1U6GB

Crystal structure of the cand1-cul1-roc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
b'KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cullin homolog 1
publication title Structure of the Cand1-Cul1-Roc1 complex reveals regulatory mechanisms for the assembly of the multisubunit cullin-dependent ubiquitin ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1u6gB00
3DPLR 1RMDA 2VPBA 5I3LA 2C2VS 3EB6A 1E4UA 3ZTGA 2L0BA 2ECIA 1WFKA 2AN6A 2VJEA 2KWOA 2LGKA 1WEUA 2LRIC 2LGGA 4C9ZA 2F6NA 5H1UA 4V3LC 2FSAA 5B78A 4ZQLA 4ZUXU 1Z6UA 2G43A 4YAXA 3T6RA 2C2LA 4IC3A 2KFTA 5FERA 3ZPVE 3ZVYA 2F6JA 4IC2A 2MD8C 2MA6A 2L43A 3HCUA 2EGPA 3N9MA 5KH7A 3SHBA 3LQIA 2YHNA 4I7CA 4LK9A 5B77A 3N9PA 2CSYA 5C13A 2L5UA 3SOXA 2L75A 2H0DA 2YQMA 2LGVA 1Z2QA 4WZ2A 2MNZA 5LKTA 4B7YC 4CCGX 1WEEA 2ZETC 3ZPV1 2VPDA 4BBQA 2YW8A 3N9OA 5LKUA 3N9LA 4R2YA 4WZ0A 4S3OC 4YBSA 5B79A 2LDRA 4W4UA 4GB0A 5J3XA 2LXPC 5TRBA 4S3OB 4TKPB 3U5PA 2MD7B 2VJEB 1DVPA 3KV6A 5B75A 4PTBA 2EODA 4FIPA 5FB1A 4O64A 5TDWA 4YBMA 3FL2A 4AP4A 2VPGA 2XEUA 4UI9B 1T1HA 1WEOA 1WEWA 2ECTA 4LKAA 3O37A 3KQIA 2BAYA 2YU4A 5FB0A 2JMJA 2K4DA 4Q6FA 3HCSA 4A4CA 3LRQA 4FJCA 3MHSA 2I50A 4P5OB 2NAAA 2LGLA 5H9MA 1VFYA 2LQ6A 4FO9A 1F62A 2CKLA 2H0DB 1LDJB 3M63A 3L1XA 5D1MB 5JG6A 2ECGA 4WZ3B 4A49A 2KREA 4B86C 5LCWB 3VK6A 5H1TA 2VPEA 4L58A 3T7LA 2KWNA 4YABA 2YSMA 3RPGC 3LQHA 5TDRA 2VJFB 3NG2A 2KYUA 4A4BA 5AIUA 4A0CD 3KV5A 1X4IA 2QICA 3PURA 2YUCA 4NN2A 3C5KA 5KH3A 2Y1NA 2F42A 4YADA 4UP5A 1WIMA 4XI1A 4AUQB 5FEYA 2LV9A 2M1RA 3LQJA 3L11A 5LKZA 2G6QA 4V3KC 2M85A 3O35A 2ECJA 5B8DA 5D1LB 4R8PK 3HCTA 3ZYQA 2CSZA 2K1JA 4AYCA 5TBNA 3O33A 2Y1MA 4ZDTA 4YBTA 2YYRA 2KGGA 3C6WA 4QF2A 3IHPA 1CHCA 2PUYA 4X3GA 2HDPA 5KH9A 2EA6A 2CKLB 2YSJA 5G0FA 5G04B 1WESA 2G45A 2KE1A 1N87A 5G05B 2Y43A 4WA6A 3PHDA 2YREA 3SOWA 2FUIA 2ECWA 1VYXA 3M99A 2ECVA 1X4JA 1HYIA 4BHWA 1JM7A 3O36A 3M62A 4FK5A 3RTRB 4AVXA 4PPEA 2LN0A 2M6MA 3N9QA 2E6SA 5D1KB 2L80A 2RI7A 1WEQA 1Z60A 4UP0A 3ZNIA 1LDKC 2MNYA 4LADB 2MT5A 4I7DA 3I2DA 2VNFA 4GNFA 1FBVA 4L7XA 3U5MA 1WENA 1MM2A 2DX8A 4YC9A 3O70A 1JOCA 4N3WA 5B76A 2KWKA 2ECNA 3U5OA 1VD4A 5LKXA 3PUQA 3SOUA 2JRJA 4GNEA 3RPGB 3ASLA 4AYCB 2MUMA 1WILA 3U5NA 1WEPA 3O34A 5H1VA 4GNDA 3L1ZB 2UZGA 3O7AA 3HTKC 4LJNA 2FUUA 2JMIA 5TABA 4GNGA 4N4FA 2K17A 2PNXA 2K16A 3EB5A 3GV4A 2YURA 2MIQA 1WEMA 1FP0A 1WEVA 4YATA 2JMDA 1IYMA 3V43A 3QZVA 1X4UA 1K2FA 2YHOA 2QIZA 4R7EA 1JM7B 1V87A 5C11A 4MVTA 3KNVA 1ZBDB 2VJFA 2KIZA 5DINA 2KU3A 3DQVR 1WE9A 2YQLA 2XB1A 4LLBA 1XWHA 2D8SA 2M3HA 5DKAA 2MA5A 2RSDA 2KGIA 2E6RA 2QJ0A 3ZVZB 3MHHA 3N9NA 2YT5A 2LXHC 1MM3A 4MSXA 1WGMA 1BORA 2KWJA 2KR4A 1G25A 5AITA 1HYJA 2HYED 1U6GB 2IDAA 4F52B 2VP7A 2OXQC 4QF3A 4I7BA 5EYAF 4CA1A 2CT2A 3GL6A
