3C6WA

Crystal structure of the ing5 phd finger in complex with h3k4me3 peptide
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
51
structure length
51
Chain Sequence
EPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 5
publication title The crystal structure of the ING5 PHD finger in complex with an H3K4me3 histone peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 51
sequence length 51
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3c6wA00
4W4UA 3MHSA 3T6RA 2JRJA 4A0CD 3KV6A 2KFTA 5KH9A 1WEEA 2VPEA 2CSZA 2F6JA 3O35A 4WA6A 3VK6A 3O7AA 2ECTA 3RPGB 5AITA 2VPGA 3HCSA 4IC3A 4P5OB 2VP7A 4NN2A 5TABA 5D1LB 2ECJA 1WESA 2NAAA 5D1KB 3SOWA 3PURA 2MA5A 3V43A 5H9MA 2KGIA 5B77A 4N4FA 2YT5A 3L1XA 1WILA 2VJFB 3N9OA 2KU3A 3DPLR 4N3WA 4GNDA 2KWJA 4UP5A 4WZ0A 5FEYA 1WEVA 2M6MA 3SHBA 4Q6FA 5JG6A 3C6WA 3DQVR 3EB5A 3N9MA 4YBSA 3ZYQA 2Y1MA 2K17A 5KH7A 2KWKA 2E6SA 4F52B 1Z6UA 1VYXA 4FK5A 4V3KC 4FIPA 2YYRA 2MT5A 4WZ3B 2QIZA 4UI9B 2K16A 2Y43A 2M3HA 3ZTGA 2HDPA 2C2LA 2MIQA 3SOUA 3O33A 2VJFA 2ECGA 3MHHA 2QICA 4R8PK 3QZVA 4IC2A 3HTKC 4YC9A 5TDRA 3RTRB 4FO9A 1Z2QA 4YAXA 2EODA 4S3OB 4X3GA 4AYCB 4WZ2A 4B86C 5DKAA 2EGPA 2VPDA 3GL6A 1FP0A 3T7LA 2M85A 4MSXA 2ECNA 5H1TA 2D8SA 5TBNA 1LDJB 3N9PA 2YHOA 3HCTA 5LKZA 4PPEA 2YURA 3ZVYA 2F6NA 2CT2A 5KH3A 1WEOA 2LXHC 5LKXA 2LDRA 2KE1A 2C2VS 1WEQA 3O36A 2DX8A 1CHCA 4XI1A 5LKTA 5TRBA 2FUIA 2VNFA 2YQMA 3SOXA 1WEUA 2YREA 2LGLA 3IHPA 2L43A 4GNEA 2PUYA 4I7CA 3U5NA 2HYED 2H0DA 4CCGX 5H1UA 1JOCA 2LGVA 3LRQA 2KWNA 2LGKA 2PNXA 4AYCA 4ZQLA 2MD8C 4S3OC 3LQJA 3M99A 2JMIA 1Z60A 2YQLA 3KNVA 1WGMA 3ZPVE 3ZPV1 1HYJA 2G45A 2K1JA 4AUQB 2G43A 4L7XA 5DINA 1WENA 1WEMA 2EA6A 2LGGA 3PUQA 3L1ZB 2FSAA 2CKLB 2LXPC 2LRIC 5EYAF 1E4UA 2F42A 2RSDA 1BORA 4LLBA 2KWOA 2YW8A 3ZVZB 2OXQC 2E6RA 2VJEB 4PTBA 1XWHA 4O64A 1JM7B 4CA1A 2MUMA 2KR4A 2BAYA 3U5PA 4GNGA 4L58A 3M62A 5G04B 4QF2A 5C11A 5C13A 3EB6A 2KGGA 2JMDA 3C5KA 2L80A 4B7YC 2Y1NA 1WIMA 2K4DA 2YSJA 3LQHA 3U5MA 3FL2A 4ZUXU 1MM3A 2ECWA 2CKLA 2AN6A 5B8DA 2L0BA 2FUUA 2L75A 2LN0A 2MA6A 5H1VA 5TDWA 3O37A 4BBQA 3KQIA 1V87A 2VJEA 3PHDA 4YATA 4LK9A 4C9ZA 1JM7A 2YSMA 1F62A 1X4UA 3N9QA 2KREA 2YUCA 4R2YA 5LCWB 4AP4A 4MVTA 4LADB 2VPBA 3HCUA 1FBVA 3M63A 5AIUA 5FERA 4A4BA 1G25A 4AVXA 3GV4A 5LKUA 2RI7A 4GNFA 4I7BA 4YADA 2L5UA 5G0FA 2ZETC 2ECIA 2KYUA 1N87A 4YBMA 2MNZA 1MM2A 2YHNA 4TKPB 1X4JA 1RMDA 2JMJA 2XEUA 2ECVA 3ZNIA 3LQIA 4FJCA 5G05B 