3O70A

Phd-type zinc finger of human phd finger protein 13
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
LYFQGLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords PHD finger protein 13
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o70A00
5TRBA 3DPLR 4YATA 3RPGB 5FB1A 2C2VS 4BBQA 1WFKA 4AVXA 1MM3A 2VJEA 3O34A 3O36A 2ECJA 4A0CD 4LJNA 5LCWB 3U5PA 1WEEA 2M3HA 2LGKA 3PUQA 5G05B 4GNFA 4B86C 5B77A 4N4FA 5TABA 5KH3A 2RSDA 2Y1NA 2KIZA 5H1VA 1N87A 3ZPVE 2KR4A 3NG2A 3O7AA 1VFYA 3SHBA 2LGVA 2KWOA 2LQ6A 3GL6A 4FIPA 2KWKA 4AP4A 1K2FA 2L80A 4A4BA 2F42A 5H1TA 4I7CA 2VJFA 5LKTA 4PTBA 3L1ZB 1X4UA 3O70A 4L7XA 3HCTA 1WEVA 2ECVA 3N9QA 2AN6A 3ZTGA 4C9ZA 2YSMA 1BORA 5FB0A 1JM7B 2ECWA 4UI9B 1F62A 3N9NA 5KH7A 3I2DA 4LLBA 2KGGA 5I3LA 2EA6A 3N9LA 2ECTA 5J3XA 2KYUA 3IHPA 2KE1A 4QF3A 2KREA 2PUYA 3KV5A 2XEUA 3C6WA 4N3WA 2MA5A 1MM2A 2ZETC 4BHWA 4IC3A 5H9MA 3SOUA 4R8PK 3LRQA 2JMJA 2E6SA 3EB5A 2D8SA 3ZVZB 4V3LC 4UP0A 4GNEA 5FERA 2MNYA 1WEOA 5EYAF 5D1KB 1ZBDB 3HCSA 5AITA 2MUMA 1Z2QA 4YABA 4Q6FA 4LADB 2KWJA 4P5OB 4WZ0A 2LXPC 5TBNA 1Z6UA 5D1LB 1X4JA 3RPGC 1T1HA 3KNVA 4LK9A 2YHNA 2YQMA 4F52B 2XB1A 4A49A 4AUQB 1Z60A 3U5NA 2C2LA 2VJFB 2CSYA 1DVPA 4FK5A 5H1UA 2CSZA 2YSJA 2YUCA 4YADA 4CA1A 2JMIA 2Y43A 4CCGX 2FUUA 4WZ3B 1X4IA 3KQIA 3MHSA 2QJ0A 1LDKC 1WEPA 4MSXA 3SOXA 2UZGA 3N9MA 2M1RA 3C5KA 1WENA 5B75A 5C11A 2FSAA 4XI1A 2YT5A 2VPEA 2YYRA 4QF2A 1HYIA 2I50A 2YHOA 1IYMA 2LRIC 3SOWA 1WEWA 4YBTA 2L5UA 5JG6A 2YREA 3T6RA 4S3OC 4W4UA 3O33A 2VP7A 4WA6A 1WESA 2EGPA 4O64A 2LDRA 2IDAA 2KGIA 3DQVR 2LXHC 1WILA 5B78A 2YQLA 3LQHA 4YAXA 1CHCA 2L75A 2VPDA 2ECIA 3KV6A 3O37A 4A4CA 5DKAA 2HDPA 4LKAA 2LGLA 3VK6A 2DX8A 4IC2A 3GV4A 4FO9A 2YU4A 4AYCA 3EB6A 1HYJA 1WEUA 5G04B 2F6JA 3RTRB 2JMDA 1WGMA 2RI7A 3ASLA 4WZ2A 1WIMA 2BAYA 3O35A 1E4UA 2MT5A 2VPGA 2H0DB 4PPEA 4YC9A 4L58A 5DINA 2L0BA 1VD4A 2EODA 2K4DA 3PURA 4AYCB 1VYXA 4YBSA 3M99A 2E6RA 5B8DA 4X3GA 2CKLB 1WE9A 3ZPV1 3FL2A 4GB0A 2FUIA 3M63A 2VPBA 3M62A 2ECNA 1V87A 2LN0A 1WEMA 4I7DA 2QICA 5G0FA 2KFTA 3N9OA 4ZDTA 2K1JA 2LGGA 4B7YC 2MIQA 2F6NA 2CKLA 3LQIA 1LDJB 3ZYQA 5B79A 2MD8C 4TKPB 5TDRA 5AIUA 4R7EA 4YBMA 5C13A 1RMDA 3ZNIA 1JM7A 2H0DA 3HTKC 3ZVYA 2LV9A 3T7LA 3U5OA 2QIZA 2M6MA 5LKXA 3HCUA 1U6GB 4V3KC 2KU3A 2K16A 5KH9A 5FEYA 5TDWA 2OXQC 3V43A 3U5MA 2L43A 4NN2A 3N9PA 3L1XA 2CT2A 3PHDA 1FP0A 4R2YA 4GNGA 2HYED 2G45A 4MVTA 3QZVA 1G25A 2G6QA 5LKUA 2MD7B 2M85A 2NAAA 2MNZA 2MA6A 1FBVA 1XWHA 2KWNA 2G43A 2VJEB 4ZQLA 2YW8A 4GNDA 2PNXA 2VNFA 3MHHA 2K17A 4ZUXU 3LQJA 2JRJA 5B76A 1JOCA 2ECGA 4UP5A 4S3OB 5D1MB 3L11A 4FJCA 4I7BA 5LKZA 2YURA 1WEQA 2Y1MA
