A;  5B79 A;  3C5K A;  3KNV A;  3SHB A;  4R8P K;  3EB5 A;  4GB0 A;  4I7D A;  4B86 C;  1F62 A;  4N4F A;  2MIQ A;  2C2L A;  5B76 A;  4UI9 B;  5LKT A;  2JMD A;  2MA5 A;  1JM7 B;  2KWK A;  3ZVY A;  4YC9 A;  3SOW A;  3N9M A;  2KGI A;  3T7L A;  2H0D A;  5FEY A;  5LKU A;  4YAB A;  5H1V A;  4WA6 A;  2KU3 A;  4WZ2 A;  2G45 A;  5TBN A;  2L0B A;  3N9L A;  2LGK A;  2YHO A;  5J3X A;  2KWJ A;  2DX8 A;  2CSY A;  2M3H A;  1X4I A;  5LCW B;  2YYR A;  1E4U A;  3KQI A;  2YUR A;  1LDK C;  3RPG B;  3PUQ A;  2YQM A;  5D1K B;  1IYM A;  3VK6 A;  1RMD A;  2M6M A;  2ECJ A;  1WEP A;  4IC2 A;  2YUC A;  4O64 A;  4FO9 A;  2QJ0 A;  4P5O B;  4AYC B;  3ZVZ B;  3ZPV 1;  5D1M B;  2ECW A;  2QIZ A;  4WZ3 B;  2MUM A;  3N9Q A;  2KRE A;  1JM7 A;  2VJE B;  2CSZ A;  3U5M A;  4X3G A;  1WEW A;  4A4C A;  3N9P A;  2Y1M A;  1WEN A;  2LV9 A;  4LJN A;  1WE9 A;  4V3K C;  3GL6 A;  2LDR A;  4S3O C;  1CHC A;  2ZET C;  4A49 A;  2RI7 A;  3LQI A;  5C11 A;  1U6G B;  4PPE A;  3RTR B;  4CA1 A;  3U5O A;  4YAD A;  3M62 A;  5LKZ A;  2PUY A;  2JMJ A;  1WEV A;  4LKA A;  4W4U A;  2K17 A;  2VPB A;  3U5N A;  5FB1 A;  3QZV A;  1LDJ B;  1N87 A;  4PTB A;  1WIL A;  3PHD A;  4MSX A;  4B7Y C;  2YRE A;  3GV4 A;  1DVP A;  2MNY A;  3LRQ A;  2FUU A;  2EOD A;  1X4U A;  2ECT A;  3L11 A;  4YAX A;  2KFT A;  2C2V S;  2YU4 A;  1T1H A;  4XI1 A;  4AYC A;  1JOC A;  3ZYQ A;  4LK9 A;  2G6Q A;  1WEU A;  4GNF A;  2IDA A;  3ZTG A;  5G0F A;  2MA6 A;  4L7X A;  2VJE A;  2KGG A;  5H9M A;  1Z60 A;  2BAY A;  2E6S A;  4UP5 A;  2OXQ C;  3O34 A;  1WFK A;  5DIN A;  3L1Z B;  4AP4 A;  4N3W A;  3ZPV E;  4A4B A;  2YW8 A;  5JG6 A;  2AN6 A;  2KE1 A;  3V43 A;  4GNG A;  5B77 A;  4ZDT A;  3U5P A;  2I50 A;  2K1J A;  5FER A;  3KV6 A;  2KWN A;  5H1T A;  2LQ6 A;  2F42 A;  4QF3 A;  5AIU A;  2JMI A;  5KH3 A;  4V3L C;  3T6R A;  2M85 A;  1VD4 A;  4BBQ A;  3O7A A;  1Z6U A;  2KWO A;  1HYJ A;  5TDW A;  2Y1N A;  5G05 B;  3M99 A;  3C6W A;  1ZBD B;  4R2Y A;  2ECG A;  2LGG A;  2PNX A;  4FIP A;  4FK5 A;  2YQL A;  2LXH C;  3KV5 A;  4ZUX U;  2Y43 A;  4YBM A;  3DPL R;  2L43 A;  2E6R A;  4GND A;  4ZQL A;  1FP0 A;  3SOU A;  4WZ0 A;  3DQV R;  2HDP A;  4AVX A;  2NAA A;  4YBS A;  4MVT A;  3HCU A;  2XEU A;  2L75 A;  2VPD A;  3O33 A;  2QIC A;  3HCT A;  1HYI A;  1WIM A;  5KH9 A;  2K16 A;  4I7B A;  2VJF B;  5G04 B;  4F52 B;  3I2D A;  4BHW A;  5KH7 A;  2ECN A;  5LKX A;  2M1R A;  1V87 A;  1Z2Q A;  2VPG A;  2LGL A;  3N9O A;  3RPG C;  3SOX A;  3LQJ A;  3M63 A;  1WEO A;  4LLB A;  1XWH A;  5DKA A;  2L5U A;  3L1X A;  2VPE A;  5TDR A;  2KIZ A;  4NN2 A;  3MHS A;  2K4D A;  4S3O B;  5TRB A;  2CKL B;  1MM2 A;  3NG2 A;  3O35 A;  2EGP A;  4CCG X;  2CT2 A;  4AUQ B;  5B8D A;  2L80 A;  2LN0 A;  2EA6 A;  5I3L A;  1BOR A;  1VYX A;  1WES A;  2MD7 B;  3O70 A;  2UZG A;  4YBT A;  2MNZ A;  3HTK C;  5D1L B;  2KYU A;  2ECI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...