1U6GB

Crystal structure of the cand1-cul1-roc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cullin homolog 1
publication title Structure of the Cand1-Cul1-Roc1 complex reveals regulatory mechanisms for the assembly of the multisubunit cullin-dependent ubiquitin ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1u6gB00
5H1TA 2HYED 4AYCB 3U5PA 1WGMA 4A0CD 2LGVA 1LDJB 2MNYA 2MIQA 1HYIA 2CKLB 3VK6A 5J3XA 3QZVA 5B78A 4YBSA 1WEWA 3L11A 3M99A 5TRBA 2JMIA 2QIZA 1FBVA 2MT5A 5FERA 4LADB 5KH7A 2FUIA 2KGGA 5G04B 4GNEA 2VJEB 1X4IA 5H1UA 3O34A 4B86C 1F62A 4YC9A 3O7AA 2RSDA 3LQJA 5AIUA 2G6QA 3EB5A 1WEUA 2UZGA 1WEQA 2LQ6A 2KWJA 4A4BA 2K17A 5LKUA 2ECJA 4FJCA 5LKZA 2CSZA 5B75A 3DQVR 4QF3A 3ZVZB 5I3LA 4S3OC 4IC2A 5LCWB 1JM7A 1Z2QA 2KFTA 5DKAA 3N9QA 4IC3A 1MM3A 5D1KB 2LDRA 2VPDA 1WEMA 4WZ0A 2NAAA 1T1HA 2K4DA 4WA6A 2G43A 3L1ZB 5DINA 4PPEA 2M85A 2FSAA 1BORA 4I7DA 3ZTGA 3U5OA 3KV5A 3N9PA 2KWNA 3N9NA 5B79A 4B7YC 2L5UA 5JG6A 1G25A 4AVXA 2BAYA 2JMJA 2FUUA 2C2VS 4YADA 3O35A 4Q6FA 2VP7A 2DX8A 1FP0A 4ZDTA 1ZBDB 4LK9A 1RMDA 3SHBA 2ECNA 2M3HA 4CCGX 2LN0A 4FO9A 2YW8A 3SOWA 4LLBA 5LKTA 1WIMA 1WILA 2MNZA 1DVPA 1VYXA 2MUMA 2IDAA 2LXPC 2CT2A 1CHCA 5FEYA 2KYUA 2YU4A 2VJFA 2LGGA 2MA6A 2PUYA 3ZPVE 2E6RA 2AN6A 1MM2A 4YATA 4L58A 2YURA 4O64A 2VPGA 4YBTA 2MD8C 2YHNA 4FK5A 5G0FA 3FL2A 2ECWA 1U6GB 2KU3A 3KNVA 2C2LA 4MVTA 3U5NA 3SOUA 2KE1A 1HYJA 2Y43A 4YAXA 2ECGA 4V3KC 4S3OB 2L0BA 3N9OA 4WZ2A 1VD4A 3N9LA 1E4UA 5LKXA 2L43A 2KGIA 4X3GA 2JMDA 1JM7B 2LGKA 4N3WA 3DPLR 2H0DA 1K2FA 3PHDA 3O33A 4PTBA 4CA1A 3HCTA 1WEEA 2YHOA 5H1VA 1V87A 2ECTA 3ZNIA 2K16A 5B8DA 3O70A 5AITA 3PURA 2EGPA 2EA6A 1WESA 4R7EA 3LRQA 1WEOA 2K1JA 3ASLA 4N4FA 3MHHA 4GB0A 3NG2A 5KH3A 4UI9B 2LXHC 1WFKA 2YT5A 2XB1A 3I2DA 1IYMA 2YSMA 4GNGA 2E6SA 2KWKA 4MSXA 4XI1A 2I50A 4C9ZA 5FB1A 2L80A 4AUQB 3LQIA 3MHSA 2JRJA 5B76A 2LGLA 2KR4A 2VPBA 3HTKC 3LQHA 2Y1NA 2KREA 2LV9A 4V3LC 3ZYQA 2QICA 4QF2A 2F6NA 3O36A 2VJFB 4BBQA 1WENA 3M63A 5C13A 2LRIC 4R2YA 5C11A 3V43A 4YBMA 5KH9A 1WEPA 2QJ0A 3HCUA 2ECIA 4AYCA 5EYAF 3IHPA 4FIPA 2XEUA 3PUQA 5TBNA 3KV6A 5FB0A 2CKLA 5B77A 4GNDA 2PNXA 4W4UA 4AP4A 3C5KA 4A4CA 2YYRA 2YREA 2ZETC 2H0DB 3ZPV1 2HDPA 3GV4A 5TDWA 3N9MA 1LDKC 4F52B 2RI7A 5TABA 2D8SA 2KWOA 2VJEA 3RPGB 5G05B 1Z60A 4GNFA 1N87A 4R8PK 3RTRB 2EODA 2OXQC 4ZUXU 1WEVA 2MA5A 3RPGC 1X4UA 2VPEA 4NN2A 4UP0A 5H9MA 3O37A 5TDRA 2KIZA 2ECVA 3T6RA 4ZQLA 3U5MA 4UP5A 1JOCA 4LJNA 2MD7B 3KQIA 4P5OB 3HCSA 1XWHA 4WZ3B 1X4JA 2YQMA 1VFYA 3SOXA 4BHWA 3C6WA 2G45A 3M62A 3ZVYA 3GL6A 2F6JA 4A49A 1WE9A 3L1XA 4I7CA 5D1MB 3EB6A 2VNFA 5D1LB 2YSJA 2M1RA 4YABA 4LKAA 4L7XA 4TKPB 3T7LA 2F42A 1Z6UA 2YUCA 4I7BA 2Y1MA 2CSYA 2YQLA 2L75A 2M6MA