chains in the Genus database with same CATH superfamily
3KDEC 5TRBA 3DPLR 4YATA 3RPGB 5FB1A 2C2VS 4BBQA 1WFKA 4AVXA 1MM3A 2VJEA 3O34A 3O36A 2ECJA 4A0CD 3PLWA 4LJNA 5LCWB 3U5PA 1WEEA 2M3HA 2LGKA 3PUQA 5G05B 4GNFA 5SVYA 4B86C 3O47A 5B77A 4N4FA 5TABA 5KH3A 2RSDA 2Y1NA 2KIZA 5H1VA 1N87A 3DWDA 3ZPVE 2KR4A 3NG2A 3O7AA 1VFYA 3SHBA 2LGVA 2KWOA 2LQ6A 3GL6A 2P57A 2XOZA 4FIPA 2KWKA 4AP4A 3Q1DA 1K2FA 2L80A 4A4BA 2F42A 5H1TA 4I7CA 3MDBC 2VJFA 5LKTA 4Z0OA 4PTBA 3L1ZB 1X4UA 3O70A 4L7XA 3HCTA 1WEVA 2ECVA 3N9QA 2AN6A 3ZTGA 4C9ZA 2YSMA 1BORA 5FB0A 1JM7B 2ECWA 4UI9B 1F62A 3LDYA 3N9NA 5KH7A 3I2DA 4LLBA 2KGGA 5I3LA 2EA6A 2YVRA 3N9LA 2ECTA 5J3XA 2KYUA 3IHPA 4QF3A 2KE1A 2KREA 2EXUA 2PUYA 2M13A 3KV5A 2XEUA 3JUEA 3C6WA 4N3WA 2MA5A 2CRRA 1MM2A 2ZETC 4IC3A 4BHWA 5H9MA 3SOUA 4R8PK 3LRQA 2JMJA 2E6SA 3EB5A 2D8SA 5K3QA 3ZVZB 4V3LC 4UP0A 4GNEA 5FERA 2MNYA 1WEOA 2B0OE 5EYAF 5D1KB 1ZBDB 3HCSA 5AITA 2MUMA 1Z2QA 4YABA 4Q6FA 4LADB 2KWJA 4P5OB 4WZ0A 2LXPC 5TBNA 1Z6UA 5D1LB 1X4JA 3RPGC 1T1HA 3KNVA 4LK9A 2YHNA 2YQMA 4F52B 2XB1A 4A49A 4AUQB 1Z60A 3U5NA 2C2LA 2VJFB 2CSYA 1DVPA 4FK5A 5H1UA 2CSZA 2YSJA 2YUCA 4YADA 4CA1A 2JMIA 2Y43A 2FFWA 4CCGX 2FUUA 4WZ3B 1X4IA 3KQIA 3MHSA 2DJAA 2QJ0A 1LDKC 2IQJA 1WEPA 4MSXA 3SOXA 4H9DA 2UZGA 3SUBA 3N9MA 2M1RA 3C5KA 1WENA 5B75A 5C11A 2FSAA 4XI1A 2YT5A 2VPEA 2YYRA 4QF2A 1HYIA 2I50A 2YHOA 1IYMA 2LRIC 3SOWA 2LAUA 1WEWA 4YBTA 2L5UA 5JG6A 2YREA 3T6RA 2E61A 4S3OC 4W4UA 3O33A 2VP7A 4WA6A 1WESA 2EGPA 4O64A 2LDRA 5SVIA 2IDAA 2KGIA 4QQ4A 3DQVR 2LXHC 1WILA 2FD4A 5B78A 2YQLA 2RR4A 3LQHA 4YAXA 1CHCA 2L75A 2VPDA 2ECIA 3KV6A 3O37A 4A4CA 2JUNA 5DKAA 2HDPA 4LKAA 2LGLA 3VK6A 2XOCA 2DX8A 3M7KA 3T9KA 2L7PA 4IC2A 3GV4A 4FO9A 2YU4A 4AYCA 3EB6A 1HYJA 1WEUA 3FM8C 5G04B 2F6JA 3RTRB 2JMDA 1WGMA 2RI7A 4WZ2A 3ASLA 1WIMA 2KKXA 2BAYA 3O35A 1E4UA 2MT5A 4OGCA 2VPGA 2H0DB 4PPEA 4YC9A 4L58A 5DINA 2L0BA 2DSMA 2XOYA 4O62A 1VD4A 2EODA 2K4DA 3PURA 4AYCB 1VYXA 4YBSA 3E2DA 3M99A 2E6RA 5B8DA 4X3GA 2CKLB 1WE9A 3ZPV1 3FL2A 4GB0A 2FUIA 3M63A 2VPBA 3M62A 2ECNA 1V87A 3FAOA 2LN0A 4OGEA 1WEMA 2XP0A 2MKEA 2CONA 4I7DA 2QICA 5G0FA 2KFTA 2CSVA 3FANA 3N9OA 4ZDTA 2CRWA 2K1JA 2LGGA 3DDTA 4B7YC 4F1PA 2MIQA 2F6NA 