3O70A

Phd-type zinc finger of human phd finger protein 13
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
LYFQGLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords PHD finger protein 13
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o70A00
2G6QA 3L1XA 4MVTA 2UZGA 2KGIA 3RPGC 2M6MA 2YT5A 3MHHA 2H0DB 1X4IA 4V3KC 4A4CA 2DX8A 4XI1A 2MD8C 1CHCA 4YADA 4A0CD 2RSDA 3FL2A 2C2LA 3SOXA 5TDWA 1WEMA 3C5KA 1WFKA 4FIPA 2ZETC 5J3XA 1K2FA 2JRJA 2LRIC 2LQ6A 4ZQLA 4R8PK 2BAYA 3GL6A 4YATA 2KWJA 4GNFA 4V3LC 2QIZA 3DPLR 3PUQA 2HYED 4CCGX 3V43A 2YHNA 5KH9A 4C9ZA 4N4FA 1WEEA 2M3HA 3PURA 2QJ0A 2EODA 1G25A 3RTRB 5H1VA 1WESA 3ZTGA 2OXQC 4LK9A 4WZ3B 4PTBA 3ZNIA 2KIZA 1MM2A 2L43A 3LRQA 2KR4A 2VJEA 5H1TA 4AYCB 2QICA 3M62A 4AP4A 2JMIA 5FERA 2LV9A 4GNEA 3N9OA 2K1JA 3MHSA 2MA6A 1FP0A 1FBVA 3EB5A 2L80A 2ECJA 5B78A 3ZPV1 2C2VS 2F6NA 4LADB 3U5OA 1ZBDB 2KU3A 3M99A 2ECWA 4WZ0A 5TABA 5C13A 2CT2A 2VPDA 5G04B 5C11A 1WILA 1T1HA 5LKXA 2LN0A 1JM7A 3SOUA 3U5MA 2JMDA 2F6JA 1WENA 2K17A 3L11A 5FB0A 1VYXA 4L58A 2MIQA 3ZVZB 2G43A 2LXPC 4WA6A 3LQIA 1HYIA 3SHBA 1DVPA 4I7BA 2MT5A 4YABA 3GV4A 4UI9B 4MSXA 1Z6UA 2MNYA 3C6WA 3N9MA 3O36A 1MM3A 5H9MA 5KH3A 1WEQA 2E6SA 2FUUA 2KGGA 3ZYQA 4AVXA 3N9NA 2ECIA 1LDKC 5DINA 3KNVA 1X4JA 3N9QA 4A4BA 4B7YC 2XB1A 1WEWA 3PHDA 1V87A 4LJNA 4CA1A 4UP5A 2K4DA 4AYCA 2K16A 2VJFA 2KWOA 2YSJA 2ECVA 1RMDA 3SOWA 1JOCA 4QF3A 5LKZA 3N9PA 4YBMA 2LDRA 2M1RA 2VP7A 4UP0A 2IDAA 2YUCA 2YQMA 5EYAF 2MUMA 2YU4A 2KYUA 4FJCA 1WGMA 4BBQA 4WZ2A 2LXHC 3LQHA 2L0BA 5B79A 2VJEB 1Z60A 4W4UA 1WEUA 4S3OC 1IYMA 1WEVA 4FO9A 2YQLA 4AUQB 4TKPB 2VPBA 5FEYA 5TBNA 2D8SA 2Y1MA 2YSMA 5B8DA 5TDRA 1LDJB 3LQJA 3HCUA 2KFTA 2KWNA 4PPEA 1WE9A 3QZVA 4F52B 4BHWA 2YURA 2CSYA 2KWKA 2I50A 3NG2A 5JG6A 1WIMA 1HYJA 3KV5A 4L7XA 4YC9A 5LKTA 4I7DA 4R2YA 1JM7B 2VPGA 1WEOA 1U6GB 5H1UA 3O7AA 4FK5A 2Y43A 4NN2A 3KQIA 1WEPA 5D1LB 5LCWB 3KV6A 3I2DA 3HCTA 2YYRA 2YHOA 2G45A 4R7EA 1N87A 4IC3A 2L75A 2LGGA 5AITA 2PUYA 1VD4A 1VFYA 3ZVYA 5I3LA 1F62A 3O33A 3T6RA 4X3GA 2CKLB 4YBTA 4Q6FA 4GNDA 3U5NA 2JMJA 4O64A 3ASLA 4QF2A 5G05B 2NAAA 5FB1A 2CSZA 4I7CA 3U5PA 2MNZA 1BORA 1Z2QA 2XEUA 2VPEA 1XWHA 4B86C 2EA6A 2YW8A 5D1KB 4IC2A 5DKAA 4ZDTA 2M85A 4GNGA 1X4UA 5TRBA 3O34A 2RI7A 4LKAA 2VNFA 4YAXA 2H0DA 3O37A 3ZPVE 2Y1NA 2FUIA 3RPGB 2KE1A 4N3WA 5B76A 3HTKC 4ZUXU 2EGPA 2LGKA 5B77A 5G0FA 4A49A 4YBSA 2ECTA 4GB0A 2ECGA 2F42A 3O35A 5LKUA 2E6RA 2MA5A 2ECNA 5D1MB 2FSAA 3DQVR 3IHPA 2LGLA 2CKLA 5B75A 2MD7B 3L1ZB 2PNXA 4P5OB 2HDPA 3EB6A 2VJFB 3M63A 3HCSA 5KH7A 2L5UA 3VK6A 2AN6A 1E4UA 3T7LA 3O70A 2LGVA 3N9LA 4S3OB 4LLBA 5AIUA 2KREA 2YREA