chains in the Genus database with same CATH superfamily
5H1TA 2HYED 4AYCB 3U5PA 1WGMA 4A0CD 2LGVA 1LDJB 2MNYA 2MIQA 1HYIA 2CKLB 3VK6A 5J3XA 3QZVA 5B78A 4YBSA 1WEWA 3L11A 3M99A 5TRBA 3FM8C 2JMIA 2QIZA 4Z0RA 5SVYA 1FBVA 3M7KA 5K3QA 2MT5A 5FERA 4LADB 5KH7A 3LJUX 2FUIA 2XOCA 2KGGA 5G04B 4GNEA 2VJEB 1X4IA 5H1UA 3O34A 4B86C 1F62A 4YC9A 3O7AA 2RSDA 2KKYA 2EXUA 3LQJA 5AIUA 2G6QA 3EB5A 1WEUA 2UZGA 1WEQA 2LQ6A 2KWJA 4A4BA 2K17A 5LKUA 2ECJA 4FJCA 5LKZA 2CSZA 5B75A 3DDTA 3DQVR 4QF3A 3ZVZB 5I3LA 4S3OC 4IC2A 5LCWB 1JM7A 1Z2QA 2KFTA 5DKAA 3N9QA 4IC3A 1MM3A 5D1KB 2LDRA 2VPDA 1WEMA 4WZ0A 2NAAA 1T1HA 2K4DA 4WA6A 2G43A 3L1ZB 5DINA 4PPEA 2M85A 2FSAA 1BORA 4I7DA 3ZTGA 2D8UA 3U5OA 3KV5A 3N9PA 2KWNA 3N9NA 5B79A 4B7YC 2L5UA 5JG6A 1G25A 4AVXA 2BAYA 2JMJA 2FUUA 2C2VS 2M13A 4YADA 3O35A 4Q6FA 2VP7A 2DX8A 1FP0A 2B0OE 4ZDTA 1ZBDB 3O47A 4LK9A 1RMDA 3SHBA 2ECNA 2M3HA 4CCGX 3MDBC 2DSMA 2LN0A 4FO9A 2YW8A 3SOWA 3LVRE 4LLBA 5LKTA 1WIMA 1WILA 2KKXA 2MNZA 1DVPA 1VYXA 2MUMA 2IDAA 2LXPC 2CT2A 2YVRA 1CHCA 5FEYA 2KYUA 3JUEA 2YU4A 3DWDA 2VJFA 2LGGA 2MA6A 2PUYA 3ZPVE 2E6RA 2AN6A 4Z0OA 1MM2A 4YATA 4L58A 2OWAA 2P57A 2YURA 4O64A 2VPGA 4OGEA 4YBTA 2YHNA 4FK5A 2MD8C 5G0FA 3FL2A 2ECWA 1U6GB 2KU3A 3KNVA 2C2LA 4MVTA 3U5NA 3SOUA 2CRRA 2KE1A 1HYJA 2Y43A 4YAXA 2ECGA 4V3KC 4S3OB 2L0BA 2RR4A 3N9OA 4WZ2A 1VD4A 3N9LA 1E4UA 5LKXA 2E61A 2KGIA 2L43A 2JMDA 2L7PA 4X3GA 3LDYA 1JM7B 2LGKA 4N3WA 3FANA 3DPLR 2H0DA 1K2FA 3PHDA 3O33A 2LAUA 2CRWA 4PTBA 4CA1A 3HCTA 1WEEA 2YHOA 5SVXA 5H1VA 1V87A 2ECTA 3ZNIA 4O62A 2K16A 3Q1DA 5B8DA 5SVIA 3O70A 5AITA 3PURA 2EGPA 2EA6A 1WESA 4R7EA 3LRQA 1WEOA 2XOZA 2K1JA 3ASLA 2CSVA 3T9KA 2FD4A 4N4FA 3MHHA 4GB0A 3NG2A 3PLWA 5KH3A 4UI9B 2LXHC 1WFKA 2YT5A 2XB1A 3I2DA 1IYMA 2YSMA 4GNGA 2E6SA 2KWKA 4MSXA 4XI1A 3KDEC 2I50A 4C9ZA 5FB1A 2L80A 4AUQB 3LQIA 3E2DA 3MHSA 2JRJA 5B76A 2LGLA 2KR4A 2VPBA 3HTKC 3LQHA 2Y1NA 4QQ4A 2KREA 2LV9A 4V3LC 3ZYQA 2QICA 4QF2A 2F6NA 3O36A 2VJFB 4BBQA 2XP0A 1WENA 3M63A 5C13A 2LRIC 4R2YA 5C11A 3V43A 4YBMA 5KH9A 1WEPA 2QJ0A 3HCUA 2ECIA 4AYCA 5EYAF 3IHPA 4FIPA 2XEUA 2JM3A 3PUQA 5TBNA 3KV6A 5FB0A 2CKLA 5B77A 4GNDA 2PNXA 