2CKLA 3LQIA 2EGMA 1LDJB 4Z0RA 2D8UA 3ZYQA 5B79A 2MD8C 4TKPB 5TDRA 2OWAA 5AIUA 4R7EA 4YBMA 5C13A 1RMDA 3ZNIA 1JM7A 3FJUB 2H0DA 3HTKC 3LJUX 3ZVYA 2LV9A 5SVIB 3T7LA 2KKYA 3U5OA 3FEHA 2QIZA 2M6MA 5LKXA 3HCUA 1U6GB 4V3KC 2KU3A 2K16A 5KH9A 5FEYA 5TDWA 3H7HA 2OXQC 3V43A 3U5MA 2L43A 4NN2A 3N9PA 2JM3A 1MBMA 3L1XA 2CT2A 3PHDA 1FP0A 3LVRE 4R2YA 4GNGA 2HYED 2G45A 4MVTA 3QZVA 1G25A 2G6QA 5LKUA 2MD7B 2M85A 2NAAA 2MNZA 1DCQA 2MA6A 1FBVA 1XWHA 2KWNA 2G43A 2VJEB 4ZQLA 2YW8A 4GNDA 2PNXA 3LVQE 2VNFA 3MHHA 2K17A 4ZUXU 5SVXA 3LQJA 2JRJA 5B76A 1JOCA 2ECGA 4UP5A 4S3OB 5D1MB 4FJCA 3L11A 4I7BA 5LKZA 2YURA 1WEQA 2Y1MA
chains in the Genus database with same CATH topology
5TRBA 3DPLR 4YATA 3RPGB 5FB1A 2C2VS 4BBQA 1WFKA 4AVXA 1MM3A 2VJEA 3O34A 3O36A 2ECJA 4A0CD 4LJNA 5LCWB 3U5PA 1WEEA 2M3HA 2LGKA 3PUQA 5G05B 4GNFA 4B86C 5B77A 4N4FA 5TABA 5KH3A 2RSDA 2Y1NA 2KIZA 5H1VA 1N87A 3ZPVE 2KR4A 3NG2A 3O7AA 1VFYA 3SHBA 2LGVA 2KWOA 2LQ6A 3GL6A 4FIPA 2KWKA 4AP4A 1K2FA 2L80A 4A4BA 2F42A 5H1TA 4I7CA 2VJFA 5LKTA 4PTBA 3L1ZB 1X4UA 3O70A 4L7XA 3HCTA 1WEVA 2ECVA 3N9QA 2AN6A 3ZTGA 4C9ZA 2YSMA 1BORA 5FB0A 1JM7B 2ECWA 4UI9B 1F62A 3N9NA 5KH7A 3I2DA 4LLBA 2KGGA 5I3LA 2EA6A 3N9LA 2ECTA 5J3XA 2KYUA 3IHPA 2KE1A 4QF3A 2KREA 2PUYA 3KV5A 2XEUA 3C6WA 4N3WA 2MA5A 1MM2A 2ZETC 4BHWA 4IC3A 5H9MA 3SOUA 4R8PK 3LRQA 2JMJA 2E6SA 3EB5A 2D8SA 3ZVZB 4V3LC 4UP0A 4GNEA 5FERA 2MNYA 1WEOA 5EYAF 5D1KB 1ZBDB 3HCSA 5AITA 2MUMA 1Z2QA 4YABA 4Q6FA 4LADB 2KWJA 4P5OB 4WZ0A 2LXPC 5TBNA 1Z6UA 5D1LB 1X4JA 3RPGC 1T1HA 3KNVA 4LK9A 2YHNA 2YQMA 4F52B 2XB1A 4A49A 4AUQB 1Z60A 3U5NA 2C2LA 2VJFB 2CSYA 1DVPA 4FK5A 5H1UA 2CSZA 2YSJA 2YUCA 4YADA 4CA1A 2JMIA 2Y43A 4CCGX 2FUUA 4WZ3B 1X4IA 3KQIA 3MHSA 2QJ0A 1LDKC 1WEPA 4MSXA 3SOXA 2UZGA 3N9MA 2M1RA 3C5KA 1WENA 5B75A 5C11A 2FSAA 4XI1A 2YT5A 2VPEA 2YYRA 4QF2A 1HYIA 2I50A 2YHOA 1IYMA 2LRIC 3SOWA 1WEWA 4YBTA 2L5UA 5JG6A 2YREA 3T6RA 4S3OC 4W4UA 3O33A 2VP7A 4WA6A 1WESA 2EGPA 4O64A 2LDRA 2IDAA 2KGIA 3DQVR 2LXHC 1WILA 5B78A 2YQLA 3LQHA 4YAXA 1CHCA 2L75A 2VPDA 2ECIA 3KV6A 3O37A 4A4CA 5DKAA 2HDPA 4LKAA 2LGLA 3VK6A 2DX8A 4IC2A 3GV4A 4FO9A 2YU4A 4AYCA 3EB6A 1HYJA 1WEUA 5G04B 2F6JA 3RTRB 2JMDA 1WGMA 2RI7A 3ASLA 4WZ2A 1WIMA 2BAYA 3O35A 1E4UA 2MT5A 2VPGA 2H0DB 4PPEA 4YC9A 4L58A 5DINA 2L0BA 1VD4A 2EODA 2K4DA 3PURA 4AYCB 1VYXA 4YBSA 3M99A 2E6RA 5B8DA 4X3GA 2CKLB 1WE9A 3ZPV1 3FL2A 4GB0A 2FUIA 3M63A 2VPBA 3M62A 