3C6WA

Crystal structure of the ing5 phd finger in complex with h3k4me3 peptide
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
51
structure length
51
Chain Sequence
EPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Inhibitor of growth protein 5
publication title The crystal structure of the ING5 PHD finger in complex with an H3K4me3 histone peptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 51
sequence length 51
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3c6wA00
2C2LA 4MSXA 2FUUA 3U5NA 3GV4A 4Q6FA 1X4IA 2KU3A 2KIZA 2KWNA 1WENA 5H9MA 2YYRA 4YC9A 4GNGA 1WEMA 5LKZA 2KWJA 2MD8C 4S3OC 2KGGA 1WEQA 5LKXA 5AITA 3IHPA 4O64A 5AIUA 3I2DA 4FK5A 3O35A 3O70A 4BHWA 3PUQA 4YBMA 2ECVA 3NG2A 3ASLA 2ZETC 5D1LB 2K17A 2F6NA 4GB0A 2VNFA 4WZ0A 2LGVA 4LK9A 3ZPVE 4WA6A 4S3OB 4AVXA 2EA6A 2JMIA 5B8DA 5C13A 5TBNA 3PURA 2MA6A 2Y1MA 2L75A 5D1MB 3N9MA 2KYUA 1WEPA 4L58A 4LKAA 2KREA 4ZQLA 2YSMA 4R8PK 2EODA 2KE1A 1U6GB 3ZTGA 1Z2QA 3ZVYA 1WESA 2MUMA 5G05B 4CA1A 2BAYA 1RMDA 2KWOA 3O36A 3M62A 1X4JA 3RTRB 2F6JA 4V3KC 5B78A 3HCSA 5DKAA 1WFKA 4NN2A 3MHHA 4FIPA 3SHBA 3N9OA 1T1HA 4L7XA 3O33A 2L5UA 1IYMA 5EYAF 4V3LC 2ECIA 2LQ6A 4ZUXU 1WILA 2CT2A 2K1JA 3HTKC 3LQIA 1LDKC 1JOCA 2LDRA 2YU4A 4YBSA 5I3LA 2QIZA 2F42A 1X4UA 2QJ0A 4PPEA 4QF2A 4R7EA 4MVTA 4B7YC 3DQVR 2YT5A 3SOXA 2K4DA 2VJEB 4LADB 1WGMA 1WIMA 4X3GA 1ZBDB 4I7CA 2DX8A 2FUIA 1FBVA 2PUYA 2VPGA 2MIQA 2VJFB 3O34A 2VP7A 5TRBA 5B76A 3V43A 2H0DB 5B79A 5C11A 2XB1A 4UP0A 3EB6A 1WEEA 1V87A 5DINA 4IC2A 3U5PA 2KWKA 5H1TA 1Z6UA 2AN6A 5LKTA 2M85A 2FSAA 1MM2A 2VPBA 4BBQA 5FB1A 1WEVA 4AYCB 2KGIA 4FO9A 4YAXA 4WZ3B 2YQMA 2NAAA 4B86C 2LXPC 4I7BA 3ZNIA 3U5OA 3VK6A 3GL6A 3QZVA 4N4FA 2ECJA 3RPGC 3KNVA 3LRQA 2G6QA 3T7LA 2VPDA 2E6RA 3O7AA 1FP0A 2ECWA 2ECNA 3L11A 5FERA 2L43A 2Y1NA 2CSYA 3T6RA 2VJEA 5H1VA 1HYJA 4AUQB 1JM7B 2LGKA 3PHDA 1F62A 5FB0A 3ZVZB 3RPGB 2L0BA 4A4BA 1WEWA 2VJFA 4GNEA 2H0DA 4AP4A 4GNDA 2JRJA 3KQIA 5TABA 4LJNA 2JMJA 2IDAA 4A0CD 2MA5A 1VYXA 5TDWA 2RSDA 2RI7A 4YATA 2MT5A 2C2VS 4AYCA 4YABA 2YREA 3L1XA 3LQHA 2KR4A 2CKLB 1WEOA 2LV9A 1Z60A 3SOUA 2MNZA 3MHSA 5H1UA 3KV5A 4R2YA 2L80A 2YSJA 3N9NA 5FEYA 2HYED 2MD7B 1G25A 2YW8A 4UP5A 4CCGX 4XI1A 4P5OB 1E4UA 3L1ZB 4UI9B 3KV6A 2G45A 4I7DA 1LDJB 1WEUA 2QICA 5J3XA 3C5KA 2ECGA 5KH9A 2JMDA 5JG6A 2EGPA 5G04B 2I50A 2D8SA 2XEUA 2K16A 2Y43A 3LQJA 1BORA 2M6MA 1JM7A 3ZPV1 3DPLR 3N9PA 5TDRA 5B75A 3SOWA 3ZYQA 2CSZA 