2UZGA 2MNYA 4QF3A 1IYMA 4ZDTA 2LQ6A 1DVPA 4LKAA 2M1RA 2IDAA 5B75A 4GB0A 4LJNA 4I7DA 3KV5A 3O70A 3L11A 3ASLA 2YU4A 2XB1A 3RPGC 4BHWA 3N9LA 3I2DA 4A4CA 3N9NA 2KIZA 5I3LA 1VD4A 2G6QA 1WEWA 3NG2A 5FB0A 5FB1A 4V3LC 1U6GB 1ZBDB 2CSYA 1VFYA 2MD7B 5D1MB 2H0DB 5B79A 2LV9A 1HYIA 4YABA 1WEPA 1LDKC 4UP0A 1WFKA 5J3XA 5B78A 2I50A 3U5OA 1K2FA 1X4IA 4YBTA 3O34A 4A49A 2QJ0A 4R7EA 1T1HA 1WE9A 5B76A
chains in the Genus database with same CATH superfamily
4W4UA 3MHSA 3T6RA 2JRJA 4A0CD 2XOCA 3KV6A 2KFTA 5KH9A 1WEEA 2VPEA 2CSZA 2F6JA 3O35A 4WA6A 3VK6A 3O7AA 2ECTA 3RPGB 5AITA 2VPGA 3HCSA 4IC3A 4P5OB 2VP7A 4NN2A 5TABA 5D1LB 2ECJA 1WESA 1MBMA 2NAAA 5D1KB 3SOWA 3PURA 2MA5A 3V43A 5H9MA 2P57A 3H7HA 2KGIA 5B77A 3FM8C 4N4FA 2YT5A 3L1XA 3FJUB 1WILA 2VJFB 3N9OA 2CONA 2KU3A 3DPLR 4N3WA 4GNDA 2KWJA 4UP5A 4WZ0A 5FEYA 1WEVA 2M6MA 3SHBA 4Q6FA 5JG6A 3C6WA 3DQVR 3EB5A 3N9MA 4YBSA 3ZYQA 2Y1MA 2K17A 5KH7A 2DSMA 3LVQE 2KWKA 2E6SA 4F52B 1Z6UA 1VYXA 4FK5A 4V3KC 4FIPA 2YYRA 2MT5A 4OGCA 4WZ3B 2QIZA 4UI9B 2K16A 2Y43A 2M3HA 2M13A 3ZTGA 2HDPA 2C2LA 2MIQA 3SOUA 3O33A 3KDEC 2VJFA 2ECGA 3MHHA 2QICA 4R8PK 3QZVA 4IC2A 3HTKC 4YC9A 5TDRA 4FO9A 3RTRB 1Z2QA 2FD4A 4YAXA 2EODA 4S3OB 4X3GA 4AYCB 4WZ2A 4B86C 5DKAA 2EGPA 2EGMA 2VPDA 3GL6A 1FP0A 3T7LA 2M85A 4MSXA 2ECNA 5H1TA 2D8SA 2OWAA 1LDJB 5TBNA 3N9PA 3FEHA 2YHOA 3HCTA 5LKZA 4PPEA 2YURA 3ZVYA 3SUBA 2E61A 2F6NA 2CT2A 5KH3A 1WEOA 2LXHC 5LKXA 2LDRA 2KE1A 2C2VS 1WEQA 3O36A 2DX8A 1CHCA 4XI1A 2IQJA 5LKTA 5TRBA 2FUIA 2VNFA 2YQMA 3SOXA 1WEUA 2YREA 2LGLA 3IHPA 2B0OE 2L43A 3DWDA 4GNEA 2PUYA 4I7CA 3U5NA 2HYED 2H0DA 4CCGX 5H1UA 1JOCA 2LGVA 3LRQA 2KWNA 2LGKA 2PNXA 4AYCA 5SVYA 4ZQLA 2MD8C 4S3OC 3LQJA 3M99A 2JMIA 1Z60A 2YQLA 3KNVA 1WGMA 3ZPVE 3ZPV1 1HYJA 2G45A 2K1JA 4AUQB 2G43A 4L7XA 5DINA 1WENA 1WEMA 2EA6A 2LGGA 3O47A 3PUQA 3L1ZB 2FSAA 2CKLB 2LXPC 2LRIC 5EYAF 1E4UA 2F42A 2RSDA 1BORA 5SVXA 4LLBA 2KWOA 2YW8A 3LVRE 2JM3A 3ZVZB 2OXQC 2E6RA 2VJEB 4PTBA 1XWHA 3Q1DA 4O64A 1JM7B 4CA1A 2MUMA 2KR4A 2BAYA 2YVRA 3U5PA 4OGEA 2D8UA 4GNGA 4L58A 3M62A 5G04B 4QF2A 4F1PA 5C11A 3MDBC 5C13A 3EB6A 2KGGA 2JMDA 3C5KA 2L80A 4B7YC 2Y1NA 1WIMA 2K4DA 2YSJA 3LQHA 3U5MA 3FL2A 4ZUXU 1MM3A 2ECWA 2XOYA 2CKLA 2AN6A 5B8DA 2L0BA 4O62A 2KKYA 2FUUA 5K3QA 2L75A 2LN0A 3PLWA 2MA6A 5H1VA 5TDWA 3T9KA 3O37A 4BBQA 3KQIA 1V87A 2VJEA 3PHDA 4YATA 4LK9A 4C9ZA 1JM7A 2YSMA 1F62A 1X4UA 4QQ4A 3N9QA 2KREA 2YUCA 4R2YA 5LCWB 3LDYA 4H9DA 4AP4A 4MVTA 