2ECNA 1V87A 2LN0A 1WEMA 4I7DA 2QICA 5G0FA 2KFTA 3N9OA 4ZDTA 2K1JA 2LGGA 4B7YC 2MIQA 2F6NA 2CKLA 3LQIA 1LDJB 3ZYQA 5B79A 2MD8C 4TKPB 5TDRA 5AIUA 4R7EA 4YBMA 5C13A 1RMDA 3ZNIA 1JM7A 2H0DA 3HTKC 3ZVYA 2LV9A 3T7LA 3U5OA 2QIZA 2M6MA 5LKXA 3HCUA 1U6GB 4V3KC 2KU3A 2K16A 5KH9A 5FEYA 5TDWA 2OXQC 3V43A 3U5MA 2L43A 4NN2A 3N9PA 3L1XA 2CT2A 3PHDA 1FP0A 4R2YA 4GNGA 2HYED 2G45A 4MVTA 3QZVA 1G25A 2G6QA 5LKUA 2MD7B 2M85A 2NAAA 2MNZA 2MA6A 1FBVA 1XWHA 2KWNA 2G43A 2VJEB 4ZQLA 2YW8A 4GNDA 2PNXA 2VNFA 3MHHA 2K17A 4ZUXU 3LQJA 2JRJA 5B76A 1JOCA 2ECGA 4UP5A 4S3OB 5D1MB 3L11A 4FJCA 4I7BA 5LKZA 2YURA 1WEQA 2Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TRB A;  3DPL R;  4YAT A;  3RPG B;  5FB1 A;  2C2V S;  4BBQ A;  1WFK A;  4AVX A;  1MM3 A;  2VJE A;  3O34 A;  3O36 A;  2ECJ A;  4A0C D;  4LJN A;  5LCW B;  3U5P A;  1WEE A;  2M3H A;  2LGK A;  3PUQ A;  5G05 B;  4GNF A;  4B86 C;  5B77 A;  4N4F A;  5TAB A;  5KH3 A;  2RSD A;  2Y1N A;  2KIZ A;  5H1V A;  1N87 A;  3ZPV E;  2KR4 A;  3NG2 A;  3O7A A;  1VFY A;  3SHB A;  2LGV A;  2KWO A;  2LQ6 A;  3GL6 A;  4FIP A;  2KWK A;  4AP4 A;  1K2F A;  2L80 A;  4A4B A;  2F42 A;  5H1T A;  4I7C A;  2VJF A;  5LKT A;  4PTB A;  3L1Z B;  1X4U A;  3O70 A;  4L7X A;  3HCT A;  1WEV A;  2ECV A;  3N9Q A;  2AN6 A;  3ZTG A;  4C9Z A;  2YSM A;  1BOR A;  5FB0 A;  1JM7 B;  2ECW A;  4UI9 B;  1F62 A;  3N9N A;  5KH7 A;  3I2D A;  4LLB A;  2KGG A;  5I3L A;  2EA6 A;  3N9L A;  2ECT A;  5J3X A;  2KYU A;  3IHP A;  2KE1 A;  4QF3 A;  2KRE A;  2PUY A;  3KV5 A;  2XEU A;  3C6W A;  4N3W A;  2MA5 A;  1MM2 A;  2ZET C;  4BHW A;  4IC3 A;  5H9M A;  3SOU A;  4R8P K;  3LRQ A;  2JMJ A;  2E6S A;  3EB5 A;  2D8S A;  3ZVZ B;  4V3L C;  4UP0 A;  4GNE A;  5FER A;  2MNY A;  1WEO A;  5EYA F;  5D1K B;  1ZBD B;  3HCS A;  5AIT A;  2MUM A;  1Z2Q A;  4YAB A;  4Q6F A;  4LAD B;  2KWJ A;  4P5O B;  4WZ0 A;  2LXP C;  5TBN A;  1Z6U A;  5D1L B;  1X4J A;  3RPG C;  1T1H A;  3KNV A;  4LK9 A;  2YHN A;  2YQM A;  4F52 B;  2XB1 A;  4A49 A;  4AUQ B;  1Z60 A;  3U5N A;  2C2L A;  2VJF B;  2CSY A;  1DVP A;  4FK5 A;  5H1U A;  2CSZ A;  2YSJ A;  2YUC A;  4YAD A;  4CA1 A;  2JMI A;  2Y43 A;  4CCG X;  2FUU A;  4WZ3 B;  1X4I A;  3KQI A;  3MHS A;  2QJ0 A;  1LDK C;  1WEP A;  4MSX A;  3SOX A;  2UZG A;  3N9M A;  2M1R A;  3C5K A;  1WEN A;  5B75 A;  5C11 A;  2FSA A;  4XI1 A;  2YT5 A;  2VPE A;  2YYR A;  4QF2 A;  1HYI A;  2I50 