4W4UA 3LVQE 4AP4A 3C5KA 4A4CA 2YYRA 2YREA 2ZETC 2H0DB 3ZPV1 2HDPA 3GV4A 5TDWA 3FJUB 1MBMA 3N9MA 2EGMA 1LDKC 4F52B 2IQJA 2RI7A 5TABA 2D8SA 2MKEA 2KWOA 4H9DA 2VJEA 3RPGB 5G05B 1Z60A 4GNFA 1N87A 4R8PK 3RTRB 2EODA 2OXQC 4ZUXU 2FFWA 1WEVA 2JUNA 2MA5A 3RPGC 5SVIB 1X4UA 2VPEA 4NN2A 4UP0A 3FAOA 5H9MA 3O37A 2XOYA 5TDRA 2KIZA 3H7HA 2ECVA 3T6RA 4ZQLA 1DCQA 3U5MA 4UP5A 1JOCA 4LJNA 2MD7B 3KQIA 4P5OB 4OGCA 3HCSA 1XWHA 4WZ3B 1X4JA 2YQMA 1VFYA 3FEHA 3SOXA 4BHWA 3C6WA 2G45A 3M62A 3ZVYA 2DJAA 2CONA 3GL6A 2F6JA 4A49A 1WE9A 3SUBA 3L1XA 4I7CA 5D1MB 3EB6A 2VNFA 5D1LB 2YSJA 2M1RA 4YABA 4LKAA 4L7XA 4TKPB 3T7LA 2F42A 1Z6UA 2YUCA 4F1PA 4I7BA 2Y1MA 2CSYA 2YQLA 2L75A 2M6MA
chains in the Genus database with same CATH topology
5H1TA 2HYED 4AYCB 3U5PA 1WGMA 4A0CD 2LGVA 1LDJB 2MNYA 2MIQA 1HYIA 2CKLB 3VK6A 5J3XA 3QZVA 5B78A 4YBSA 1WEWA 3L11A 3M99A 5TRBA 2JMIA 2QIZA 1FBVA 2MT5A 5FERA 4LADB 5KH7A 2FUIA 2KGGA 5G04B 4GNEA 2VJEB 1X4IA 5H1UA 3O34A 4B86C 1F62A 4YC9A 3O7AA 2RSDA 3LQJA 5AIUA 2G6QA 3EB5A 1WEUA 2UZGA 1WEQA 2LQ6A 2KWJA 4A4BA 2K17A 5LKUA 2ECJA 4FJCA 5LKZA 2CSZA 5B75A 3DQVR 4QF3A 3ZVZB 5I3LA 4S3OC 4IC2A 5LCWB 1JM7A 1Z2QA 2KFTA 5DKAA 3N9QA 4IC3A 1MM3A 5D1KB 2LDRA 2VPDA 1WEMA 4WZ0A 2NAAA 1T1HA 2K4DA 4WA6A 2G43A 3L1ZB 5DINA 4PPEA 2M85A 2FSAA 1BORA 4I7DA 3ZTGA 3U5OA 3KV5A 3N9PA 2KWNA 3N9NA 5B79A 4B7YC 2L5UA 5JG6A 1G25A 4AVXA 2BAYA 2JMJA 2FUUA 2C2VS 4YADA 3O35A 4Q6FA 2VP7A 2DX8A 1FP0A 4ZDTA 1ZBDB 4LK9A 1RMDA 3SHBA 2ECNA 2M3HA 4CCGX 2LN0A 4FO9A 2YW8A 3SOWA 4LLBA 5LKTA 1WIMA 1WILA 2MNZA 1DVPA 1VYXA 2MUMA 2IDAA 2LXPC 2CT2A 1CHCA 5FEYA 2KYUA 2YU4A 2VJFA 2LGGA 2MA6A 2PUYA 3ZPVE 2E6RA 2AN6A 1MM2A 4YATA 4L58A 2YURA 4O64A 2VPGA 4YBTA 2MD8C 2YHNA 4FK5A 5G0FA 3FL2A 2ECWA 1U6GB 2KU3A 3KNVA 2C2LA 4MVTA 3U5NA 3SOUA 2KE1A 1HYJA 2Y43A 4YAXA 2ECGA 4V3KC 4S3OB 2L0BA 3N9OA 4WZ2A 1VD4A 3N9LA 1E4UA 5LKXA 2L43A 2KGIA 4X3GA 2JMDA 1JM7B 2LGKA 4N3WA 3DPLR 2H0DA 1K2FA 3PHDA 3O33A 4PTBA 4CA1A 3HCTA 1WEEA 2YHOA 5H1VA 1V87A 2ECTA 3ZNIA 2K16A 5B8DA 3O70A 5AITA 3PURA 2EGPA 2EA6A 1WESA 4R7EA 3LRQA 1WEOA 2K1JA 3ASLA 4N4FA 3MHHA 4GB0A 3NG2A 5KH3A 4UI9B 2LXHC 1WFKA 2YT5A 2XB1A 3I2DA 1IYMA 2YSMA 4GNGA 2E6SA 2KWKA 4MSXA 4XI1A 2I50A 4C9ZA 5FB1A 2L80A 4AUQB 3LQIA 3MHSA 2JRJA 5B76A 2LGLA 2KR4A 2VPBA 3HTKC 3LQHA 2Y1NA 2KREA 2LV9A 4V3LC 3ZYQA 2QICA 4QF2A 2F6NA 3O36A 2VJFB 4BBQA 1WENA 3M63A 5C13A 2LRIC 4R2YA 5C11A 3V43A 4YBMA 5KH9A 