chains in the Genus database with same CATH superfamily
2G6QA 3L1XA 4MVTA 2UZGA 2KGIA 3RPGC 2M6MA 4Z0RA 2YT5A 3MHHA 1MBMA 2H0DB 1X4IA 4V3KC 4A4CA 2FD4A 2DX8A 4XI1A 2MD8C 2OWAA 1CHCA 4YADA 4A0CD 2RSDA 3FL2A 2C2LA 3SOXA 3Q1DA 5TDWA 1WEMA 3C5KA 1WFKA 4FIPA 2ZETC 5J3XA 1K2FA 2JRJA 2LRIC 2LQ6A 4ZQLA 4R8PK 2BAYA 3GL6A 4YATA 2KWJA 4GNFA 4V3LC 2QIZA 2XOYA 3DPLR 3PUQA 2HYED 4CCGX 3V43A 2YHNA 5KH9A 4C9ZA 4N4FA 1WEEA 2M3HA 3PURA 2QJ0A 2P57A 2EODA 1G25A 3RTRB 5H1VA 1WESA 3ZTGA 2OXQC 5SVIB 4LK9A 2MKEA 4WZ3B 3LJUX 3DWDA 1DCQA 4PTBA 3ZNIA 2KIZA 1MM2A 2L43A 3LRQA 2KR4A 2VJEA 5H1TA 4AYCB 2QICA 4QQ4A 3M62A 4AP4A 2JMIA 5FERA 2FFWA 2LV9A 4GNEA 3N9OA 2K1JA 3MHSA 2MA6A 1FBVA 1FP0A 2DJAA 3EB5A 2JM3A 2L80A 2ECJA 5B78A 3ZPV1 2C2VS 2F6NA 4LADB 3U5OA 1ZBDB 2KU3A 5SVIA 3M99A 2ECWA 4WZ0A 5TABA 5C13A 2CT2A 3KDEC 2VPDA 2M13A 5G04B 5C11A 1WILA 1T1HA 5LKXA 2LN0A 2E61A 1JM7A 3SOUA 3U5MA 2JMDA 2B0OE 2F6JA 2CRRA 1WENA 2K17A 3L11A 5FB0A 1VYXA 4L58A 2MIQA 3ZVZB 5SVXA 2G43A 2LXPC 4WA6A 3LQIA 3M7KA 1HYIA 3SHBA 1DVPA 4I7BA 2MT5A 4YABA 2XOCA 3LVRE 3GV4A 2RR4A 3E2DA 4UI9B 4MSXA 1Z6UA 2MNYA 3C6WA 3N9MA 3O36A 1MM3A 2L7PA 5H9MA 5KH3A 1WEQA 2E6SA 3JUEA 2FUUA 2KGGA 2IQJA 4F1PA 3ZYQA 4AVXA 3N9NA 2ECIA 5DINA 1LDKC 3KNVA 1X4JA 3N9QA 4A4BA 4B7YC 2XB1A 1WEWA 3PHDA 1V87A 3FM8C 4LJNA 2KKXA 4CA1A 4UP5A 2K4DA 4AYCA 2K16A 2VJFA 2KWOA 2YSJA 2ECVA 1RMDA 3SOWA 1JOCA 4QF3A 5LKZA 3N9PA 4YBMA 2LDRA 2M1RA 2VP7A 4UP0A 2IDAA 2YUCA 2YQMA 3LDYA 5EYAF 2MUMA 2YU4A 2KYUA 4FJCA 1WGMA 4BBQA 4WZ2A 2LXHC 3LQHA 2L0BA 5B79A 2VJEB 1Z60A 4W4UA 1WEUA 4S3OC 1IYMA 1WEVA 2CONA 4FO9A 2YQLA 4AUQB 4TKPB 2VPBA 5FEYA 3MDBC 5TBNA 2DSMA 2EGMA 2D8SA 2Y1MA 2YSMA 5B8DA 5TDRA 1LDJB 3LQJA 3HCUA 2KFTA 2JUNA 2KWNA 4PPEA 1WE9A 3QZVA 4F52B 4BHWA 3FANA 2YURA 2CSYA 2KWKA 2I50A 3NG2A 3T9KA 5JG6A 1WIMA 1HYJA 3KV5A 4L7XA 4YC9A 5LKTA 4I7DA 4R2YA 1JM7B 2VPGA 1WEOA 1U6GB 5H1UA 3O7AA 4FK5A 2Y43A 4NN2A 3KQIA 1WEPA 5D1LB 5LCWB 3KV6A 3I2DA 3HCTA 2YYRA 2YHOA 2G45A 4R7EA 2LAUA 1N87A 2YVRA 4IC3A 2EXUA 2L75A 2LGGA 5AITA 2PUYA 2D8UA 1VD4A 1VFYA 3ZVYA 5I3LA 1F62A 3O33A 3T6RA 4X3GA 3LVQE 2CKLB 4YBTA 4Q6FA 4GNDA 3U5NA 2JMJA 2KKYA 4O64A 3ASLA 4QF2A 5G05B 2NAAA 5SVYA 