A;  2YHO A;  1IYM A;  2LRI C;  3SOW A;  1WEW A;  4YBT A;  2L5U A;  5JG6 A;  2YRE A;  3T6R A;  4S3O C;  4W4U A;  3O33 A;  2VP7 A;  4WA6 A;  1WES A;  2EGP A;  4O64 A;  2LDR A;  2IDA A;  2KGI A;  3DQV R;  2LXH C;  1WIL A;  5B78 A;  2YQL A;  3LQH A;  4YAX A;  1CHC A;  2L75 A;  2VPD A;  2ECI A;  3KV6 A;  3O37 A;  4A4C A;  5DKA A;  2HDP A;  4LKA A;  2LGL A;  3VK6 A;  2DX8 A;  4IC2 A;  3GV4 A;  4FO9 A;  2YU4 A;  4AYC A;  3EB6 A;  1HYJ A;  1WEU A;  5G04 B;  2F6J A;  3RTR B;  2JMD A;  1WGM A;  2RI7 A;  3ASL A;  4WZ2 A;  1WIM A;  2BAY A;  3O35 A;  1E4U A;  2MT5 A;  2VPG A;  2H0D B;  4PPE A;  4YC9 A;  4L58 A;  5DIN A;  2L0B A;  1VD4 A;  2EOD A;  2K4D A;  3PUR A;  4AYC B;  1VYX A;  4YBS A;  3M99 A;  2E6R A;  5B8D A;  4X3G A;  2CKL B;  1WE9 A;  3ZPV 1;  3FL2 A;  4GB0 A;  2FUI A;  3M63 A;  2VPB A;  3M62 A;  2ECN A;  1V87 A;  2LN0 A;  1WEM A;  4I7D A;  2QIC A;  5G0F A;  2KFT A;  3N9O A;  4ZDT A;  2K1J A;  2LGG A;  4B7Y C;  2MIQ A;  2F6N A;  2CKL A;  3LQI A;  1LDJ B;  3ZYQ A;  5B79 A;  2MD8 C;  4TKP B;  5TDR A;  5AIU A;  4R7E A;  4YBM A;  5C13 A;  1RMD A;  3ZNI A;  1JM7 A;  2H0D A;  3HTK C;  3ZVY A;  2LV9 A;  3T7L A;  3U5O A;  2QIZ A;  2M6M A;  5LKX A;  3HCU A;  1U6G B;  4V3K C;  2KU3 A;  2K16 A;  5KH9 A;  5FEY A;  5TDW A;  2OXQ C;  3V43 A;  3U5M A;  2L43 A;  4NN2 A;  3N9P A;  3L1X A;  2CT2 A;  3PHD A;  1FP0 A;  4R2Y A;  4GNG A;  2HYE D;  2G45 A;  4MVT A;  3QZV A;  1G25 A;  2G6Q A;  5LKU A;  2MD7 B;  2M85 A;  2NAA A;  2MNZ A;  2MA6 A;  1FBV A;  1XWH A;  2KWN A;  2G43 A;  2VJE B;  4ZQL A;  2YW8 A;  4GND A;  2PNX A;  2VNF A;  3MHH A;  2K17 A;  4ZUX U;  3LQJ A;  2JRJ A;  5B76 A;  1JOC A;  2ECG A;  4UP5 A;  4S3O B;  5D1M B;  3L11 A;  4FJC A;  4I7B A;  5LKZ A;  2YUR A;  1WEQ A;  2Y1M A; 
#chains in the Genus database with same CATH topology
 3KDE C;  5TRB A;  3DPL R;  4YAT A;  3RPG B;  5FB1 A;  2C2V S;  4BBQ A;  1WFK A;  4AVX A;  1MM3 A;  2VJE A;  3O34 A;  3O36 A;  2ECJ A;  4A0C D;  3PLW A;  4LJN A;  5LCW B;  3U5P A;  1WEE A;  2M3H A;  2LGK A;  3PUQ A;  5G05 B;  4GNF A;  5SVY A;  4B86 C;  3O47 A;  5B77 A;  4N4F A;  5TAB A;  5KH3 A;  2RSD A;  2Y1N A;  2KIZ A;  5H1V A;  1N87 A;  3DWD A;  3ZPV E;  2KR4 A;  3NG2 A;  3O7A A;  1VFY A;  3SHB A;  2LGV A;  2KWO A;  2LQ6 A;  3GL6 A;  2P57 A;  2XOZ A;  4FIP A;  2KWK A;  4AP4 A;  3Q1D A;  1K2F A;  2L80 A;  4A4B A;  2F42 A;  