4YADA 4A4CA 1HYIA 2LXHC 3FL2A 4IC3A 1XWHA 3HCTA 4C9ZA 2LGLA 3M63A 1VFYA 2M1RA 2HDPA 2G43A 2M3HA 5LKUA 2E6SA 4FJCA 5KH3A 5G0FA 3HCUA 3C6WA 4PTBA 5D1KB 2LRIC 2UZGA 1K2FA 4QF3A 2OXQC 2PNXA 2KFTA 1N87A 2CKLA 4WZ2A 4TKPB 3EB5A 4LLBA 4ZDTA 2ECTA 3U5MA 3O37A 3N9QA 5B77A 4F52B 2VPEA 1MM3A 2YHOA 2LGGA 4W4UA 2YUCA 2YURA 3N9LA 4YBTA 4GNFA 1VD4A 2LN0A 1WE9A 4N3WA 2MNYA 2YQLA 1DVPA 4A49A 5KH7A 1CHCA 5LCWB 2YHNA 3M99A
chains in the Genus database with same CATH superfamily
2C2LA 2OWAA 4QQ4A 2CRRA 4MSXA 1DCQA 2EXUA 3T9KA 2FUUA 3U5NA 3GV4A 4Q6FA 1X4IA 2KU3A 2KIZA 2KWNA 1WENA 5H9MA 2YYRA 4YC9A 2FD4A 4GNGA 2XOCA 1WEMA 5LKZA 3MDBC 2KWJA 2MD8C 4S3OC 2KGGA 1WEQA 5LKXA 2M13A 5AITA 3IHPA 4O64A 3FANA 5AIUA 3I2DA 4FK5A 3O35A 3O70A 4BHWA 3PUQA 4YBMA 2ECVA 3NG2A 3ASLA 2ZETC 5D1LB 2K17A 2F6NA 4GB0A 2VNFA 2JUNA 4WZ0A 2LGVA 4LK9A 3ZPVE 4WA6A 4S3OB 4AVXA 3DDTA 2EA6A 2JMIA 5B8DA 5C13A 5TBNA 3PURA 2MA6A 2Y1MA 4O62A 2L75A 5D1MB 3N9MA 2KYUA 5K3QA 1WEPA 4L58A 4LKAA 2KREA 4ZQLA 2YSMA 3LJUX 4R8PK 2EODA 4OGCA 2KE1A 1U6GB 2LAUA 3ZTGA 1Z2QA 3ZVYA 1WESA 2MUMA 5G05B 4CA1A 3KDEC 2BAYA 1RMDA 2KWOA 3O36A 3M62A 3FAOA 1X4JA 3RTRB 2F6JA 4V3KC 5B78A 3HCSA 5DKAA 1WFKA 4NN2A 3MHHA 4FIPA 3SHBA 3N9OA 1T1HA 2IQJA 4L7XA 3O33A 2L5UA 1IYMA 5EYAF 4V3LC 2ECIA 2LQ6A 4ZUXU 1WILA 2CT2A 2K1JA 3HTKC 3LQIA 1LDKC 1JOCA 2LDRA 2YU4A 4YBSA 5I3LA 2L7PA 2KKYA 2QIZA 2F42A 1X4UA 2QJ0A 4PPEA 4QF2A 4R7EA 4MVTA 4B7YC 3DQVR 2YT5A 3SOXA 2K4DA 2VJEB 4LADB 1WGMA 1WIMA 4X3GA 1MBMA 1ZBDB 4I7CA 2DX8A 2FUIA 1FBVA 3M7KA 2PUYA 2VPGA 3LVQE 5SVXA 2MIQA 2VJFB 2D8UA 3O34A 2VP7A 5TRBA 5B76A 3V43A 2H0DB 5B79A 5C11A 2XB1A 4UP0A 3EB6A 1WEEA 1V87A 5DINA 4IC2A 3U5PA 2KWKA 5H1TA 4H9DA 2XOZA 5SVYA 1Z6UA 2AN6A 5LKTA 2M85A 2FSAA 1MM2A 2XOYA 2VPBA 2KKXA 4BBQA 5FB1A 1WEVA 4AYCB 2KGIA 4FO9A 4YAXA 4WZ3B 2YQMA 2NAAA 5SVIB 4B86C 2LXPC 4I7BA 3ZNIA 3U5OA 3VK6A 3GL6A 3QZVA 4N4FA 2P57A 2ECJA 3RPGC 3KNVA 3LRQA 2G6QA 3T7LA 2VPDA 2E6RA 3O7AA 1FP0A 2ECWA 2ECNA 3L11A 5FERA 2L43A 2Y1NA 2CSYA 3T6RA 2VJEA 4Z0RA 5H1VA 3PLWA 1HYJA 4AUQB 1JM7B 2LGKA 3PHDA 1F62A 5FB0A 3ZVZB 3RPGB 2L0BA 4A4BA 1WEWA 2VJFA 3FEHA 2DSMA 4GNEA 2H0DA 4AP4A 4GNDA 2JRJA 3KQIA 5TABA 4LJNA 2FFWA 2JMJA 2IDAA 2MKEA 4A0CD 2MA5A 1VYXA 5TDWA 2RSDA 2CSVA 2RI7A 4YATA 2MT5A 2JM3A 2C2VS 4AYCA 4YABA 2YREA 3L1XA 3LQHA 2KR4A 2CKLB 1WEOA 2LV9A 1Z60A 3SOUA 5SVIA 2MNZA 3MHSA 5H1UA 3KV5A 3DWDA 3O47A 4R2YA 2L80A 2YSJA 3N9NA 5FEYA 3FJUB 