4Z0OA 5FB1A 3FEHA 2CSZA 4I7CA 3U5PA 2MNZA 1BORA 1Z2QA 2XEUA 2VPEA 1XWHA 4B86C 3PLWA 4OGEA 3H7HA 2EA6A 2YW8A 5D1KB 4IC2A 5DKAA 4ZDTA 2CRWA 2M85A 4GNGA 1X4UA 5TRBA 3O34A 2RI7A 4LKAA 4OGCA 3DDTA 3SUBA 2VNFA 4YAXA 2H0DA 3O37A 3ZPVE 2Y1NA 2FUIA 3RPGB 2KE1A 4N3WA 3FAOA 5B76A 3HTKC 4ZUXU 2EGPA 2XP0A 2LGKA 5B77A 5G0FA 4A49A 4YBSA 2ECTA 4GB0A 2ECGA 2F42A 2XOZA 3O35A 5LKUA 2E6RA 2MA5A 2ECNA 5D1MB 2FSAA 3DQVR 3IHPA 4H9DA 2LGLA 2CKLA 5B75A 2MD7B 3L1ZB 5K3QA 3O47A 2PNXA 4P5OB 2HDPA 3EB6A 2VJFB 3M63A 3HCSA 5KH7A 2L5UA 3VK6A 2AN6A 1E4UA 3T7LA 3O70A 3FJUB 2LGVA 4O62A 3N9LA 4S3OB 2CSVA 4LLBA 5AIUA 2KREA 2YREA
chains in the Genus database with same CATH topology
2G6QA 3L1XA 4MVTA 2UZGA 2KGIA 3RPGC 2M6MA 2YT5A 3MHHA 2H0DB 1X4IA 4V3KC 4A4CA 2DX8A 4XI1A 2MD8C 1CHCA 4YADA 4A0CD 2RSDA 3FL2A 2C2LA 3SOXA 5TDWA 1WEMA 3C5KA 1WFKA 4FIPA 2ZETC 5J3XA 1K2FA 2JRJA 2LRIC 2LQ6A 4ZQLA 4R8PK 2BAYA 3GL6A 4YATA 2KWJA 4GNFA 4V3LC 2QIZA 3DPLR 3PUQA 2HYED 4CCGX 3V43A 2YHNA 5KH9A 4C9ZA 4N4FA 1WEEA 2M3HA 3PURA 2QJ0A 2EODA 1G25A 3RTRB 5H1VA 1WESA 3ZTGA 2OXQC 4LK9A 4WZ3B 4PTBA 3ZNIA 2KIZA 1MM2A 2L43A 3LRQA 2KR4A 2VJEA 5H1TA 4AYCB 2QICA 3M62A 4AP4A 2JMIA 5FERA 2LV9A 4GNEA 3N9OA 2K1JA 3MHSA 2MA6A 1FP0A 1FBVA 3EB5A 2L80A 2ECJA 5B78A 3ZPV1 2C2VS 2F6NA 4LADB 3U5OA 1ZBDB 2KU3A 3M99A 2ECWA 4WZ0A 5TABA 5C13A 2CT2A 2VPDA 5G04B 5C11A 1WILA 1T1HA 5LKXA 2LN0A 1JM7A 3SOUA 3U5MA 2JMDA 2F6JA 1WENA 2K17A 3L11A 5FB0A 1VYXA 4L58A 2MIQA 3ZVZB 2G43A 2LXPC 4WA6A 3LQIA 1HYIA 3SHBA 1DVPA 4I7BA 2MT5A 4YABA 3GV4A 4UI9B 4MSXA 1Z6UA 2MNYA 3C6WA 3N9MA 3O36A 1MM3A 5H9MA 5KH3A 1WEQA 2E6SA 2FUUA 2KGGA 3ZYQA 4AVXA 3N9NA 2ECIA 1LDKC 5DINA 3KNVA 1X4JA 3N9QA 4A4BA 4B7YC 2XB1A 1WEWA 3PHDA 1V87A 4LJNA 4CA1A 4UP5A 2K4DA 4AYCA 2K16A 2VJFA 2KWOA 2YSJA 2ECVA 1RMDA 3SOWA 1JOCA 4QF3A 5LKZA 3N9PA 4YBMA 2LDRA 2M1RA 2VP7A 4UP0A 2IDAA 2YUCA 2YQMA 5EYAF 2MUMA 2YU4A 2KYUA 4FJCA 1WGMA 4BBQA 4WZ2A 2LXHC 3LQHA 2L0BA 5B79A 2VJEB 1Z60A 4W4UA 1WEUA 4S3OC 1IYMA 1WEVA 4FO9A 2YQLA 4AUQB 4TKPB 2VPBA 5FEYA 5TBNA 2D8SA 2Y1MA 2YSMA 5B8DA 5TDRA 1LDJB 3LQJA 3HCUA 2KFTA 2KWNA 4PPEA 1WE9A 3QZVA 4F52B 4BHWA 2YURA 2CSYA 2KWKA 2I50A 3NG2A 5JG6A 1WIMA 1HYJA 3KV5A 4L7XA 4YC9A 5LKTA 4I7DA 4R2YA 1JM7B 2VPGA 1WEOA 1U6GB 5H1UA 3O7AA 4FK5A 2Y43A 4NN2A 3KQIA 1WEPA 5D1LB 5LCWB 3KV6A 3I2DA 3HCTA 2YYRA 2YHOA 2G45A 4R7EA 1N87A 4IC3A 2L75A 2LGGA 5AITA 2PUYA 1VD4A 1VFYA 