5H1T A;  4I7C A;  3MDB C;  2VJF A;  5LKT A;  4Z0O A;  4PTB A;  3L1Z B;  1X4U A;  3O70 A;  4L7X A;  3HCT A;  1WEV A;  2ECV A;  3N9Q A;  2AN6 A;  3ZTG A;  4C9Z A;  2YSM A;  1BOR A;  5FB0 A;  1JM7 B;  2ECW A;  4UI9 B;  1F62 A;  3LDY A;  3N9N A;  5KH7 A;  3I2D A;  4LLB A;  2KGG A;  5I3L A;  2EA6 A;  2YVR A;  3N9L A;  2ECT A;  5J3X A;  2KYU A;  3IHP A;  4QF3 A;  2KE1 A;  2KRE A;  2EXU A;  2PUY A;  2M13 A;  3KV5 A;  2XEU A;  3JUE A;  3C6W A;  4N3W A;  2MA5 A;  2CRR A;  1MM2 A;  2ZET C;  4IC3 A;  4BHW A;  5H9M A;  3SOU A;  4R8P K;  3LRQ A;  2JMJ A;  2E6S A;  3EB5 A;  2D8S A;  5K3Q A;  3ZVZ B;  4V3L C;  4UP0 A;  4GNE A;  5FER A;  2MNY A;  1WEO A;  2B0O E;  5EYA F;  5D1K B;  1ZBD B;  3HCS A;  5AIT A;  2MUM A;  1Z2Q A;  4YAB A;  4Q6F A;  4LAD B;  2KWJ A;  4P5O B;  4WZ0 A;  2LXP C;  5TBN A;  1Z6U A;  5D1L B;  1X4J A;  3RPG C;  1T1H A;  3KNV A;  4LK9 A;  2YHN A;  2YQM A;  4F52 B;  2XB1 A;  4A49 A;  4AUQ B;  1Z60 A;  3U5N A;  2C2L A;  2VJF B;  2CSY A;  1DVP A;  4FK5 A;  5H1U A;  2CSZ A;  2YSJ A;  2YUC A;  4YAD A;  4CA1 A;  2JMI A;  2Y43 A;  2FFW A;  4CCG X;  2FUU A;  4WZ3 B;  1X4I A;  3KQI A;  3MHS A;  2DJA A;  2QJ0 A;  1LDK C;  2IQJ A;  1WEP A;  4MSX A;  3SOX A;  4H9D A;  2UZG A;  3SUB A;  3N9M A;  2M1R A;  3C5K A;  1WEN A;  5B75 A;  5C11 A;  2FSA A;  4XI1 A;  2YT5 A;  2VPE A;  2YYR A;  4QF2 A;  1HYI A;  2I50 A;  2YHO A;  1IYM A;  2LRI C;  3SOW A;  2LAU A;  1WEW A;  4YBT A;  2L5U A;  5JG6 A;  2YRE A;  3T6R A;  2E61 A;  4S3O C;  4W4U A;  3O33 A;  2VP7 A;  4WA6 A;  1WES A;  2EGP A;  4O64 A;  2LDR A;  5SVI A;  2IDA A;  2KGI A;  4QQ4 A;  3DQV R;  2LXH C;  1WIL A;  2FD4 A;  5B78 A;  2YQL A;  2RR4 A;  3LQH A;  4YAX A;  1CHC A;  2L75 A;  2VPD A;  2ECI A;  3KV6 A;  3O37 A;  4A4C A;  2JUN A;  5DKA A;  2HDP A;  4LKA A;  2LGL A;  3VK6 A;  2XOC A;  2DX8 A;  3M7K A;  3T9K A;  2L7P A;  4IC2 A;  3GV4 A;  4FO9 A;  2YU4 A;  4AYC A;  3EB6 A;  1HYJ A;  1WEU A;  3FM8 C;  5G04 B;  2F6J A;  3RTR B;  2JMD A;  1WGM A;  2RI7 A;  4WZ2 A;  3ASL A;  1WIM A;  2KKX A;  2BAY A;  3O35 A;  1E4U A;  2MT5 A;  4OGC A;  2VPG A;  2H0D B;  4PPE A;  4YC9 A;  4L58 A;  5DIN A;  2L0B A;  2DSM A;  2XOY A;  4O62 A;  1VD4 A;  2EOD A;  2K4D A;  3PUR A;  4AYC B;  1VYX A;  4YBS A;  3E2D A;  3M99 A;  2E6R A;  5B8D A;  4X3G A;  2CKL B;  1WE9 A;  3ZPV 1;  3FL2 A;  4GB0 A;  2FUI A;  3M63 A;  2VPB A;  3M62 A;  