2HYED 4Z0OA 2MD7B 1G25A 2YW8A 4UP5A 4CCGX 4XI1A 4P5OB 1E4UA 3L1ZB 4UI9B 3KV6A 2G45A 2B0OE 4I7DA 1LDJB 1WEUA 2QICA 5J3XA 3C5KA 2ECGA 5KH9A 3FM8C 2JMDA 5JG6A 2EGPA 4F1PA 5G04B 2I50A 2D8SA 2XEUA 2K16A 2Y43A 3LQJA 2RR4A 1BORA 2M6MA 1JM7A 3ZPV1 3DPLR 3N9PA 5TDRA 5B75A 3SOWA 3ZYQA 2CSZA 4YADA 4A4CA 1HYIA 2LXHC 3FL2A 4IC3A 3SUBA 1XWHA 3HCTA 4C9ZA 2LGLA 3M63A 1VFYA 3LDYA 2M1RA 2HDPA 2G43A 2M3HA 5LKUA 2E6SA 4FJCA 5KH3A 5G0FA 3HCUA 3C6WA 4PTBA 5D1KB 2LRIC 2UZGA 1K2FA 3Q1DA 4QF3A 2OXQC 2PNXA 2KFTA 1N87A 2CKLA 2CRWA 4WZ2A 4TKPB 2EGMA 3H7HA 4LLBA 2XP0A 3EB5A 4ZDTA 2ECTA 3U5MA 3O37A 3LVRE 3N9QA 5B77A 4F52B 2VPEA 1MM3A 2DJAA 2YHOA 2LGGA 4W4UA 2YUCA 2YURA 3N9LA 4YBTA 4OGEA 4GNFA 1VD4A 2E61A 2LN0A 1WE9A 4N3WA 3JUEA 2MNYA 2YQLA 1DVPA 4A49A 5KH7A 1CHCA 2YVRA 5LCWB 3E2DA 2CONA 2YHNA 3M99A
chains in the Genus database with same CATH topology
2C2LA 4MSXA 2FUUA 3U5NA 3GV4A 4Q6FA 1X4IA 2KU3A 2KIZA 2KWNA 1WENA 5H9MA 2YYRA 4YC9A 4GNGA 1WEMA 5LKZA 2KWJA 2MD8C 4S3OC 2KGGA 1WEQA 5LKXA 5AITA 3IHPA 4O64A 5AIUA 3I2DA 4FK5A 3O35A 3O70A 4BHWA 3PUQA 4YBMA 2ECVA 3NG2A 3ASLA 2ZETC 5D1LB 2K17A 2F6NA 4GB0A 2VNFA 4WZ0A 2LGVA 4LK9A 3ZPVE 4WA6A 4S3OB 4AVXA 2EA6A 2JMIA 5B8DA 5C13A 5TBNA 3PURA 2MA6A 2Y1MA 2L75A 5D1MB 3N9MA 2KYUA 1WEPA 4L58A 4LKAA 2KREA 4ZQLA 2YSMA 4R8PK 2EODA 2KE1A 1U6GB 3ZTGA 1Z2QA 3ZVYA 1WESA 2MUMA 5G05B 4CA1A 2BAYA 1RMDA 2KWOA 3O36A 3M62A 1X4JA 3RTRB 2F6JA 4V3KC 5B78A 3HCSA 5DKAA 1WFKA 4NN2A 3MHHA 4FIPA 3SHBA 3N9OA 1T1HA 4L7XA 3O33A 2L5UA 1IYMA 5EYAF 4V3LC 2ECIA 2LQ6A 4ZUXU 1WILA 2CT2A 2K1JA 3HTKC 3LQIA 1LDKC 1JOCA 2LDRA 2YU4A 4YBSA 5I3LA 2QIZA 2F42A 1X4UA 2QJ0A 4PPEA 4QF2A 4R7EA 4MVTA 4B7YC 3DQVR 2YT5A 3SOXA 2K4DA 2VJEB 4LADB 1WGMA 1WIMA 4X3GA 1ZBDB 4I7CA 2DX8A 2FUIA 1FBVA 2PUYA 2VPGA 2MIQA 2VJFB 3O34A 2VP7A 5TRBA 5B76A 3V43A 2H0DB 5B79A 5C11A 2XB1A 4UP0A 3EB6A 1WEEA 1V87A 5DINA 4IC2A 3U5PA 2KWKA 5H1TA 1Z6UA 2AN6A 5LKTA 2M85A 2FSAA 1MM2A 2VPBA 4BBQA 5FB1A 1WEVA 4AYCB 2KGIA 4FO9A 4YAXA 4WZ3B 2YQMA 2NAAA 4B86C 2LXPC 4I7BA 3ZNIA 3U5OA 3VK6A 3GL6A 3QZVA 4N4FA 2ECJA 3RPGC 3KNVA 3LRQA 2G6QA 3T7LA 2VPDA 2E6RA 3O7AA 1FP0A 2ECWA 2ECNA 3L11A 5FERA 2L43A 2Y1NA 2CSYA 3T6RA 2VJEA 5H1VA 1HYJA 4AUQB 1JM7B 2LGKA 3PHDA 1F62A 5FB0A 3ZVZB 3RPGB 2L0BA 4A4BA 1WEWA 2VJFA 4GNEA 2H0DA 4AP4A 4GNDA 2JRJA 3KQIA 5TABA 4LJNA 2JMJA 2IDAA 4A0CD 2MA5A 1VYXA 5TDWA 2RSDA 2RI7A 4YATA 2MT5A 2C2VS 4AYCA 4YABA 2YREA 3L1XA 3LQHA 2KR4A 