1WEPA 2QJ0A 3HCUA 2ECIA 4AYCA 5EYAF 3IHPA 4FIPA 2XEUA 3PUQA 5TBNA 3KV6A 5FB0A 2CKLA 5B77A 4GNDA 2PNXA 4W4UA 4AP4A 3C5KA 4A4CA 2YYRA 2YREA 2ZETC 2H0DB 3ZPV1 2HDPA 3GV4A 5TDWA 3N9MA 1LDKC 4F52B 2RI7A 5TABA 2D8SA 2KWOA 2VJEA 3RPGB 5G05B 1Z60A 4GNFA 1N87A 4R8PK 3RTRB 2EODA 2OXQC 4ZUXU 1WEVA 2MA5A 3RPGC 1X4UA 2VPEA 4NN2A 4UP0A 5H9MA 3O37A 5TDRA 2KIZA 2ECVA 3T6RA 4ZQLA 3U5MA 4UP5A 1JOCA 4LJNA 2MD7B 3KQIA 4P5OB 3HCSA 1XWHA 4WZ3B 1X4JA 2YQMA 1VFYA 3SOXA 4BHWA 3C6WA 2G45A 3M62A 3ZVYA 3GL6A 2F6JA 4A49A 1WE9A 3L1XA 4I7CA 5D1MB 3EB6A 2VNFA 5D1LB 2YSJA 2M1RA 4YABA 4LKAA 4L7XA 4TKPB 3T7LA 2F42A 1Z6UA 2YUCA 4I7BA 2Y1MA 2CSYA 2YQLA 2L75A 2M6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1T A;  2HYE D;  4AYC B;  3U5P A;  1WGM A;  4A0C D;  2LGV A;  1LDJ B;  2MNY A;  2MIQ A;  1HYI A;  2CKL B;  3VK6 A;  5J3X A;  3QZV A;  5B78 A;  4YBS A;  1WEW A;  3L11 A;  3M99 A;  5TRB A;  2JMI A;  2QIZ A;  1FBV A;  2MT5 A;  5FER A;  4LAD B;  5KH7 A;  2FUI A;  2KGG A;  5G04 B;  4GNE A;  2VJE B;  1X4I A;  5H1U A;  3O34 A;  4B86 C;  1F62 A;  4YC9 A;  3O7A A;  2RSD A;  3LQJ A;  5AIU A;  2G6Q A;  3EB5 A;  1WEU A;  2UZG A;  1WEQ A;  2LQ6 A;  2KWJ A;  4A4B A;  2K17 A;  5LKU A;  2ECJ A;  4FJC A;  5LKZ A;  2CSZ A;  5B75 A;  3DQV R;  4QF3 A;  3ZVZ B;  5I3L A;  4S3O C;  4IC2 A;  5LCW B;  1JM7 A;  1Z2Q A;  2KFT A;  5DKA A;  3N9Q A;  4IC3 A;  1MM3 A;  5D1K B;  2LDR A;  2VPD A;  1WEM A;  4WZ0 A;  2NAA A;  1T1H A;  2K4D A;  4WA6 A;  2G43 A;  3L1Z B;  5DIN A;  4PPE A;  2M85 A;  2FSA A;  1BOR A;  4I7D A;  3ZTG A;  3U5O A;  3KV5 A;  3N9P A;  2KWN A;  3N9N A;  5B79 A;  4B7Y C;  2L5U A;  5JG6 A;  1G25 A;  4AVX A;  2BAY A;  2JMJ A;  2FUU A;  2C2V S;  4YAD A;  3O35 A;  4Q6F A;  2VP7 A;  2DX8 A;  1FP0 A;  4ZDT A;  1ZBD B;  4LK9 A;  1RMD A;  3SHB A;  2ECN A;  2M3H A;  4CCG X;  2LN0 A;  4FO9 A;  2YW8 A;  3SOW A;  4LLB A;  5LKT A;  1WIM A;  1WIL A;  2MNZ A;  1DVP A;  1VYX A;  2MUM A;  2IDA A;  2LXP C;  2CT2 A;  1CHC A;  5FEY A;  2KYU A;  2YU4 A;  2VJF A;  2LGG A;  2MA6 A;  2PUY A;  3ZPV E;  2E6R A;  2AN6 A;  1MM2 A;  4YAT A;  4L58 A;  2YUR A;  4O64 A;  2VPG A;  4YBT A;  2MD8 C;  2YHN A;  4FK5 A;  5G0F A;  3FL2 A;  2ECW A;  1U6G B;  2KU3 A;  3KNV A;  2C2L A;  4MVT A;  3U5N A;  3SOU A;  2KE1 A;  1HYJ A;  2Y43 A;  4YAX A;  2ECG A;  4V3K C;  4S3O B;  2L0B A;  3N9O A;  4WZ2 A;  1VD4 A;  3N9L A;  1E4U A;  5LKX