2ECN A;  1V87 A;  3FAO A;  2LN0 A;  4OGE A;  1WEM A;  2XP0 A;  2MKE A;  2CON A;  4I7D A;  2QIC A;  5G0F A;  2KFT A;  2CSV A;  3FAN A;  3N9O A;  4ZDT A;  2CRW A;  2K1J A;  2LGG A;  3DDT A;  4B7Y C;  4F1P A;  2MIQ A;  2F6N A;  2CKL A;  3LQI A;  2EGM A;  1LDJ B;  4Z0R A;  2D8U A;  3ZYQ A;  5B79 A;  2MD8 C;  4TKP B;  5TDR A;  2OWA A;  5AIU A;  4R7E A;  4YBM A;  5C13 A;  1RMD A;  3ZNI A;  1JM7 A;  3FJU B;  2H0D A;  3HTK C;  3LJU X;  3ZVY A;  2LV9 A;  5SVI B;  3T7L A;  2KKY A;  3U5O A;  3FEH A;  2QIZ A;  2M6M A;  5LKX A;  3HCU A;  1U6G B;  4V3K C;  2KU3 A;  2K16 A;  5KH9 A;  5FEY A;  5TDW A;  3H7H A;  2OXQ C;  3V43 A;  3U5M A;  2L43 A;  4NN2 A;  3N9P A;  2JM3 A;  1MBM A;  3L1X A;  2CT2 A;  3PHD A;  1FP0 A;  3LVR E;  4R2Y A;  4GNG A;  2HYE D;  2G45 A;  4MVT A;  3QZV A;  1G25 A;  2G6Q A;  5LKU A;  2MD7 B;  2M85 A;  2NAA A;  2MNZ A;  1DCQ A;  2MA6 A;  1FBV A;  1XWH A;  2KWN A;  2G43 A;  2VJE B;  4ZQL A;  2YW8 A;  4GND A;  2PNX A;  3LVQ E;  2VNF A;  3MHH A;  2K17 A;  4ZUX U;  5SVX A;  3LQJ A;  2JRJ A;  5B76 A;  1JOC A;  2ECG A;  4UP5 A;  4S3O B;  5D1M B;  4FJC A;  3L11 A;  4I7B A;  5LKZ A;  2YUR A;  1WEQ A;  2Y1M A; 
#chains in the Genus database with same CATH homology
 5TRB A;  3DPL R;  4YAT A;  3RPG B;  5FB1 A;  2C2V S;  4BBQ A;  1WFK A;  4AVX A;  1MM3 A;  2VJE A;  3O34 A;  3O36 A;  2ECJ A;  4A0C D;  4LJN A;  5LCW B;  3U5P A;  1WEE A;  2M3H A;  2LGK A;  3PUQ A;  5G05 B;  4GNF A;  4B86 C;  5B77 A;  4N4F A;  5TAB A;  5KH3 A;  2RSD A;  2Y1N A;  2KIZ A;  5H1V A;  1N87 A;  3ZPV E;  2KR4 A;  3NG2 A;  3O7A A;  1VFY A;  3SHB A;  2LGV A;  2KWO A;  2LQ6 A;  3GL6 A;  4FIP A;  2KWK A;  4AP4 A;  1K2F A;  2L80 A;  4A4B A;  2F42 A;  5H1T A;  4I7C A;  2VJF A;  5LKT A;  4PTB A;  3L1Z B;  1X4U A;  3O70 A;  4L7X A;  3HCT A;  1WEV A;  2ECV A;  3N9Q A;  2AN6 A;  3ZTG A;  4C9Z A;  2YSM A;  1BOR A;  5FB0 A;  1JM7 B;  2ECW A;  4UI9 B;  1F62 A;  3N9N A;  5KH7 A;  3I2D A;  4LLB A;  2KGG A;  5I3L A;  2EA6 A;  3N9L A;  2ECT A;  5J3X A;  2KYU A;  3IHP A;  2KE1 A;  4QF3 A;  2KRE A;  2PUY A;  3KV5 A;  2XEU A;  3C6W A;  4N3W A;  2MA5 A;  1MM2 A;  2ZET C;  4BHW A;  4IC3 A;  5H9M A;  3SOU A;  4R8P K;  3LRQ A;  2JMJ A;  2E6S A;  3EB5 A;  2D8S A;  3ZVZ B;  4V3L C;  4UP0 A;  4GNE A;  5FER A;  2MNY A;  1WEO A;  5EYA F;  5D1K B;  1ZBD B;  3HCS A;  5AIT A;  2MUM A;  1Z2Q A;  4YAB A;  4Q6F