2CKLB 1WEOA 2LV9A 1Z60A 3SOUA 2MNZA 3MHSA 5H1UA 3KV5A 4R2YA 2L80A 2YSJA 3N9NA 5FEYA 2HYED 2MD7B 1G25A 2YW8A 4UP5A 4CCGX 4XI1A 4P5OB 1E4UA 3L1ZB 4UI9B 3KV6A 2G45A 4I7DA 1LDJB 1WEUA 2QICA 5J3XA 3C5KA 2ECGA 5KH9A 2JMDA 5JG6A 2EGPA 5G04B 2I50A 2D8SA 2XEUA 2K16A 2Y43A 3LQJA 1BORA 2M6MA 1JM7A 3ZPV1 3DPLR 3N9PA 5TDRA 5B75A 3SOWA 3ZYQA 2CSZA 4YADA 4A4CA 1HYIA 2LXHC 3FL2A 4IC3A 1XWHA 3HCTA 4C9ZA 2LGLA 3M63A 1VFYA 2M1RA 2HDPA 2G43A 2M3HA 5LKUA 2E6SA 4FJCA 5KH3A 5G0FA 3HCUA 3C6WA 4PTBA 5D1KB 2LRIC 2UZGA 1K2FA 4QF3A 2OXQC 2PNXA 2KFTA 1N87A 2CKLA 4WZ2A 4TKPB 3EB5A 4LLBA 4ZDTA 2ECTA 3U5MA 3O37A 3N9QA 5B77A 4F52B 2VPEA 1MM3A 2YHOA 2LGGA 4W4UA 2YUCA 2YURA 3N9LA 4YBTA 4GNFA 1VD4A 2LN0A 1WE9A 4N3WA 2MNYA 2YQLA 1DVPA 4A49A 5KH7A 1CHCA 5LCWB 2YHNA 3M99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2L A;  4MSX A;  2FUU A;  3U5N A;  3GV4 A;  4Q6F A;  1X4I A;  2KU3 A;  2KIZ A;  2KWN A;  1WEN A;  5H9M A;  2YYR A;  4YC9 A;  4GNG A;  1WEM A;  5LKZ A;  2KWJ A;  2MD8 C;  4S3O C;  2KGG A;  1WEQ A;  5LKX A;  5AIT A;  3IHP A;  4O64 A;  5AIU A;  3I2D A;  4FK5 A;  3O35 A;  3O70 A;  4BHW A;  3PUQ A;  4YBM A;  2ECV A;  3NG2 A;  3ASL A;  2ZET C;  5D1L B;  2K17 A;  2F6N A;  4GB0 A;  2VNF A;  4WZ0 A;  2LGV A;  4LK9 A;  3ZPV E;  4WA6 A;  4S3O B;  4AVX A;  2EA6 A;  2JMI A;  5B8D A;  5C13 A;  5TBN A;  3PUR A;  2MA6 A;  2Y1M A;  2L75 A;  5D1M B;  3N9M A;  2KYU A;  1WEP A;  4L58 A;  4LKA A;  2KRE A;  4ZQL A;  2YSM A;  4R8P K;  2EOD A;  2KE1 A;  1U6G B;  3ZTG A;  1Z2Q A;  3ZVY A;  1WES A;  2MUM A;  5G05 B;  4CA1 A;  2BAY A;  1RMD A;  2KWO A;  3O36 A;  3M62 A;  1X4J A;  3RTR B;  2F6J A;  4V3K C;  5B78 A;  3HCS A;  5DKA A;  1WFK A;  4NN2 A;  3MHH A;  4FIP A;  3SHB A;  3N9O A;  1T1H A;  4L7X A;  3O33 A;  2L5U A;  1IYM A;  5EYA F;  4V3L C;  2ECI A;  2LQ6 A;  4ZUX U;  1WIL A;  2CT2 A;  2K1J A;  3HTK C;  3LQI A;  1LDK C;  1JOC A;  2LDR A;  2YU4 A;  4YBS A;  5I3L A;  2QIZ A;  2F42 A;  1X4U A;  2QJ0 A;  4PPE A;  4QF2 A;  4R7E A;  4MVT A;  4B7Y C;  3DQV R;  2YT5 A;  3SOX A;  2K4D A;  2VJE B;  4LAD B;  1WGM A;  1WIM A;  4X3G A;  1ZBD B;  4I7C A;  2DX8 A;  2FUI A;  1FBV A;  2PUY A;  2VPG A;  2MIQ A;  2VJF B;  3O34 A;  2VP7 A;  5TRB A;  5B76 A;  3V43 A;  2H0D B;  5B79 A;  5C11 A;  2XB1 A;  4UP0 A;  3EB6 A;  1WEE A;  1V87 A;  5DIN A;  4IC2 A;  3U5P A;  2KWK A;  5H1T A;  1Z6U A;  2AN6 A;  5LKT A;  2M85 A;  2FSA A;  1MM2 A;  