4LADB 2VPBA 3HCUA 1FBVA 3M63A 5AIUA 5FERA 4A4BA 1DCQA 1G25A 4AVXA 3GV4A 5LKUA 2RI7A 4GNFA 4I7BA 4YADA 2L5UA 5G0FA 2ZETC 2MKEA 2ECIA 5SVIB 2KYUA 1N87A 4YBMA 2MNZA 1MM2A 2YHNA 4TKPB 1X4JA 2LAUA 1RMDA 2JMJA 2XEUA 2ECVA 2CRRA 2XP0A 3ZNIA 2RR4A 2L7PA 3LQIA 4FJCA 5G05B 2UZGA 2MNYA 4QF3A 1IYMA 4ZDTA 2LQ6A 1DVPA 4LKAA 2KKXA 2M1RA 4Z0RA 2IDAA 5B75A 4GB0A 4LJNA 4I7DA 3KV5A 3O70A 3L11A 2XOZA 3M7KA 3ASLA 2YU4A 2XB1A 3RPGC 2CSVA 4BHWA 3LJUX 3N9LA 3JUEA 3I2DA 4A4CA 3N9NA 2KIZA 2EXUA 5I3LA 2CRWA 1VD4A 2G6QA 1WEWA 3NG2A 5SVIA 5FB0A 2FFWA 5FB1A 4V3LC 1U6GB 1ZBDB 2CSYA 1VFYA 2MD7B 5D1MB 2H0DB 5B79A 2LV9A 2DJAA 1HYIA 4YABA 1WEPA 4Z0OA 2JUNA 1LDKC 4UP0A 3E2DA 1WFKA 5J3XA 5B78A 2I50A 3U5OA 1K2FA 3FANA 1X4IA 3FAOA 4YBTA 3O34A 4A49A 2QJ0A 4R7EA 1T1HA 1WE9A 3DDTA 5B76A
chains in the Genus database with same CATH topology
4W4UA 3MHSA 3T6RA 2JRJA 4A0CD 3KV6A 2KFTA 5KH9A 1WEEA 2VPEA 2CSZA 2F6JA 3O35A 4WA6A 3VK6A 3O7AA 2ECTA 3RPGB 5AITA 2VPGA 3HCSA 4IC3A 4P5OB 2VP7A 4NN2A 5TABA 5D1LB 2ECJA 1WESA 2NAAA 5D1KB 3SOWA 3PURA 2MA5A 3V43A 5H9MA 2KGIA 5B77A 4N4FA 2YT5A 3L1XA 1WILA 2VJFB 3N9OA 2KU3A 3DPLR 4N3WA 4GNDA 2KWJA 4UP5A 4WZ0A 5FEYA 1WEVA 2M6MA 3SHBA 4Q6FA 5JG6A 3C6WA 3DQVR 3EB5A 3N9MA 4YBSA 3ZYQA 2Y1MA 2K17A 5KH7A 2KWKA 2E6SA 4F52B 1Z6UA 1VYXA 4FK5A 4V3KC 4FIPA 2YYRA 2MT5A 4WZ3B 2QIZA 4UI9B 2K16A 2Y43A 2M3HA 3ZTGA 2HDPA 2C2LA 2MIQA 3SOUA 3O33A 2VJFA 2ECGA 3MHHA 2QICA 4R8PK 3QZVA 4IC2A 3HTKC 4YC9A 5TDRA 3RTRB 4FO9A 1Z2QA 4YAXA 2EODA 4S3OB 4X3GA 4AYCB 4WZ2A 4B86C 5DKAA 2EGPA 2VPDA 3GL6A 1FP0A 3T7LA 2M85A 4MSXA 2ECNA 5H1TA 2D8SA 5TBNA 1LDJB 3N9PA 2YHOA 3HCTA 5LKZA 4PPEA 2YURA 3ZVYA 2F6NA 2CT2A 5KH3A 1WEOA 2LXHC 5LKXA 2LDRA 2KE1A 2C2VS 1WEQA 3O36A 2DX8A 1CHCA 4XI1A 5LKTA 5TRBA 2FUIA 2VNFA 2YQMA 3SOXA 1WEUA 2YREA 2LGLA 3IHPA 2L43A 4GNEA 2PUYA 4I7CA 3U5NA 2HYED 2H0DA 4CCGX 5H1UA 1JOCA 2LGVA 3LRQA 2KWNA 2LGKA 2PNXA 4AYCA 4ZQLA 2MD8C 4S3OC 3LQJA 3M99A 2JMIA 1Z60A 2YQLA 3KNVA 1WGMA 3ZPVE 3ZPV1 1HYJA 2G45A 2K1JA 4AUQB 2G43A 4L7XA 5DINA 1WENA 1WEMA 2EA6A 2LGGA 3PUQA 3L1ZB 2FSAA 2CKLB 2LXPC 2LRIC 5EYAF 1E4UA 2F42A 2RSDA 1BORA 4LLBA 2KWOA 2YW8A 3ZVZB 2OXQC 2E6RA 2VJEB 4PTBA 1XWHA 4O64A 1JM7B 4CA1A 2MUMA 2KR4A 2BAYA 3U5PA 4GNGA 4L58A 3M62A 5G04B 4QF2A 5C11A 5C13A 3EB6A 2KGGA 2JMDA 3C5KA 2L80A 4B7YC 2Y1NA 1WIMA 2K4DA 2YSJA 3LQHA 3U5MA 3FL2A 4ZUXU 1MM3A 2ECWA 2CKLA 2AN6A 5B8DA 2L0BA 2FUUA 2L75A 2LN0A 2MA6A 5H1VA 