A;  4LAD B;  2KWJ A;  4P5O B;  4WZ0 A;  2LXP C;  5TBN A;  1Z6U A;  5D1L B;  1X4J A;  3RPG C;  1T1H A;  3KNV A;  4LK9 A;  2YHN A;  2YQM A;  4F52 B;  2XB1 A;  4A49 A;  4AUQ B;  1Z60 A;  3U5N A;  2C2L A;  2VJF B;  2CSY A;  1DVP A;  4FK5 A;  5H1U A;  2CSZ A;  2YSJ A;  2YUC A;  4YAD A;  4CA1 A;  2JMI A;  2Y43 A;  4CCG X;  2FUU A;  4WZ3 B;  1X4I A;  3KQI A;  3MHS A;  2QJ0 A;  1LDK C;  1WEP A;  4MSX A;  3SOX A;  2UZG A;  3N9M A;  2M1R A;  3C5K A;  1WEN A;  5B75 A;  5C11 A;  2FSA A;  4XI1 A;  2YT5 A;  2VPE A;  2YYR A;  4QF2 A;  1HYI A;  2I50 A;  2YHO A;  1IYM A;  2LRI C;  3SOW A;  1WEW A;  4YBT A;  2L5U A;  5JG6 A;  2YRE A;  3T6R A;  4S3O C;  4W4U A;  3O33 A;  2VP7 A;  4WA6 A;  1WES A;  2EGP A;  4O64 A;  2LDR A;  2IDA A;  2KGI A;  3DQV R;  2LXH C;  1WIL A;  5B78 A;  2YQL A;  3LQH A;  4YAX A;  1CHC A;  2L75 A;  2VPD A;  2ECI A;  3KV6 A;  3O37 A;  4A4C A;  5DKA A;  2HDP A;  4LKA A;  2LGL A;  3VK6 A;  2DX8 A;  4IC2 A;  3GV4 A;  4FO9 A;  2YU4 A;  4AYC A;  3EB6 A;  1HYJ A;  1WEU A;  5G04 B;  2F6J A;  3RTR B;  2JMD A;  1WGM A;  2RI7 A;  3ASL A;  4WZ2 A;  1WIM A;  2BAY A;  3O35 A;  1E4U A;  2MT5 A;  2VPG A;  2H0D B;  4PPE A;  4YC9 A;  4L58 A;  5DIN A;  2L0B A;  1VD4 A;  2EOD A;  2K4D A;  3PUR A;  4AYC B;  1VYX A;  4YBS A;  3M99 A;  2E6R A;  5B8D A;  4X3G A;  2CKL B;  1WE9 A;  3ZPV 1;  3FL2 A;  4GB0 A;  2FUI A;  3M63 A;  2VPB A;  3M62 A;  2ECN A;  1V87 A;  2LN0 A;  1WEM A;  4I7D A;  2QIC A;  5G0F A;  2KFT A;  3N9O A;  4ZDT A;  2K1J A;  2LGG A;  4B7Y C;  2MIQ A;  2F6N A;  2CKL A;  3LQI A;  1LDJ B;  3ZYQ A;  5B79 A;  2MD8 C;  4TKP B;  5TDR A;  5AIU A;  4R7E A;  4YBM A;  5C13 A;  1RMD A;  3ZNI A;  1JM7 A;  2H0D A;  3HTK C;  3ZVY A;  2LV9 A;  3T7L A;  3U5O A;  2QIZ A;  2M6M A;  5LKX A;  3HCU A;  1U6G B;  4V3K C;  2KU3 A;  2K16 A;  5KH9 A;  5FEY A;  5TDW A;  2OXQ C;  3V43 A;  3U5M A;  2L43 A;  4NN2 A;  3N9P A;  3L1X A;  2CT2 A;  3PHD A;  1FP0 A;  4R2Y A;  4GNG A;  2HYE D;  2G45 A;  4MVT A;  3QZV A;  1G25 A;  2G6Q A;  5LKU A;  2MD7 B;  2M85 A;  2NAA A;  2MNZ A;  2MA6 A;  1FBV A;  1XWH A;  2KWN A;  2G43 A;  2VJE B;  4ZQL A;  2YW8 A;  4GND A;  2PNX A;  2VNF A;  3MHH A;  2K17 A;  4ZUX U;  3LQJ A;  2JRJ A;  5B76 A;  1JOC A;  2ECG A;  4UP5 A;  4S3O B;  5D1M B;  3L11 A;  4FJC A;  4I7B A;  5LKZ A;  2YUR A;  1WEQ A;  2Y1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...