2VPB A;  4BBQ A;  5FB1 A;  1WEV A;  4AYC B;  2KGI A;  4FO9 A;  4YAX A;  4WZ3 B;  2YQM A;  2NAA A;  4B86 C;  2LXP C;  4I7B A;  3ZNI A;  3U5O A;  3VK6 A;  3GL6 A;  3QZV A;  4N4F A;  2ECJ A;  3RPG C;  3KNV A;  3LRQ A;  2G6Q A;  3T7L A;  2VPD A;  2E6R A;  3O7A A;  1FP0 A;  2ECW A;  2ECN A;  3L11 A;  5FER A;  2L43 A;  2Y1N A;  2CSY A;  3T6R A;  2VJE A;  5H1V A;  1HYJ A;  4AUQ B;  1JM7 B;  2LGK A;  3PHD A;  1F62 A;  5FB0 A;  3ZVZ B;  3RPG B;  2L0B A;  4A4B A;  1WEW A;  2VJF A;  4GNE A;  2H0D A;  4AP4 A;  4GND A;  2JRJ A;  3KQI A;  5TAB A;  4LJN A;  2JMJ A;  2IDA A;  4A0C D;  2MA5 A;  1VYX A;  5TDW A;  2RSD A;  2RI7 A;  4YAT A;  2MT5 A;  2C2V S;  4AYC A;  4YAB A;  2YRE A;  3L1X A;  3LQH A;  2KR4 A;  2CKL B;  1WEO A;  2LV9 A;  1Z60 A;  3SOU A;  2MNZ A;  3MHS A;  5H1U A;  3KV5 A;  4R2Y A;  2L80 A;  2YSJ A;  3N9N A;  5FEY A;  2HYE D;  2MD7 B;  1G25 A;  2YW8 A;  4UP5 A;  4CCG X;  4XI1 A;  4P5O B;  1E4U A;  3L1Z B;  4UI9 B;  3KV6 A;  2G45 A;  4I7D A;  1LDJ B;  1WEU A;  2QIC A;  5J3X A;  3C5K A;  2ECG A;  5KH9 A;  2JMD A;  5JG6 A;  2EGP A;  5G04 B;  2I50 A;  2D8S A;  2XEU A;  2K16 A;  2Y43 A;  3LQJ A;  1BOR A;  2M6M A;  1JM7 A;  3ZPV 1;  3DPL R;  3N9P A;  5TDR A;  5B75 A;  3SOW A;  3ZYQ A;  2CSZ A;  4YAD A;  4A4C A;  1HYI A;  2LXH C;  3FL2 A;  4IC3 A;  1XWH A;  3HCT A;  4C9Z A;  2LGL A;  3M63 A;  1VFY A;  2M1R A;  2HDP A;  2G43 A;  2M3H A;  5LKU A;  2E6S A;  4FJC A;  5KH3 A;  5G0F A;  3HCU A;  3C6W A;  4PTB A;  5D1K B;  2LRI C;  2UZG A;  1K2F A;  4QF3 A;  2OXQ C;  2PNX A;  2KFT A;  1N87 A;  2CKL A;  4WZ2 A;  4TKP B;  3EB5 A;  4LLB A;  4ZDT A;  2ECT A;  3U5M A;  3O37 A;  3N9Q A;  5B77 A;  4F52 B;  2VPE A;  1MM3 A;  2YHO A;  2LGG A;  4W4U A;  2YUC A;  2YUR A;  3N9L A;  4YBT A;  4GNF A;  1VD4 A;  2LN0 A;  1WE9 A;  4N3W A;  2MNY A;  2YQL A;  1DVP A;  4A49 A;  5KH7 A;  1CHC A;  5LCW B;  2YHN A;  3M99 A; 
#chains in the Genus database with same CATH topology
 2C2L A;  2OWA A;  4QQ4 A;  2CRR A;  4MSX A;  1DCQ A;  2EXU A;  3T9K A;  2FUU A;  3U5N A;  3GV4 A;  4Q6F A;  1X4I A;  2KU3 A;  2KIZ A;  2KWN A;  1WEN A;  5H9M A;  2YYR A;  4YC9 A;  2FD4 A;  4GNG A;  2XOC A;  1WEM A;  5LKZ A;  3MDB C;  2KWJ A;  2MD8 C;  4S3O C;  2KGG A;  1WEQ A;  5LKX A;  2M13 A;  5AIT A;  3IHP A;  4O64 A;  3FAN A;  5AIU A;  3I2D A;  4FK5 A;  3O35 A;  3O70 A;  4BHW A;  3PUQ A;  4YBM A;  2ECV A;  3NG2 A;  3ASL A;  2ZET C;  5D1L