3ZVYA 5I3LA 1F62A 3O33A 3T6RA 4X3GA 2CKLB 4YBTA 4Q6FA 4GNDA 3U5NA 2JMJA 4O64A 3ASLA 4QF2A 5G05B 2NAAA 5FB1A 2CSZA 4I7CA 3U5PA 2MNZA 1BORA 1Z2QA 2XEUA 2VPEA 1XWHA 4B86C 2EA6A 2YW8A 5D1KB 4IC2A 5DKAA 4ZDTA 2M85A 4GNGA 1X4UA 5TRBA 3O34A 2RI7A 4LKAA 2VNFA 4YAXA 2H0DA 3O37A 3ZPVE 2Y1NA 2FUIA 3RPGB 2KE1A 4N3WA 5B76A 3HTKC 4ZUXU 2EGPA 2LGKA 5B77A 5G0FA 4A49A 4YBSA 2ECTA 4GB0A 2ECGA 2F42A 3O35A 5LKUA 2E6RA 2MA5A 2ECNA 5D1MB 2FSAA 3DQVR 3IHPA 2LGLA 2CKLA 5B75A 2MD7B 3L1ZB 2PNXA 4P5OB 2HDPA 3EB6A 2VJFB 3M63A 3HCSA 5KH7A 2L5UA 3VK6A 2AN6A 1E4UA 3T7LA 3O70A 2LGVA 3N9LA 4S3OB 4LLBA 5AIUA 2KREA 2YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6Q A;  3L1X A;  4MVT A;  2UZG A;  2KGI A;  3RPG C;  2M6M A;  2YT5 A;  3MHH A;  2H0D B;  1X4I A;  4V3K C;  4A4C A;  2DX8 A;  4XI1 A;  2MD8 C;  1CHC A;  4YAD A;  4A0C D;  2RSD A;  3FL2 A;  2C2L A;  3SOX A;  5TDW A;  1WEM A;  3C5K A;  1WFK A;  4FIP A;  2ZET C;  5J3X A;  1K2F A;  2JRJ A;  2LRI C;  2LQ6 A;  4ZQL A;  4R8P K;  2BAY A;  3GL6 A;  4YAT A;  2KWJ A;  4GNF A;  4V3L C;  2QIZ A;  3DPL R;  3PUQ A;  2HYE D;  4CCG X;  3V43 A;  2YHN A;  5KH9 A;  4C9Z A;  4N4F A;  1WEE A;  2M3H A;  3PUR A;  2QJ0 A;  2EOD A;  1G25 A;  3RTR B;  5H1V A;  1WES A;  3ZTG A;  2OXQ C;  4LK9 A;  4WZ3 B;  4PTB A;  3ZNI A;  2KIZ A;  1MM2 A;  2L43 A;  3LRQ A;  2KR4 A;  2VJE A;  5H1T A;  4AYC B;  2QIC A;  3M62 A;  4AP4 A;  2JMI A;  5FER A;  2LV9 A;  4GNE A;  3N9O A;  2K1J A;  3MHS A;  2MA6 A;  1FP0 A;  1FBV A;  3EB5 A;  2L80 A;  2ECJ A;  5B78 A;  3ZPV 1;  2C2V S;  2F6N A;  4LAD B;  3U5O A;  1ZBD B;  2KU3 A;  3M99 A;  2ECW A;  4WZ0 A;  5TAB A;  5C13 A;  2CT2 A;  2VPD A;  5G04 B;  5C11 A;  1WIL A;  1T1H A;  5LKX A;  2LN0 A;  1JM7 A;  3SOU A;  3U5M A;  2JMD A;  2F6J A;  1WEN A;  2K17 A;  3L11 A;  5FB0 A;  1VYX A;  4L58 A;  2MIQ A;  3ZVZ B;  2G43 A;  2LXP C;  4WA6 A;  3LQI A;  1HYI A;  3SHB A;  1DVP A;  4I7B A;  2MT5 A;  4YAB A;  3GV4 A;  4UI9 B;  4MSX A;  1Z6U A;  2MNY A;  3C6W A;  3N9M A;  3O36 A;  1MM3 A;  5H9M A;  5KH3 A;  1WEQ A;  2E6S A;  2FUU A;  2KGG A;  3ZYQ A;  4AVX A;  3N9N A;  2ECI A;  1LDK C;  5DIN A;  3KNV A;  1X4J A;  3N9Q A;  4A4B A;  4B7Y C;  2XB1 A;  1WEW A;  3PHD A;  1V87 A;  4LJN A;  4CA1 A;  4UP5 A;  2K4D A;  4AYC A;  2K16 A;  2VJF A;  2KWO A;  2YSJ A;  2ECV A;  1RMD A;  3SOW A;  1JOC A;  4QF3 A;  5LKZ A;  3N9P A;  4YBM A;  2LDR