5TDWA 3O37A 4BBQA 3KQIA 1V87A 2VJEA 3PHDA 4YATA 4LK9A 4C9ZA 1JM7A 2YSMA 1F62A 1X4UA 3N9QA 2KREA 2YUCA 4R2YA 5LCWB 4AP4A 4MVTA 4LADB 2VPBA 3HCUA 1FBVA 3M63A 5AIUA 5FERA 4A4BA 1G25A 4AVXA 3GV4A 5LKUA 2RI7A 4GNFA 4I7BA 4YADA 2L5UA 5G0FA 2ZETC 2ECIA 2KYUA 1N87A 4YBMA 2MNZA 1MM2A 2YHNA 4TKPB 1X4JA 1RMDA 2JMJA 2XEUA 2ECVA 3ZNIA 3LQIA 4FJCA 5G05B 2UZGA 2MNYA 4QF3A 1IYMA 4ZDTA 2LQ6A 1DVPA 4LKAA 2M1RA 2IDAA 5B75A 4GB0A 4LJNA 4I7DA 3KV5A 3O70A 3L11A 3ASLA 2YU4A 2XB1A 3RPGC 4BHWA 3N9LA 3I2DA 4A4CA 3N9NA 2KIZA 5I3LA 1VD4A 2G6QA 1WEWA 3NG2A 5FB0A 5FB1A 4V3LC 1U6GB 1ZBDB 2CSYA 1VFYA 2MD7B 5D1MB 2H0DB 5B79A 2LV9A 1HYIA 4YABA 1WEPA 1LDKC 4UP0A 1WFKA 5J3XA 5B78A 2I50A 3U5OA 1K2FA 1X4IA 4YBTA 3O34A 4A49A 2QJ0A 4R7EA 1T1HA 1WE9A 5B76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4U A;  3MHS A;  3T6R A;  2JRJ A;  4A0C D;  3KV6 A;  2KFT A;  5KH9 A;  1WEE A;  2VPE A;  2CSZ A;  2F6J A;  3O35 A;  4WA6 A;  3VK6 A;  3O7A A;  2ECT A;  3RPG B;  5AIT A;  2VPG A;  3HCS A;  4IC3 A;  4P5O B;  2VP7 A;  4NN2 A;  5TAB A;  5D1L B;  2ECJ A;  1WES A;  2NAA A;  5D1K B;  3SOW A;  3PUR A;  2MA5 A;  3V43 A;  5H9M A;  2KGI A;  5B77 A;  4N4F A;  2YT5 A;  3L1X A;  1WIL A;  2VJF B;  3N9O A;  2KU3 A;  3DPL R;  4N3W A;  4GND A;  2KWJ A;  4UP5 A;  4WZ0 A;  5FEY A;  1WEV A;  2M6M A;  3SHB A;  4Q6F A;  5JG6 A;  3C6W A;  3DQV R;  3EB5 A;  3N9M A;  4YBS A;  3ZYQ A;  2Y1M A;  2K17 A;  5KH7 A;  2KWK A;  2E6S A;  4F52 B;  1Z6U A;  1VYX A;  4FK5 A;  4V3K C;  4FIP A;  2YYR A;  2MT5 A;  4WZ3 B;  2QIZ A;  4UI9 B;  2K16 A;  2Y43 A;  2M3H A;  3ZTG A;  2HDP A;  2C2L A;  2MIQ A;  3SOU A;  3O33 A;  2VJF A;  2ECG A;  3MHH A;  2QIC A;  4R8P K;  3QZV A;  4IC2 A;  3HTK C;  4YC9 A;  5TDR A;  3RTR B;  4FO9 A;  1Z2Q A;  4YAX A;  2EOD A;  4S3O B;  4X3G A;  4AYC B;  4WZ2 A;  4B86 C;  5DKA A;  2EGP A;  2VPD A;  3GL6 A;  1FP0 A;  3T7L A;  2M85 A;  4MSX A;  2ECN A;  5H1T A;  2D8S A;  5TBN A;  1LDJ B;  3N9P A;  2YHO A;  3HCT A;  5LKZ A;  4PPE A;  2YUR A;  3ZVY A;  2F6N A;  2CT2 A;  5KH3 A;  1WEO A;  2LXH C;  5LKX A;  2LDR A;  2KE1 A;  2C2V S;  1WEQ A;  3O36 A;  2DX8 A;  1CHC A;  4XI1 A;  5LKT A;  5TRB A;  2FUI A;  2VNF A;  2YQM A;  3SOX A;  1WEU A;  2YRE A;  2LGL A;  3IHP A;  2L43 A;  4GNE A;  2PUY A;  4I7C A;  3U5N A;  2HYE D;  2H0D A;  4CCG X;  5H1U A;  1JOC A;  2LGV A;  3LRQ A;  2KWN A;  2LGK A;  2PNX A;  4AYC A;  4ZQL A;  2MD8 C;  4S3O C;  