B;  2K17 A;  2F6N A;  4GB0 A;  2VNF A;  2JUN A;  4WZ0 A;  2LGV A;  4LK9 A;  3ZPV E;  4WA6 A;  4S3O B;  4AVX A;  3DDT A;  2EA6 A;  2JMI A;  5B8D A;  5C13 A;  5TBN A;  3PUR A;  2MA6 A;  2Y1M A;  4O62 A;  2L75 A;  5D1M B;  3N9M A;  2KYU A;  5K3Q A;  1WEP A;  4L58 A;  4LKA A;  2KRE A;  4ZQL A;  2YSM A;  3LJU X;  4R8P K;  2EOD A;  4OGC A;  2KE1 A;  1U6G B;  2LAU A;  3ZTG A;  1Z2Q A;  3ZVY A;  1WES A;  2MUM A;  5G05 B;  4CA1 A;  3KDE C;  2BAY A;  1RMD A;  2KWO A;  3O36 A;  3M62 A;  3FAO A;  1X4J A;  3RTR B;  2F6J A;  4V3K C;  5B78 A;  3HCS A;  5DKA A;  1WFK A;  4NN2 A;  3MHH A;  4FIP A;  3SHB A;  3N9O A;  1T1H A;  2IQJ A;  4L7X A;  3O33 A;  2L5U A;  1IYM A;  5EYA F;  4V3L C;  2ECI A;  2LQ6 A;  4ZUX U;  1WIL A;  2CT2 A;  2K1J A;  3HTK C;  3LQI A;  1LDK C;  1JOC A;  2LDR A;  2YU4 A;  4YBS A;  5I3L A;  2L7P A;  2KKY A;  2QIZ A;  2F42 A;  1X4U A;  2QJ0 A;  4PPE A;  4QF2 A;  4R7E A;  4MVT A;  4B7Y C;  3DQV R;  2YT5 A;  3SOX A;  2K4D A;  2VJE B;  4LAD B;  1WGM A;  1WIM A;  4X3G A;  1MBM A;  1ZBD B;  4I7C A;  2DX8 A;  2FUI A;  1FBV A;  3M7K A;  2PUY A;  2VPG A;  3LVQ E;  5SVX A;  2MIQ A;  2VJF B;  2D8U A;  3O34 A;  2VP7 A;  5TRB A;  5B76 A;  3V43 A;  2H0D B;  5B79 A;  5C11 A;  2XB1 A;  4UP0 A;  3EB6 A;  1WEE A;  1V87 A;  5DIN A;  4IC2 A;  3U5P A;  2KWK A;  5H1T A;  4H9D A;  2XOZ A;  5SVY A;  1Z6U A;  2AN6 A;  5LKT A;  2M85 A;  2FSA A;  1MM2 A;  2XOY A;  2VPB A;  2KKX A;  4BBQ A;  5FB1 A;  1WEV A;  4AYC B;  2KGI A;  4FO9 A;  4YAX A;  4WZ3 B;  2YQM A;  2NAA A;  5SVI B;  4B86 C;  2LXP C;  4I7B A;  3ZNI A;  3U5O A;  3VK6 A;  3GL6 A;  3QZV A;  4N4F A;  2P57 A;  2ECJ A;  3RPG C;  3KNV A;  3LRQ A;  2G6Q A;  3T7L A;  2VPD A;  2E6R A;  3O7A A;  1FP0 A;  2ECW A;  2ECN A;  3L11 A;  5FER A;  2L43 A;  2Y1N A;  2CSY A;  3T6R A;  2VJE A;  4Z0R A;  5H1V A;  3PLW A;  1HYJ A;  4AUQ B;  1JM7 B;  2LGK A;  3PHD A;  1F62 A;  5FB0 A;  3ZVZ B;  3RPG B;  2L0B A;  4A4B A;  1WEW A;  2VJF A;  3FEH A;  2DSM A;  4GNE A;  2H0D A;  4AP4 A;  4GND A;  2JRJ A;  3KQI A;  5TAB A;  4LJN A;  2FFW A;  2JMJ A;  2IDA A;  2MKE A;  4A0C D;  2MA5 A;  1VYX A;  5TDW A;  2RSD A;  2CSV A;  2RI7 A;  4YAT A;  2MT5 A;  2JM3 A;  2C2V S;  4AYC A;  4YAB A;  2YRE A;  3L1X A;  3LQH A;  2KR4 A;  2CKL B;  1WEO A;  2LV9 A;  1Z60 A;  3SOU A;  5SVI A;  2MNZ A;  3MHS A;  5H1U A;  3KV5 A;  3DWD A;  3O47 A;  4R2Y A;  2L80 A;  2YSJ A;  3N9N A;  5FEY