A;  2M1R A;  2VP7 A;  4UP0 A;  2IDA A;  2YUC A;  2YQM A;  5EYA F;  2MUM A;  2YU4 A;  2KYU A;  4FJC A;  1WGM A;  4BBQ A;  4WZ2 A;  2LXH C;  3LQH A;  2L0B A;  5B79 A;  2VJE B;  1Z60 A;  4W4U A;  1WEU A;  4S3O C;  1IYM A;  1WEV A;  4FO9 A;  2YQL A;  4AUQ B;  4TKP B;  2VPB A;  5FEY A;  5TBN A;  2D8S A;  2Y1M A;  2YSM A;  5B8D A;  5TDR A;  1LDJ B;  3LQJ A;  3HCU A;  2KFT A;  2KWN A;  4PPE A;  1WE9 A;  3QZV A;  4F52 B;  4BHW A;  2YUR A;  2CSY A;  2KWK A;  2I50 A;  3NG2 A;  5JG6 A;  1WIM A;  1HYJ A;  3KV5 A;  4L7X A;  4YC9 A;  5LKT A;  4I7D A;  4R2Y A;  1JM7 B;  2VPG A;  1WEO A;  1U6G B;  5H1U A;  3O7A A;  4FK5 A;  2Y43 A;  4NN2 A;  3KQI A;  1WEP A;  5D1L B;  5LCW B;  3KV6 A;  3I2D A;  3HCT A;  2YYR A;  2YHO A;  2G45 A;  4R7E A;  1N87 A;  4IC3 A;  2L75 A;  2LGG A;  5AIT A;  2PUY A;  1VD4 A;  1VFY A;  3ZVY A;  5I3L A;  1F62 A;  3O33 A;  3T6R A;  4X3G A;  2CKL B;  4YBT A;  4Q6F A;  4GND A;  3U5N A;  2JMJ A;  4O64 A;  3ASL A;  4QF2 A;  5G05 B;  2NAA A;  5FB1 A;  2CSZ A;  4I7C A;  3U5P A;  2MNZ A;  1BOR A;  1Z2Q A;  2XEU A;  2VPE A;  1XWH A;  4B86 C;  2EA6 A;  2YW8 A;  5D1K B;  4IC2 A;  5DKA A;  4ZDT A;  2M85 A;  4GNG A;  1X4U A;  5TRB A;  3O34 A;  2RI7 A;  4LKA A;  2VNF A;  4YAX A;  2H0D A;  3O37 A;  3ZPV E;  2Y1N A;  2FUI A;  3RPG B;  2KE1 A;  4N3W A;  5B76 A;  3HTK C;  4ZUX U;  2EGP A;  2LGK A;  5B77 A;  5G0F A;  4A49 A;  4YBS A;  2ECT A;  4GB0 A;  2ECG A;  2F42 A;  3O35 A;  5LKU A;  2E6R A;  2MA5 A;  2ECN A;  5D1M B;  2FSA A;  3DQV R;  3IHP A;  2LGL A;  2CKL A;  5B75 A;  2MD7 B;  3L1Z B;  2PNX A;  4P5O B;  2HDP A;  3EB6 A;  2VJF B;  3M63 A;  3HCS A;  5KH7 A;  2L5U A;  3VK6 A;  2AN6 A;  1E4U A;  3T7L A;  3O70 A;  2LGV A;  3N9L A;  4S3O B;  4LLB A;  5AIU A;  2KRE A;  2YRE A; 
#chains in the Genus database with same CATH topology
 2G6Q A;  3L1X A;  4MVT A;  2UZG A;  2KGI A;  3RPG C;  2M6M A;  4Z0R A;  2YT5 A;  3MHH A;  1MBM A;  2H0D B;  1X4I A;  4V3K C;  4A4C A;  2FD4 A;  2DX8 A;  4XI1 A;  2MD8 C;  2OWA A;  1CHC A;  4YAD A;  4A0C D;  2RSD A;  3FL2 A;  2C2L A;  3SOX A;  3Q1D A;  5TDW A;  1WEM A;  3C5K A;  1WFK A;  4FIP A;  2ZET C;  5J3X A;  1K2F A;  2JRJ A;  2LRI C;  2LQ6 A;  4ZQL A;  4R8P K;  2BAY A;  3GL6 A;  4YAT A;  2KWJ A;  4GNF A;  4V3L C;  2QIZ A;  2XOY A;  3DPL R;  3PUQ A;  2HYE D;  4CCG X;  3V43 A;  2YHN A;  5KH9 A;  4C9Z A;  4N4F A;  1WEE A;  