3LQJ A;  3M99 A;  2JMI A;  1Z60 A;  2YQL A;  3KNV A;  1WGM A;  3ZPV E;  3ZPV 1;  1HYJ A;  2G45 A;  2K1J A;  4AUQ B;  2G43 A;  4L7X A;  5DIN A;  1WEN A;  1WEM A;  2EA6 A;  2LGG A;  3PUQ A;  3L1Z B;  2FSA A;  2CKL B;  2LXP C;  2LRI C;  5EYA F;  1E4U A;  2F42 A;  2RSD A;  1BOR A;  4LLB A;  2KWO A;  2YW8 A;  3ZVZ B;  2OXQ C;  2E6R A;  2VJE B;  4PTB A;  1XWH A;  4O64 A;  1JM7 B;  4CA1 A;  2MUM A;  2KR4 A;  2BAY A;  3U5P A;  4GNG A;  4L58 A;  3M62 A;  5G04 B;  4QF2 A;  5C11 A;  5C13 A;  3EB6 A;  2KGG A;  2JMD A;  3C5K A;  2L80 A;  4B7Y C;  2Y1N A;  1WIM A;  2K4D A;  2YSJ A;  3LQH A;  3U5M A;  3FL2 A;  4ZUX U;  1MM3 A;  2ECW A;  2CKL A;  2AN6 A;  5B8D A;  2L0B A;  2FUU A;  2L75 A;  2LN0 A;  2MA6 A;  5H1V A;  5TDW A;  3O37 A;  4BBQ A;  3KQI A;  1V87 A;  2VJE A;  3PHD A;  4YAT A;  4LK9 A;  4C9Z A;  1JM7 A;  2YSM A;  1F62 A;  1X4U A;  3N9Q A;  2KRE A;  2YUC A;  4R2Y A;  5LCW B;  4AP4 A;  4MVT A;  4LAD B;  2VPB A;  3HCU A;  1FBV A;  3M63 A;  5AIU A;  5FER A;  4A4B A;  1G25 A;  4AVX A;  3GV4 A;  5LKU A;  2RI7 A;  4GNF A;  4I7B A;  4YAD A;  2L5U A;  5G0F A;  2ZET C;  2ECI A;  2KYU A;  1N87 A;  4YBM A;  2MNZ A;  1MM2 A;  2YHN A;  4TKP B;  1X4J A;  1RMD A;  2JMJ A;  2XEU A;  2ECV A;  3ZNI A;  3LQI A;  4FJC A;  5G05 B;  2UZG A;  2MNY A;  4QF3 A;  1IYM A;  4ZDT A;  2LQ6 A;  1DVP A;  4LKA A;  2M1R A;  2IDA A;  5B75 A;  4GB0 A;  4LJN A;  4I7D A;  3KV5 A;  3O70 A;  3L11 A;  3ASL A;  2YU4 A;  2XB1 A;  3RPG C;  4BHW A;  3N9L A;  3I2D A;  4A4C A;  3N9N A;  2KIZ A;  5I3L A;  1VD4 A;  2G6Q A;  1WEW A;  3NG2 A;  5FB0 A;  5FB1 A;  4V3L C;  1U6G B;  1ZBD B;  2CSY A;  1VFY A;  2MD7 B;  5D1M B;  2H0D B;  5B79 A;  2LV9 A;  1HYI A;  4YAB A;  1WEP A;  1LDK C;  4UP0 A;  1WFK A;  5J3X A;  5B78 A;  2I50 A;  3U5O A;  1K2F A;  1X4I A;  4YBT A;  3O34 A;  4A49 A;  2QJ0 A;  4R7E A;  1T1H A;  1WE9 A;  5B76 A; 
#chains in the Genus database with same CATH topology
 4W4U A;  3MHS A;  3T6R A;  2JRJ A;  4A0C D;  2XOC A;  3KV6 A;  2KFT A;  5KH9 A;  1WEE A;  2VPE A;  2CSZ A;  2F6J A;  3O35 A;  4WA6 A;  3VK6 A;  3O7A A;  2ECT A;  3RPG B;  5AIT A;  2VPG A;  3HCS A;  4IC3 A;  4P5O B;  2VP7 A;  4NN2 A;  5TAB A;  5D1L B;  2ECJ A;  1WES A;  1MBM A;  2NAA A;  5D1K B;  3SOW A;  3PUR A;  2MA5 A;  3V43 A;  5H9M A;  2P57 A;  3H7H A;  2KGI A;  5B77 A;  3FM8 C;  4N4F A;  2YT5 A;  3L1X A;  3FJU B;  1WIL A;  2VJF B;  3N9O A;  2CON