A;  3FJU B;  2HYE D;  4Z0O A;  2MD7 B;  1G25 A;  2YW8 A;  4UP5 A;  4CCG X;  4XI1 A;  4P5O B;  1E4U A;  3L1Z B;  4UI9 B;  3KV6 A;  2G45 A;  2B0O E;  4I7D A;  1LDJ B;  1WEU A;  2QIC A;  5J3X A;  3C5K A;  2ECG A;  5KH9 A;  3FM8 C;  2JMD A;  5JG6 A;  2EGP A;  4F1P A;  5G04 B;  2I50 A;  2D8S A;  2XEU A;  2K16 A;  2Y43 A;  3LQJ A;  2RR4 A;  1BOR A;  2M6M A;  1JM7 A;  3ZPV 1;  3DPL R;  3N9P A;  5TDR A;  5B75 A;  3SOW A;  3ZYQ A;  2CSZ A;  4YAD A;  4A4C A;  1HYI A;  2LXH C;  3FL2 A;  4IC3 A;  3SUB A;  1XWH A;  3HCT A;  4C9Z A;  2LGL A;  3M63 A;  1VFY A;  3LDY A;  2M1R A;  2HDP A;  2G43 A;  2M3H A;  5LKU A;  2E6S A;  4FJC A;  5KH3 A;  5G0F A;  3HCU A;  3C6W A;  4PTB A;  5D1K B;  2LRI C;  2UZG A;  1K2F A;  3Q1D A;  4QF3 A;  2OXQ C;  2PNX A;  2KFT A;  1N87 A;  2CKL A;  2CRW A;  4WZ2 A;  4TKP B;  2EGM A;  3H7H A;  4LLB A;  2XP0 A;  3EB5 A;  4ZDT A;  2ECT A;  3U5M A;  3O37 A;  3LVR E;  3N9Q A;  5B77 A;  4F52 B;  2VPE A;  1MM3 A;  2DJA A;  2YHO A;  2LGG A;  4W4U A;  2YUC A;  2YUR A;  3N9L A;  4YBT A;  4OGE A;  4GNF A;  1VD4 A;  2E61 A;  2LN0 A;  1WE9 A;  4N3W A;  3JUE A;  2MNY A;  2YQL A;  1DVP A;  4A49 A;  5KH7 A;  1CHC A;  2YVR A;  5LCW B;  3E2D A;  2CON A;  2YHN A;  3M99 A; 
#chains in the Genus database with same CATH homology
 2C2L A;  4MSX A;  2FUU A;  3U5N A;  3GV4 A;  4Q6F A;  1X4I A;  2KU3 A;  2KIZ A;  2KWN A;  1WEN A;  5H9M A;  2YYR A;  4YC9 A;  4GNG A;  1WEM A;  5LKZ A;  2KWJ A;  2MD8 C;  4S3O C;  2KGG A;  1WEQ A;  5LKX A;  5AIT A;  3IHP A;  4O64 A;  5AIU A;  3I2D A;  4FK5 A;  3O35 A;  3O70 A;  4BHW A;  3PUQ A;  4YBM A;  2ECV A;  3NG2 A;  3ASL A;  2ZET C;  5D1L B;  2K17 A;  2F6N A;  4GB0 A;  2VNF A;  4WZ0 A;  2LGV A;  4LK9 A;  3ZPV E;  4WA6 A;  4S3O B;  4AVX A;  2EA6 A;  2JMI A;  5B8D A;  5C13 A;  5TBN A;  3PUR A;  2MA6 A;  2Y1M A;  2L75 A;  5D1M B;  3N9M A;  2KYU A;  1WEP A;  4L58 A;  4LKA A;  2KRE A;  4ZQL A;  2YSM A;  4R8P K;  2EOD A;  2KE1 A;  1U6G B;  3ZTG A;  1Z2Q A;  3ZVY A;  1WES A;  2MUM A;  5G05 B;  4CA1 A;  2BAY A;  1RMD A;  2KWO A;  3O36 A;  3M62 A;  1X4J A;  3RTR B;  2F6J A;  4V3K C;  5B78 A;  3HCS A;  5DKA A;  1WFK A;  4NN2 A;  3MHH A;  4FIP A;  3SHB A;  3N9O A;  1T1H A;  4L7X A;  3O33 A;  2L5U A;  1IYM A;  5EYA F;  4V3L C;  2ECI A;  2LQ6 A;  4ZUX U;  1WIL A;  2CT2 A;  2K1J A;  3HTK C;  3LQI A;  1LDK C;  1JOC A;  2LDR A;  2YU4 A;  4YBS A;  5I3L A;  2QIZ A;  2F42 