2M3H A;  3PUR A;  2QJ0 A;  2P57 A;  2EOD A;  1G25 A;  3RTR B;  5H1V A;  1WES A;  3ZTG A;  2OXQ C;  5SVI B;  4LK9 A;  2MKE A;  4WZ3 B;  3LJU X;  3DWD A;  1DCQ A;  4PTB A;  3ZNI A;  2KIZ A;  1MM2 A;  2L43 A;  3LRQ A;  2KR4 A;  2VJE A;  5H1T A;  4AYC B;  2QIC A;  4QQ4 A;  3M62 A;  4AP4 A;  2JMI A;  5FER A;  2FFW A;  2LV9 A;  4GNE A;  3N9O A;  2K1J A;  3MHS A;  2MA6 A;  1FBV A;  1FP0 A;  2DJA A;  3EB5 A;  2JM3 A;  2L80 A;  2ECJ A;  5B78 A;  3ZPV 1;  2C2V S;  2F6N A;  4LAD B;  3U5O A;  1ZBD B;  2KU3 A;  5SVI A;  3M99 A;  2ECW A;  4WZ0 A;  5TAB A;  5C13 A;  2CT2 A;  3KDE C;  2VPD A;  2M13 A;  5G04 B;  5C11 A;  1WIL A;  1T1H A;  5LKX A;  2LN0 A;  2E61 A;  1JM7 A;  3SOU A;  3U5M A;  2JMD A;  2B0O E;  2F6J A;  2CRR A;  1WEN A;  2K17 A;  3L11 A;  5FB0 A;  1VYX A;  4L58 A;  2MIQ A;  3ZVZ B;  5SVX A;  2G43 A;  2LXP C;  4WA6 A;  3LQI A;  3M7K A;  1HYI A;  3SHB A;  1DVP A;  4I7B A;  2MT5 A;  4YAB A;  2XOC A;  3LVR E;  3GV4 A;  2RR4 A;  3E2D A;  4UI9 B;  4MSX A;  1Z6U A;  2MNY A;  3C6W A;  3N9M A;  3O36 A;  1MM3 A;  2L7P A;  5H9M A;  5KH3 A;  1WEQ A;  2E6S A;  3JUE A;  2FUU A;  2KGG A;  2IQJ A;  4F1P A;  3ZYQ A;  4AVX A;  3N9N A;  2ECI A;  5DIN A;  1LDK C;  3KNV A;  1X4J A;  3N9Q A;  4A4B A;  4B7Y C;  2XB1 A;  1WEW A;  3PHD A;  1V87 A;  3FM8 C;  4LJN A;  2KKX A;  4CA1 A;  4UP5 A;  2K4D A;  4AYC A;  2K16 A;  2VJF A;  2KWO A;  2YSJ A;  2ECV A;  1RMD A;  3SOW A;  1JOC A;  4QF3 A;  5LKZ A;  3N9P A;  4YBM A;  2LDR A;  2M1R A;  2VP7 A;  4UP0 A;  2IDA A;  2YUC A;  2YQM A;  3LDY A;  5EYA F;  2MUM A;  2YU4 A;  2KYU A;  4FJC A;  1WGM A;  4BBQ A;  4WZ2 A;  2LXH C;  3LQH A;  2L0B A;  5B79 A;  2VJE B;  1Z60 A;  4W4U A;  1WEU A;  4S3O C;  1IYM A;  1WEV A;  2CON A;  4FO9 A;  2YQL A;  4AUQ B;  4TKP B;  2VPB A;  5FEY A;  3MDB C;  5TBN A;  2DSM A;  2EGM A;  2D8S A;  2Y1M A;  2YSM A;  5B8D A;  5TDR A;  1LDJ B;  3LQJ A;  3HCU A;  2KFT A;  2JUN A;  2KWN A;  4PPE A;  1WE9 A;  3QZV A;  4F52 B;  4BHW A;  3FAN A;  2YUR A;  2CSY A;  2KWK A;  2I50 A;  3NG2 A;  3T9K A;  5JG6 A;  1WIM A;  1HYJ A;  3KV5 A;  4L7X A;  4YC9 A;  5LKT A;  4I7D A;  4R2Y A;  1JM7 B;  2VPG A;  1WEO A;  1U6G B;  5H1U A;  3O7A A;  4FK5 A;  2Y43 A;  4NN2 A;  3KQI A;  1WEP A;  5D1L B;  5LCW B;  3KV6 A;  3I2D A;  3HCT A;  2YYR A;  2YHO A;  2G45 A;  4R7E A;  2LAU A;  1N87 A;  2YVR A;  4IC3 A;  2EXU A;  2L75 A;  2LGG A;  