A;  2KU3 A;  3DPL R;  4N3W A;  4GND A;  2KWJ A;  4UP5 A;  4WZ0 A;  5FEY A;  1WEV A;  2M6M A;  3SHB A;  4Q6F A;  5JG6 A;  3C6W A;  3DQV R;  3EB5 A;  3N9M A;  4YBS A;  3ZYQ A;  2Y1M A;  2K17 A;  5KH7 A;  2DSM A;  3LVQ E;  2KWK A;  2E6S A;  4F52 B;  1Z6U A;  1VYX A;  4FK5 A;  4V3K C;  4FIP A;  2YYR A;  2MT5 A;  4OGC A;  4WZ3 B;  2QIZ A;  4UI9 B;  2K16 A;  2Y43 A;  2M3H A;  2M13 A;  3ZTG A;  2HDP A;  2C2L A;  2MIQ A;  3SOU A;  3O33 A;  3KDE C;  2VJF A;  2ECG A;  3MHH A;  2QIC A;  4R8P K;  3QZV A;  4IC2 A;  3HTK C;  4YC9 A;  5TDR A;  4FO9 A;  3RTR B;  1Z2Q A;  2FD4 A;  4YAX A;  2EOD A;  4S3O B;  4X3G A;  4AYC B;  4WZ2 A;  4B86 C;  5DKA A;  2EGP A;  2EGM A;  2VPD A;  3GL6 A;  1FP0 A;  3T7L A;  2M85 A;  4MSX A;  2ECN A;  5H1T A;  2D8S A;  2OWA A;  1LDJ B;  5TBN A;  3N9P A;  3FEH A;  2YHO A;  3HCT A;  5LKZ A;  4PPE A;  2YUR A;  3ZVY A;  3SUB A;  2E61 A;  2F6N A;  2CT2 A;  5KH3 A;  1WEO A;  2LXH C;  5LKX A;  2LDR A;  2KE1 A;  2C2V S;  1WEQ A;  3O36 A;  2DX8 A;  1CHC A;  4XI1 A;  2IQJ A;  5LKT A;  5TRB A;  2FUI A;  2VNF A;  2YQM A;  3SOX A;  1WEU A;  2YRE A;  2LGL A;  3IHP A;  2B0O E;  2L43 A;  3DWD A;  4GNE A;  2PUY A;  4I7C A;  3U5N A;  2HYE D;  2H0D A;  4CCG X;  5H1U A;  1JOC A;  2LGV A;  3LRQ A;  2KWN A;  2LGK A;  2PNX A;  4AYC A;  5SVY A;  4ZQL A;  2MD8 C;  4S3O C;  3LQJ A;  3M99 A;  2JMI A;  1Z60 A;  2YQL A;  3KNV A;  1WGM A;  3ZPV E;  3ZPV 1;  1HYJ A;  2G45 A;  2K1J A;  4AUQ B;  2G43 A;  4L7X A;  5DIN A;  1WEN A;  1WEM A;  2EA6 A;  2LGG A;  3O47 A;  3PUQ A;  3L1Z B;  2FSA A;  2CKL B;  2LXP C;  2LRI C;  5EYA F;  1E4U A;  2F42 A;  2RSD A;  1BOR A;  5SVX A;  4LLB A;  2KWO A;  2YW8 A;  3LVR E;  2JM3 A;  3ZVZ B;  2OXQ C;  2E6R A;  2VJE B;  4PTB A;  1XWH A;  3Q1D A;  4O64 A;  1JM7 B;  4CA1 A;  2MUM A;  2KR4 A;  2BAY A;  2YVR A;  3U5P A;  4OGE A;  2D8U A;  4GNG A;  4L58 A;  3M62 A;  5G04 B;  4QF2 A;  4F1P A;  5C11 A;  3MDB C;  5C13 A;  3EB6 A;  2KGG A;  2JMD A;  3C5K A;  2L80 A;  4B7Y C;  2Y1N A;  1WIM A;  2K4D A;  2YSJ A;  3LQH A;  3U5M A;  3FL2 A;  4ZUX U;  1MM3 A;  2ECW A;  2XOY A;  2CKL A;  2AN6 A;  5B8D A;  2L0B A;  4O62 A;  2KKY A;  2FUU A;  5K3Q A;  2L75 A;  2LN0 A;  3PLW A;  2MA6 A;  5H1V A;  5TDW A;  3T9K A;  3O37 A;  4BBQ A;  3KQI A;  1V87 A;  2VJE A;  3PHD A;  4YAT A;  4LK9 A;  4C9Z A;  1JM7 A;  2YSM A;  1F62 A;  1X4U A;  4QQ4 A;  3N9Q A;  2KRE A;  2YUC A;  4R2Y A;  