A;  2L43 A;  2KGI A;  4X3G A;  2JMD A;  1JM7 B;  2LGK A;  4N3W A;  3DPL R;  2H0D A;  1K2F A;  3PHD A;  3O33 A;  4PTB A;  4CA1 A;  3HCT A;  1WEE A;  2YHO A;  5H1V A;  1V87 A;  2ECT A;  3ZNI A;  2K16 A;  5B8D A;  3O70 A;  5AIT A;  3PUR A;  2EGP A;  2EA6 A;  1WES A;  4R7E A;  3LRQ A;  1WEO A;  2K1J A;  3ASL A;  4N4F A;  3MHH A;  4GB0 A;  3NG2 A;  5KH3 A;  4UI9 B;  2LXH C;  1WFK A;  2YT5 A;  2XB1 A;  3I2D A;  1IYM A;  2YSM A;  4GNG A;  2E6S A;  2KWK A;  4MSX A;  4XI1 A;  2I50 A;  4C9Z A;  5FB1 A;  2L80 A;  4AUQ B;  3LQI A;  3MHS A;  2JRJ A;  5B76 A;  2LGL A;  2KR4 A;  2VPB A;  3HTK C;  3LQH A;  2Y1N A;  2KRE A;  2LV9 A;  4V3L C;  3ZYQ A;  2QIC A;  4QF2 A;  2F6N A;  3O36 A;  2VJF B;  4BBQ A;  1WEN A;  3M63 A;  5C13 A;  2LRI C;  4R2Y A;  5C11 A;  3V43 A;  4YBM A;  5KH9 A;  1WEP A;  2QJ0 A;  3HCU A;  2ECI A;  4AYC A;  5EYA F;  3IHP A;  4FIP A;  2XEU A;  3PUQ A;  5TBN A;  3KV6 A;  5FB0 A;  2CKL A;  5B77 A;  4GND A;  2PNX A;  4W4U A;  4AP4 A;  3C5K A;  4A4C A;  2YYR A;  2YRE A;  2ZET C;  2H0D B;  3ZPV 1;  2HDP A;  3GV4 A;  5TDW A;  3N9M A;  1LDK C;  4F52 B;  2RI7 A;  5TAB A;  2D8S A;  2KWO A;  2VJE A;  3RPG B;  5G05 B;  1Z60 A;  4GNF A;  1N87 A;  4R8P K;  3RTR B;  2EOD A;  2OXQ C;  4ZUX U;  1WEV A;  2MA5 A;  3RPG C;  1X4U A;  2VPE A;  4NN2 A;  4UP0 A;  5H9M A;  3O37 A;  5TDR A;  2KIZ A;  2ECV A;  3T6R A;  4ZQL A;  3U5M A;  4UP5 A;  1JOC A;  4LJN A;  2MD7 B;  3KQI A;  4P5O B;  3HCS A;  1XWH A;  4WZ3 B;  1X4J A;  2YQM A;  1VFY A;  3SOX A;  4BHW A;  3C6W A;  2G45 A;  3M62 A;  3ZVY A;  3GL6 A;  2F6J A;  4A49 A;  1WE9 A;  3L1X A;  4I7C A;  5D1M B;  3EB6 A;  2VNF A;  5D1L B;  2YSJ A;  2M1R A;  4YAB A;  4LKA A;  4L7X A;  4TKP B;  3T7L A;  2F42 A;  1Z6U A;  2YUC A;  4I7B A;  2Y1M A;  2CSY A;  2YQL A;  2L75 A;  2M6M A; 
#chains in the Genus database with same CATH topology
 5H1T A;  2HYE D;  4AYC B;  3U5P A;  1WGM A;  4A0C D;  2LGV A;  1LDJ B;  2MNY A;  2MIQ A;  1HYI A;  2CKL B;  3VK6 A;  5J3X A;  3QZV A;  5B78 A;  4YBS A;  1WEW A;  3L11 A;  3M99 A;  5TRB A;  3FM8 C;  2JMI A;  2QIZ A;  4Z0R A;  5SVY A;  1FBV A;  3M7K A;  5K3Q A;  2MT5 A;  5FER A;  4LAD B;  5KH7 A;  3LJU X;  2FUI A;  2XOC A;  2KGG A;  5G04 B;  4GNE A;  2VJE B;  1X4I A;  5H1U A;  3O34 A;  4B86 C;  1F62 A;  4YC9 A;  3O7A A;  2RSD A;  2KKY A;  2EXU A;  3LQJ A;  5AIU A;  2G6Q A;  3EB5 A;  1WEU A;  2UZG A;  