5AIT A;  2PUY A;  2D8U A;  1VD4 A;  1VFY A;  3ZVY A;  5I3L A;  1F62 A;  3O33 A;  3T6R A;  4X3G A;  3LVQ E;  2CKL B;  4YBT A;  4Q6F A;  4GND A;  3U5N A;  2JMJ A;  2KKY A;  4O64 A;  3ASL A;  4QF2 A;  5G05 B;  2NAA A;  5SVY A;  4Z0O A;  5FB1 A;  3FEH A;  2CSZ A;  4I7C A;  3U5P A;  2MNZ A;  1BOR A;  1Z2Q A;  2XEU A;  2VPE A;  1XWH A;  4B86 C;  3PLW A;  4OGE A;  3H7H A;  2EA6 A;  2YW8 A;  5D1K B;  4IC2 A;  5DKA A;  4ZDT A;  2CRW A;  2M85 A;  4GNG A;  1X4U A;  5TRB A;  3O34 A;  2RI7 A;  4LKA A;  4OGC A;  3DDT A;  3SUB A;  2VNF A;  4YAX A;  2H0D A;  3O37 A;  3ZPV E;  2Y1N A;  2FUI A;  3RPG B;  2KE1 A;  4N3W A;  3FAO A;  5B76 A;  3HTK C;  4ZUX U;  2EGP A;  2XP0 A;  2LGK A;  5B77 A;  5G0F A;  4A49 A;  4YBS A;  2ECT A;  4GB0 A;  2ECG A;  2F42 A;  2XOZ A;  3O35 A;  5LKU A;  2E6R A;  2MA5 A;  2ECN A;  5D1M B;  2FSA A;  3DQV R;  3IHP A;  4H9D A;  2LGL A;  2CKL A;  5B75 A;  2MD7 B;  3L1Z B;  5K3Q A;  3O47 A;  2PNX A;  4P5O B;  2HDP A;  3EB6 A;  2VJF B;  3M63 A;  3HCS A;  5KH7 A;  2L5U A;  3VK6 A;  2AN6 A;  1E4U A;  3T7L A;  3O70 A;  3FJU B;  2LGV A;  4O62 A;  3N9L A;  4S3O B;  2CSV A;  4LLB A;  5AIU A;  2KRE A;  2YRE A; 
#chains in the Genus database with same CATH homology
 2G6Q A;  3L1X A;  4MVT A;  2UZG A;  2KGI A;  3RPG C;  2M6M A;  2YT5 A;  3MHH A;  2H0D B;  1X4I A;  4V3K C;  4A4C A;  2DX8 A;  4XI1 A;  2MD8 C;  1CHC A;  4YAD A;  4A0C D;  2RSD A;  3FL2 A;  2C2L A;  3SOX A;  5TDW A;  1WEM A;  3C5K A;  1WFK A;  4FIP A;  2ZET C;  5J3X A;  1K2F A;  2JRJ A;  2LRI C;  2LQ6 A;  4ZQL A;  4R8P K;  2BAY A;  3GL6 A;  4YAT A;  2KWJ A;  4GNF A;  4V3L C;  2QIZ A;  3DPL R;  3PUQ A;  2HYE D;  4CCG X;  3V43 A;  2YHN A;  5KH9 A;  4C9Z A;  4N4F A;  1WEE A;  2M3H A;  3PUR A;  2QJ0 A;  2EOD A;  1G25 A;  3RTR B;  5H1V A;  1WES A;  3ZTG A;  2OXQ C;  4LK9 A;  4WZ3 B;  4PTB A;  3ZNI A;  2KIZ A;  1MM2 A;  2L43 A;  3LRQ A;  2KR4 A;  2VJE A;  5H1T A;  4AYC B;  2QIC A;  3M62 A;  4AP4 A;  2JMI A;  5FER A;  2LV9 A;  4GNE A;  3N9O A;  2K1J A;  3MHS A;  2MA6 A;  1FP0 A;  1FBV A;  3EB5 A;  2L80 A;  2ECJ A;  5B78 A;  3ZPV 1;  2C2V S;  2F6N A;  4LAD B;  3U5O A;  1ZBD B;  2KU3 A;  3M99 A;  2ECW A;  4WZ0 A;  5TAB A;  5C13 A;  2CT2 A;  2VPD A;  5G04 B;  5C11 A;  1WIL A;  1T1H A;  5LKX A;  2LN0 A;  1JM7 A;  3SOU A;  3U5M A;  2JMD A;  2F6J A;  1WEN A;  2K17 A;  3L11 A;  5FB0 A;  1VYX A;  4L58 