5LCW B;  3LDY A;  4H9D A;  4AP4 A;  4MVT A;  4LAD B;  2VPB A;  3HCU A;  1FBV A;  3M63 A;  5AIU A;  5FER A;  4A4B A;  1DCQ A;  1G25 A;  4AVX A;  3GV4 A;  5LKU A;  2RI7 A;  4GNF A;  4I7B A;  4YAD A;  2L5U A;  5G0F A;  2ZET C;  2MKE A;  2ECI A;  5SVI B;  2KYU A;  1N87 A;  4YBM A;  2MNZ A;  1MM2 A;  2YHN A;  4TKP B;  1X4J A;  2LAU A;  1RMD A;  2JMJ A;  2XEU A;  2ECV A;  2CRR A;  2XP0 A;  3ZNI A;  2RR4 A;  2L7P A;  3LQI A;  4FJC A;  5G05 B;  2UZG A;  2MNY A;  4QF3 A;  1IYM A;  4ZDT A;  2LQ6 A;  1DVP A;  4LKA A;  2KKX A;  2M1R A;  4Z0R A;  2IDA A;  5B75 A;  4GB0 A;  4LJN A;  4I7D A;  3KV5 A;  3O70 A;  3L11 A;  2XOZ A;  3M7K A;  3ASL A;  2YU4 A;  2XB1 A;  3RPG C;  2CSV A;  4BHW A;  3LJU X;  3N9L A;  3JUE A;  3I2D A;  4A4C A;  3N9N A;  2KIZ A;  2EXU A;  5I3L A;  2CRW A;  1VD4 A;  2G6Q A;  1WEW A;  3NG2 A;  5SVI A;  5FB0 A;  2FFW A;  5FB1 A;  4V3L C;  1U6G B;  1ZBD B;  2CSY A;  1VFY A;  2MD7 B;  5D1M B;  2H0D B;  5B79 A;  2LV9 A;  2DJA A;  1HYI A;  4YAB A;  1WEP A;  4Z0O A;  2JUN A;  1LDK C;  4UP0 A;  3E2D A;  1WFK A;  5J3X A;  5B78 A;  2I50 A;  3U5O A;  1K2F A;  3FAN A;  1X4I A;  3FAO A;  4YBT A;  3O34 A;  4A49 A;  2QJ0 A;  4R7E A;  1T1H A;  1WE9 A;  3DDT A;  5B76 A; 
#chains in the Genus database with same CATH homology
 4W4U A;  3MHS A;  3T6R A;  2JRJ A;  4A0C D;  3KV6 A;  2KFT A;  5KH9 A;  1WEE A;  2VPE A;  2CSZ A;  2F6J A;  3O35 A;  4WA6 A;  3VK6 A;  3O7A A;  2ECT A;  3RPG B;  5AIT A;  2VPG A;  3HCS A;  4IC3 A;  4P5O B;  2VP7 A;  4NN2 A;  5TAB A;  5D1L B;  2ECJ A;  1WES A;  2NAA A;  5D1K B;  3SOW A;  3PUR A;  2MA5 A;  3V43 A;  5H9M A;  2KGI A;  5B77 A;  4N4F A;  2YT5 A;  3L1X A;  1WIL A;  2VJF B;  3N9O A;  2KU3 A;  3DPL R;  4N3W A;  4GND A;  2KWJ A;  4UP5 A;  4WZ0 A;  5FEY A;  1WEV A;  2M6M A;  3SHB A;  4Q6F A;  5JG6 A;  3C6W A;  3DQV R;  3EB5 A;  3N9M A;  4YBS A;  3ZYQ A;  2Y1M A;  2K17 A;  5KH7 A;  2KWK A;  2E6S A;  4F52 B;  1Z6U A;  1VYX A;  4FK5 A;  4V3K C;  4FIP A;  2YYR A;  2MT5 A;  4WZ3 B;  2QIZ A;  4UI9 B;  2K16 A;  2Y43 A;  2M3H A;  3ZTG A;  2HDP A;  2C2L A;  2MIQ A;  3SOU A;  3O33 A;  2VJF A;  2ECG A;  3MHH A;  2QIC A;  4R8P K;  3QZV A;  4IC2 A;  3HTK C;  4YC9 A;  5TDR A;  3RTR B;  4FO9 A;  1Z2Q A;  4YAX A;  2EOD A;  4S3O B;  4X3G A;  4AYC B;  4WZ2 A;  4B86 C;  5DKA A;  2EGP A;  2VPD A;  3GL6 A;  1FP0 A;  3T7L A;  2M85 A;  4MSX A;  2ECN A;  5H1T A;  2D8S A;  5TBN A;  