1WEQ A;  2LQ6 A;  2KWJ A;  4A4B A;  2K17 A;  5LKU A;  2ECJ A;  4FJC A;  5LKZ A;  2CSZ A;  5B75 A;  3DDT A;  3DQV R;  4QF3 A;  3ZVZ B;  5I3L A;  4S3O C;  4IC2 A;  5LCW B;  1JM7 A;  1Z2Q A;  2KFT A;  5DKA A;  3N9Q A;  4IC3 A;  1MM3 A;  5D1K B;  2LDR A;  2VPD A;  1WEM A;  4WZ0 A;  2NAA A;  1T1H A;  2K4D A;  4WA6 A;  2G43 A;  3L1Z B;  5DIN A;  4PPE A;  2M85 A;  2FSA A;  1BOR A;  4I7D A;  3ZTG A;  2D8U A;  3U5O A;  3KV5 A;  3N9P A;  2KWN A;  3N9N A;  5B79 A;  4B7Y C;  2L5U A;  5JG6 A;  1G25 A;  4AVX A;  2BAY A;  2JMJ A;  2FUU A;  2C2V S;  2M13 A;  4YAD A;  3O35 A;  4Q6F A;  2VP7 A;  2DX8 A;  1FP0 A;  2B0O E;  4ZDT A;  1ZBD B;  3O47 A;  4LK9 A;  1RMD A;  3SHB A;  2ECN A;  2M3H A;  4CCG X;  3MDB C;  2DSM A;  2LN0 A;  4FO9 A;  2YW8 A;  3SOW A;  3LVR E;  4LLB A;  5LKT A;  1WIM A;  1WIL A;  2KKX A;  2MNZ A;  1DVP A;  1VYX A;  2MUM A;  2IDA A;  2LXP C;  2CT2 A;  2YVR A;  1CHC A;  5FEY A;  2KYU A;  3JUE A;  2YU4 A;  3DWD A;  2VJF A;  2LGG A;  2MA6 A;  2PUY A;  3ZPV E;  2E6R A;  2AN6 A;  4Z0O A;  1MM2 A;  4YAT A;  4L58 A;  2OWA A;  2P57 A;  2YUR A;  4O64 A;  2VPG A;  4OGE A;  4YBT A;  2YHN A;  4FK5 A;  2MD8 C;  5G0F A;  3FL2 A;  2ECW A;  1U6G B;  2KU3 A;  3KNV A;  2C2L A;  4MVT A;  3U5N A;  3SOU A;  2CRR A;  2KE1 A;  1HYJ A;  2Y43 A;  4YAX A;  2ECG A;  4V3K C;  4S3O B;  2L0B A;  2RR4 A;  3N9O A;  4WZ2 A;  1VD4 A;  3N9L A;  1E4U A;  5LKX A;  2E61 A;  2KGI A;  2L43 A;  2JMD A;  2L7P A;  4X3G A;  3LDY A;  1JM7 B;  2LGK A;  4N3W A;  3FAN A;  3DPL R;  2H0D A;  1K2F A;  3PHD A;  3O33 A;  2LAU A;  2CRW A;  4PTB A;  4CA1 A;  3HCT A;  1WEE A;  2YHO A;  5SVX A;  5H1V A;  1V87 A;  2ECT A;  3ZNI A;  4O62 A;  2K16 A;  3Q1D A;  5B8D A;  5SVI A;  3O70 A;  5AIT A;  3PUR A;  2EGP A;  2EA6 A;  1WES A;  4R7E A;  3LRQ A;  1WEO A;  2XOZ A;  2K1J A;  3ASL A;  2CSV A;  3T9K A;  2FD4 A;  4N4F A;  3MHH A;  4GB0 A;  3NG2 A;  3PLW A;  5KH3 A;  4UI9 B;  2LXH C;  1WFK A;  2YT5 A;  2XB1 A;  3I2D A;  1IYM A;  2YSM A;  4GNG A;  2E6S A;  2KWK A;  4MSX A;  4XI1 A;  3KDE C;  2I50 A;  4C9Z A;  5FB1 A;  2L80 A;  4AUQ B;  3LQI A;  3E2D A;  3MHS A;  2JRJ A;  5B76 A;  2LGL A;  2KR4 A;  2VPB A;  3HTK C;  3LQH A;  2Y1N A;  4QQ4 A;  2KRE A;  2LV9 A;  4V3L C;  3ZYQ A;  2QIC A;  4QF2 A;  2F6N A;  3O36 A;  2VJF B;  4BBQ A;  2XP0 A;  1WEN A;  3M63 A;  5C13 A;  2LRI C;  4R2Y A;  5C11 A;  3V43 A;  4YBM A;  5KH9 A;  