A;  1X4U A;  2QJ0 A;  4PPE A;  4QF2 A;  4R7E A;  4MVT A;  4B7Y C;  3DQV R;  2YT5 A;  3SOX A;  2K4D A;  2VJE B;  4LAD B;  1WGM A;  1WIM A;  4X3G A;  1ZBD B;  4I7C A;  2DX8 A;  2FUI A;  1FBV A;  2PUY A;  2VPG A;  2MIQ A;  2VJF B;  3O34 A;  2VP7 A;  5TRB A;  5B76 A;  3V43 A;  2H0D B;  5B79 A;  5C11 A;  2XB1 A;  4UP0 A;  3EB6 A;  1WEE A;  1V87 A;  5DIN A;  4IC2 A;  3U5P A;  2KWK A;  5H1T A;  1Z6U A;  2AN6 A;  5LKT A;  2M85 A;  2FSA A;  1MM2 A;  2VPB A;  4BBQ A;  5FB1 A;  1WEV A;  4AYC B;  2KGI A;  4FO9 A;  4YAX A;  4WZ3 B;  2YQM A;  2NAA A;  4B86 C;  2LXP C;  4I7B A;  3ZNI A;  3U5O A;  3VK6 A;  3GL6 A;  3QZV A;  4N4F A;  2ECJ A;  3RPG C;  3KNV A;  3LRQ A;  2G6Q A;  3T7L A;  2VPD A;  2E6R A;  3O7A A;  1FP0 A;  2ECW A;  2ECN A;  3L11 A;  5FER A;  2L43 A;  2Y1N A;  2CSY A;  3T6R A;  2VJE A;  5H1V A;  1HYJ A;  4AUQ B;  1JM7 B;  2LGK A;  3PHD A;  1F62 A;  5FB0 A;  3ZVZ B;  3RPG B;  2L0B A;  4A4B A;  1WEW A;  2VJF A;  4GNE A;  2H0D A;  4AP4 A;  4GND A;  2JRJ A;  3KQI A;  5TAB A;  4LJN A;  2JMJ A;  2IDA A;  4A0C D;  2MA5 A;  1VYX A;  5TDW A;  2RSD A;  2RI7 A;  4YAT A;  2MT5 A;  2C2V S;  4AYC A;  4YAB A;  2YRE A;  3L1X A;  3LQH A;  2KR4 A;  2CKL B;  1WEO A;  2LV9 A;  1Z60 A;  3SOU A;  2MNZ A;  3MHS A;  5H1U A;  3KV5 A;  4R2Y A;  2L80 A;  2YSJ A;  3N9N A;  5FEY A;  2HYE D;  2MD7 B;  1G25 A;  2YW8 A;  4UP5 A;  4CCG X;  4XI1 A;  4P5O B;  1E4U A;  3L1Z B;  4UI9 B;  3KV6 A;  2G45 A;  4I7D A;  1LDJ B;  1WEU A;  2QIC A;  5J3X A;  3C5K A;  2ECG A;  5KH9 A;  2JMD A;  5JG6 A;  2EGP A;  5G04 B;  2I50 A;  2D8S A;  2XEU A;  2K16 A;  2Y43 A;  3LQJ A;  1BOR A;  2M6M A;  1JM7 A;  3ZPV 1;  3DPL R;  3N9P A;  5TDR A;  5B75 A;  3SOW A;  3ZYQ A;  2CSZ A;  4YAD A;  4A4C A;  1HYI A;  2LXH C;  3FL2 A;  4IC3 A;  1XWH A;  3HCT A;  4C9Z A;  2LGL A;  3M63 A;  1VFY A;  2M1R A;  2HDP A;  2G43 A;  2M3H A;  5LKU A;  2E6S A;  4FJC A;  5KH3 A;  5G0F A;  3HCU A;  3C6W A;  4PTB A;  5D1K B;  2LRI C;  2UZG A;  1K2F A;  4QF3 A;  2OXQ C;  2PNX A;  2KFT A;  1N87 A;  2CKL A;  4WZ2 A;  4TKP B;  3EB5 A;  4LLB A;  4ZDT A;  2ECT A;  3U5M A;  3O37 A;  3N9Q A;  5B77 A;  4F52 B;  2VPE A;  1MM3 A;  2YHO A;  2LGG A;  4W4U A;  2YUC A;  2YUR A;  3N9L A;  4YBT A;  4GNF A;  1VD4 A;  2LN0 A;  1WE9 A;  4N3W A;  2MNY A;  2YQL A;  1DVP A;  4A49 A;  5KH7 A;  1CHC A;  5LCW B;  2YHN A;  3M99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...