A;  2MIQ A;  3ZVZ B;  2G43 A;  2LXP C;  4WA6 A;  3LQI A;  1HYI A;  3SHB A;  1DVP A;  4I7B A;  2MT5 A;  4YAB A;  3GV4 A;  4UI9 B;  4MSX A;  1Z6U A;  2MNY A;  3C6W A;  3N9M A;  3O36 A;  1MM3 A;  5H9M A;  5KH3 A;  1WEQ A;  2E6S A;  2FUU A;  2KGG A;  3ZYQ A;  4AVX A;  3N9N A;  2ECI A;  1LDK C;  5DIN A;  3KNV A;  1X4J A;  3N9Q A;  4A4B A;  4B7Y C;  2XB1 A;  1WEW A;  3PHD A;  1V87 A;  4LJN A;  4CA1 A;  4UP5 A;  2K4D A;  4AYC A;  2K16 A;  2VJF A;  2KWO A;  2YSJ A;  2ECV A;  1RMD A;  3SOW A;  1JOC A;  4QF3 A;  5LKZ A;  3N9P A;  4YBM A;  2LDR A;  2M1R A;  2VP7 A;  4UP0 A;  2IDA A;  2YUC A;  2YQM A;  5EYA F;  2MUM A;  2YU4 A;  2KYU A;  4FJC A;  1WGM A;  4BBQ A;  4WZ2 A;  2LXH C;  3LQH A;  2L0B A;  5B79 A;  2VJE B;  1Z60 A;  4W4U A;  1WEU A;  4S3O C;  1IYM A;  1WEV A;  4FO9 A;  2YQL A;  4AUQ B;  4TKP B;  2VPB A;  5FEY A;  5TBN A;  2D8S A;  2Y1M A;  2YSM A;  5B8D A;  5TDR A;  1LDJ B;  3LQJ A;  3HCU A;  2KFT A;  2KWN A;  4PPE A;  1WE9 A;  3QZV A;  4F52 B;  4BHW A;  2YUR A;  2CSY A;  2KWK A;  2I50 A;  3NG2 A;  5JG6 A;  1WIM A;  1HYJ A;  3KV5 A;  4L7X A;  4YC9 A;  5LKT A;  4I7D A;  4R2Y A;  1JM7 B;  2VPG A;  1WEO A;  1U6G B;  5H1U A;  3O7A A;  4FK5 A;  2Y43 A;  4NN2 A;  3KQI A;  1WEP A;  5D1L B;  5LCW B;  3KV6 A;  3I2D A;  3HCT A;  2YYR A;  2YHO A;  2G45 A;  4R7E A;  1N87 A;  4IC3 A;  2L75 A;  2LGG A;  5AIT A;  2PUY A;  1VD4 A;  1VFY A;  3ZVY A;  5I3L A;  1F62 A;  3O33 A;  3T6R A;  4X3G A;  2CKL B;  4YBT A;  4Q6F A;  4GND A;  3U5N A;  2JMJ A;  4O64 A;  3ASL A;  4QF2 A;  5G05 B;  2NAA A;  5FB1 A;  2CSZ A;  4I7C A;  3U5P A;  2MNZ A;  1BOR A;  1Z2Q A;  2XEU A;  2VPE A;  1XWH A;  4B86 C;  2EA6 A;  2YW8 A;  5D1K B;  4IC2 A;  5DKA A;  4ZDT A;  2M85 A;  4GNG A;  1X4U A;  5TRB A;  3O34 A;  2RI7 A;  4LKA A;  2VNF A;  4YAX A;  2H0D A;  3O37 A;  3ZPV E;  2Y1N A;  2FUI A;  3RPG B;  2KE1 A;  4N3W A;  5B76 A;  3HTK C;  4ZUX U;  2EGP A;  2LGK A;  5B77 A;  5G0F A;  4A49 A;  4YBS A;  2ECT A;  4GB0 A;  2ECG A;  2F42 A;  3O35 A;  5LKU A;  2E6R A;  2MA5 A;  2ECN A;  5D1M B;  2FSA A;  3DQV R;  3IHP A;  2LGL A;  2CKL A;  5B75 A;  2MD7 B;  3L1Z B;  2PNX A;  4P5O B;  2HDP A;  3EB6 A;  2VJF B;  3M63 A;  3HCS A;  5KH7 A;  2L5U A;  3VK6 A;  2AN6 A;  1E4U A;  3T7L A;  3O70 A;  2LGV A;  3N9L A;  4S3O B;  4LLB A;  5AIU A;  2KRE A;  2YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...