1WEP A;  2QJ0 A;  3HCU A;  2ECI A;  4AYC A;  5EYA F;  3IHP A;  4FIP A;  2XEU A;  2JM3 A;  3PUQ A;  5TBN A;  3KV6 A;  5FB0 A;  2CKL A;  5B77 A;  4GND A;  2PNX A;  4W4U A;  3LVQ E;  4AP4 A;  3C5K A;  4A4C A;  2YYR A;  2YRE A;  2ZET C;  2H0D B;  3ZPV 1;  2HDP A;  3GV4 A;  5TDW A;  3FJU B;  1MBM A;  3N9M A;  2EGM A;  1LDK C;  4F52 B;  2IQJ A;  2RI7 A;  5TAB A;  2D8S A;  2MKE A;  2KWO A;  4H9D A;  2VJE A;  3RPG B;  5G05 B;  1Z60 A;  4GNF A;  1N87 A;  4R8P K;  3RTR B;  2EOD A;  2OXQ C;  4ZUX U;  2FFW A;  1WEV A;  2JUN A;  2MA5 A;  3RPG C;  5SVI B;  1X4U A;  2VPE A;  4NN2 A;  4UP0 A;  3FAO A;  5H9M A;  3O37 A;  2XOY A;  5TDR A;  2KIZ A;  3H7H A;  2ECV A;  3T6R A;  4ZQL A;  1DCQ A;  3U5M A;  4UP5 A;  1JOC A;  4LJN A;  2MD7 B;  3KQI A;  4P5O B;  4OGC A;  3HCS A;  1XWH A;  4WZ3 B;  1X4J A;  2YQM A;  1VFY A;  3FEH A;  3SOX A;  4BHW A;  3C6W A;  2G45 A;  3M62 A;  3ZVY A;  2DJA A;  2CON A;  3GL6 A;  2F6J A;  4A49 A;  1WE9 A;  3SUB A;  3L1X A;  4I7C A;  5D1M B;  3EB6 A;  2VNF A;  5D1L B;  2YSJ A;  2M1R A;  4YAB A;  4LKA A;  4L7X A;  4TKP B;  3T7L A;  2F42 A;  1Z6U A;  2YUC A;  4F1P A;  4I7B A;  2Y1M A;  2CSY A;  2YQL A;  2L75 A;  2M6M A; 
#chains in the Genus database with same CATH homology
 5H1T A;  2HYE D;  4AYC B;  3U5P A;  1WGM A;  4A0C D;  2LGV A;  1LDJ B;  2MNY A;  2MIQ A;  1HYI A;  2CKL B;  3VK6 A;  5J3X A;  3QZV A;  5B78 A;  4YBS A;  1WEW A;  3L11 A;  3M99 A;  5TRB A;  2JMI A;  2QIZ A;  1FBV A;  2MT5 A;  5FER A;  4LAD B;  5KH7 A;  2FUI A;  2KGG A;  5G04 B;  4GNE A;  2VJE B;  1X4I A;  5H1U A;  3O34 A;  4B86 C;  1F62 A;  4YC9 A;  3O7A A;  2RSD A;  3LQJ A;  5AIU A;  2G6Q A;  3EB5 A;  1WEU A;  2UZG A;  1WEQ A;  2LQ6 A;  2KWJ A;  4A4B A;  2K17 A;  5LKU A;  2ECJ A;  4FJC A;  5LKZ A;  2CSZ A;  5B75 A;  3DQV R;  4QF3 A;  3ZVZ B;  5I3L A;  4S3O C;  4IC2 A;  5LCW B;  1JM7 A;  1Z2Q A;  2KFT A;  5DKA A;  3N9Q A;  4IC3 A;  1MM3 A;  5D1K B;  2LDR A;  2VPD A;  1WEM A;  4WZ0 A;  2NAA A;  1T1H A;  2K4D A;  4WA6 A;  2G43 A;  3L1Z B;  5DIN A;  4PPE A;  2M85 A;  2FSA A;  1BOR A;  4I7D A;  3ZTG A;  3U5O A;  3KV5 A;  3N9P A;  2KWN A;  3N9N A;  5B79 A;  4B7Y C;  2L5U A;  5JG6 A;  1G25 A;  4AVX A;  2BAY A;  2JMJ A;  2FUU A;  2C2V S;  4YAD A;  3O35 A;  4Q6F A;  2VP7 A;  2DX8 A;  1FP0 A;  4ZDT A;  1ZBD B;  4LK9 A;  1RMD A;  3SHB A;  2ECN A;  2M3H A;  4CCG X;  2LN0 A;  4FO9 A;  2YW8 