1LDJ B;  3N9P A;  2YHO A;  3HCT A;  5LKZ A;  4PPE A;  2YUR A;  3ZVY A;  2F6N A;  2CT2 A;  5KH3 A;  1WEO A;  2LXH C;  5LKX A;  2LDR A;  2KE1 A;  2C2V S;  1WEQ A;  3O36 A;  2DX8 A;  1CHC A;  4XI1 A;  5LKT A;  5TRB A;  2FUI A;  2VNF A;  2YQM A;  3SOX A;  1WEU A;  2YRE A;  2LGL A;  3IHP A;  2L43 A;  4GNE A;  2PUY A;  4I7C A;  3U5N A;  2HYE D;  2H0D A;  4CCG X;  5H1U A;  1JOC A;  2LGV A;  3LRQ A;  2KWN A;  2LGK A;  2PNX A;  4AYC A;  4ZQL A;  2MD8 C;  4S3O C;  3LQJ A;  3M99 A;  2JMI A;  1Z60 A;  2YQL A;  3KNV A;  1WGM A;  3ZPV E;  3ZPV 1;  1HYJ A;  2G45 A;  2K1J A;  4AUQ B;  2G43 A;  4L7X A;  5DIN A;  1WEN A;  1WEM A;  2EA6 A;  2LGG A;  3PUQ A;  3L1Z B;  2FSA A;  2CKL B;  2LXP C;  2LRI C;  5EYA F;  1E4U A;  2F42 A;  2RSD A;  1BOR A;  4LLB A;  2KWO A;  2YW8 A;  3ZVZ B;  2OXQ C;  2E6R A;  2VJE B;  4PTB A;  1XWH A;  4O64 A;  1JM7 B;  4CA1 A;  2MUM A;  2KR4 A;  2BAY A;  3U5P A;  4GNG A;  4L58 A;  3M62 A;  5G04 B;  4QF2 A;  5C11 A;  5C13 A;  3EB6 A;  2KGG A;  2JMD A;  3C5K A;  2L80 A;  4B7Y C;  2Y1N A;  1WIM A;  2K4D A;  2YSJ A;  3LQH A;  3U5M A;  3FL2 A;  4ZUX U;  1MM3 A;  2ECW A;  2CKL A;  2AN6 A;  5B8D A;  2L0B A;  2FUU A;  2L75 A;  2LN0 A;  2MA6 A;  5H1V A;  5TDW A;  3O37 A;  4BBQ A;  3KQI A;  1V87 A;  2VJE A;  3PHD A;  4YAT A;  4LK9 A;  4C9Z A;  1JM7 A;  2YSM A;  1F62 A;  1X4U A;  3N9Q A;  2KRE A;  2YUC A;  4R2Y A;  5LCW B;  4AP4 A;  4MVT A;  4LAD B;  2VPB A;  3HCU A;  1FBV A;  3M63 A;  5AIU A;  5FER A;  4A4B A;  1G25 A;  4AVX A;  3GV4 A;  5LKU A;  2RI7 A;  4GNF A;  4I7B A;  4YAD A;  2L5U A;  5G0F A;  2ZET C;  2ECI A;  2KYU A;  1N87 A;  4YBM A;  2MNZ A;  1MM2 A;  2YHN A;  4TKP B;  1X4J A;  1RMD A;  2JMJ A;  2XEU A;  2ECV A;  3ZNI A;  3LQI A;  4FJC A;  5G05 B;  2UZG A;  2MNY A;  4QF3 A;  1IYM A;  4ZDT A;  2LQ6 A;  1DVP A;  4LKA A;  2M1R A;  2IDA A;  5B75 A;  4GB0 A;  4LJN A;  4I7D A;  3KV5 A;  3O70 A;  3L11 A;  3ASL A;  2YU4 A;  2XB1 A;  3RPG C;  4BHW A;  3N9L A;  3I2D A;  4A4C A;  3N9N A;  2KIZ A;  5I3L A;  1VD4 A;  2G6Q A;  1WEW A;  3NG2 A;  5FB0 A;  5FB1 A;  4V3L C;  1U6G B;  1ZBD B;  2CSY A;  1VFY A;  2MD7 B;  5D1M B;  2H0D B;  5B79 A;  2LV9 A;  1HYI A;  4YAB A;  1WEP A;  1LDK C;  4UP0 A;  1WFK A;  5J3X A;  5B78 A;  2I50 A;  3U5O A;  1K2F A;  1X4I A;  4YBT A;  3O34 A;  4A49 A;  2QJ0 A;  4R7E A;  1T1H A;  1WE9 A;  5B76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...