A;  3SOW A;  4LLB A;  5LKT A;  1WIM A;  1WIL A;  2MNZ A;  1DVP A;  1VYX A;  2MUM A;  2IDA A;  2LXP C;  2CT2 A;  1CHC A;  5FEY A;  2KYU A;  2YU4 A;  2VJF A;  2LGG A;  2MA6 A;  2PUY A;  3ZPV E;  2E6R A;  2AN6 A;  1MM2 A;  4YAT A;  4L58 A;  2YUR A;  4O64 A;  2VPG A;  4YBT A;  2MD8 C;  2YHN A;  4FK5 A;  5G0F A;  3FL2 A;  2ECW A;  1U6G B;  2KU3 A;  3KNV A;  2C2L A;  4MVT A;  3U5N A;  3SOU A;  2KE1 A;  1HYJ A;  2Y43 A;  4YAX A;  2ECG A;  4V3K C;  4S3O B;  2L0B A;  3N9O A;  4WZ2 A;  1VD4 A;  3N9L A;  1E4U A;  5LKX A;  2L43 A;  2KGI A;  4X3G A;  2JMD A;  1JM7 B;  2LGK A;  4N3W A;  3DPL R;  2H0D A;  1K2F A;  3PHD A;  3O33 A;  4PTB A;  4CA1 A;  3HCT A;  1WEE A;  2YHO A;  5H1V A;  1V87 A;  2ECT A;  3ZNI A;  2K16 A;  5B8D A;  3O70 A;  5AIT A;  3PUR A;  2EGP A;  2EA6 A;  1WES A;  4R7E A;  3LRQ A;  1WEO A;  2K1J A;  3ASL A;  4N4F A;  3MHH A;  4GB0 A;  3NG2 A;  5KH3 A;  4UI9 B;  2LXH C;  1WFK A;  2YT5 A;  2XB1 A;  3I2D A;  1IYM A;  2YSM A;  4GNG A;  2E6S A;  2KWK A;  4MSX A;  4XI1 A;  2I50 A;  4C9Z A;  5FB1 A;  2L80 A;  4AUQ B;  3LQI A;  3MHS A;  2JRJ A;  5B76 A;  2LGL A;  2KR4 A;  2VPB A;  3HTK C;  3LQH A;  2Y1N A;  2KRE A;  2LV9 A;  4V3L C;  3ZYQ A;  2QIC A;  4QF2 A;  2F6N A;  3O36 A;  2VJF B;  4BBQ A;  1WEN A;  3M63 A;  5C13 A;  2LRI C;  4R2Y A;  5C11 A;  3V43 A;  4YBM A;  5KH9 A;  1WEP A;  2QJ0 A;  3HCU A;  2ECI A;  4AYC A;  5EYA F;  3IHP A;  4FIP A;  2XEU A;  3PUQ A;  5TBN A;  3KV6 A;  5FB0 A;  2CKL A;  5B77 A;  4GND A;  2PNX A;  4W4U A;  4AP4 A;  3C5K A;  4A4C A;  2YYR A;  2YRE A;  2ZET C;  2H0D B;  3ZPV 1;  2HDP A;  3GV4 A;  5TDW A;  3N9M A;  1LDK C;  4F52 B;  2RI7 A;  5TAB A;  2D8S A;  2KWO A;  2VJE A;  3RPG B;  5G05 B;  1Z60 A;  4GNF A;  1N87 A;  4R8P K;  3RTR B;  2EOD A;  2OXQ C;  4ZUX U;  1WEV A;  2MA5 A;  3RPG C;  1X4U A;  2VPE A;  4NN2 A;  4UP0 A;  5H9M A;  3O37 A;  5TDR A;  2KIZ A;  2ECV A;  3T6R A;  4ZQL A;  3U5M A;  4UP5 A;  1JOC A;  4LJN A;  2MD7 B;  3KQI A;  4P5O B;  3HCS A;  1XWH A;  4WZ3 B;  1X4J A;  2YQM A;  1VFY A;  3SOX A;  4BHW A;  3C6W A;  2G45 A;  3M62 A;  3ZVY A;  3GL6 A;  2F6J A;  4A49 A;  1WE9 A;  3L1X A;  4I7C A;  5D1M B;  3EB6 A;  2VNF A;  5D1L B;  2YSJ A;  2M1R A;  4YAB A;  4LKA A;  4L7X A;  4TKP B;  3T7L A;  2F42 A;  1Z6U A;  2YUC A;  4I7B A;  2Y1M A;  2CSY A;  2YQL A;  2L75 A;  2M6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...