chains in the Genus database with same CATH superfamily
3DPLR 1RMDA 2VPBA 5I3LA 2C2VS 3EB6A 1E4UA 3ZTGA 2L0BA 2ECIA 1WFKA 2AN6A 2VJEA 3H7HA 2KWOA 2LGKA 1WEUA 2LRIC 2LGGA 4C9ZA 2F6NA 5H1UA 4V3LC 2FSAA 5B78A 4ZQLA 4ZUXU 2CRRA 1Z6UA 2G43A 4YAXA 4Z0OA 3T6RA 2C2LA 4IC3A 2KFTA 5FERA 3ZPVE 3ZVYA 2F6JA 4IC2A 2MD8C 2MA6A 4QQ4A 2L43A 3HCUA 2EGPA 3N9MA 5KH7A 3SHBA 3LQIA 2YHNA 4I7CA 4LK9A 5B77A 3N9PA 2CSYA 2KKYA 5SVYA 5C13A 2L5UA 3SOXA 2L75A 2H0DA 2YQMA 2LGVA 1Z2QA 4WZ2A 2MNZA 3Q1DA 5LKTA 4B7YC 4CCGX 1WEEA 2ZETC 3ZPV1 2VPDA 4BBQA 2YW8A 2JUNA 3N9OA 5LKUA 3N9LA 4R2YA 4WZ0A 4S3OC 4YBSA 5B79A 2LDRA 4W4UA 4GB0A 5J3XA 2LXPC 3LJUX 5TRBA 3FAOA 2M13A 4S3OB 2CRWA 4TKPB 3U5PA 2MD7B 2VJEB 1DVPA 3KV6A 4F1PA 5B75A 4PTBA 2EODA 4FIPA 5FB1A 4O64A 5TDWA 4YBMA 3FL2A 4AP4A 2VPGA 2XEUA 4UI9B 1T1HA 1WEOA 1WEWA 2ECTA 4LKAA 5SVIA 3O37A 2D8UA 3KQIA 3M7KA 2BAYA 2LAUA 2YU4A 5FB0A 2DJAA 2JMJA 2K4DA 4Q6FA 3HCSA 4A4CA 3LRQA 4FJCA 3MHSA 2I50A 4P5OB 2NAAA 2LGLA 5H9MA 1VFYA 2LQ6A 4FO9A 1F62A 2CKLA 2H0DB 1LDJB 3M63A 3L1XA 5D1MB 5JG6A 2ECGA 4WZ3B 4A49A 2KREA 4B86C 5LCWB 3O47A 3VK6A 5H1TA 4OGEA 2VPEA 4L58A 2CONA 3T7LA 2KWNA 4YABA 2YSMA 3RPGC 3LQHA 5TDRA 2VJFB 3NG2A 2KYUA 4A4BA 3MDBC 5AIUA 4A0CD 3KV5A 1X4IA 2QICA 3PURA 2YUCA 4NN2A 3C5KA 5KH3A 1MBMA 2Y1NA 2F42A 4YADA 4UP5A 1WIMA 4XI1A 4AUQB 5FEYA 2LV9A 2M1RA 3LQJA 3L11A 5LKZA 2G6QA 4V3KC 2M85A 3O35A 2ECJA 5SVIB 1DCQA 5B8DA 5D1LB 4R8PK 3HCTA 3ZYQA 2CSZA 2K1JA 4AYCA 3SUBA 5TBNA 3DWDA 3O33A 2Y1MA 4ZDTA 4YBTA 2YYRA 2KGGA 3C6WA 4QF2A 2XOYA 3IHPA 1CHCA 2PUYA 4X3GA 2HDPA 5KH9A 2EA6A 3LVQE 2CKLB 2JM3A 2YSJA 5G0FA 5G04B 1WESA 2G45A 2KE1A 1N87A 5G05B 2Y43A 2XP0A 4WA6A 2FD4A 3PHDA 2YREA 3SOWA 2FUIA 2ECWA 1VYXA 3M99A 2ECVA 4H9DA 1X4JA 1HYIA 4BHWA 1JM7A 2KKXA 3O36A 3M62A 4FK5A 3RTRB 4AVXA 4PPEA 2LN0A 2M6MA 3N9QA 2E6SA 4OGCA 5D1KB 2L80A 2RI7A 1WEQA 2DSMA 2XOZA 1Z60A 4UP0A 3ZNIA 1LDKC 2MNYA 2B0OE 4LADB 2MT5A 3FJUB 4I7DA 3I2DA 2VNFA 4GNFA 2EGMA 1FBVA 4L7XA 3U5MA 1WENA 1MM2A 2DX8A 4YC9A 3O70A 1JOCA 4N3WA 4Z0RA 2RR4A 5B76A 3PLWA 2KWKA 2ECNA 3U5OA 3DDTA 3E2DA 1VD4A 5LKXA 3PUQA 3SOUA 2JRJA 4GNEA 3RPGB 3ASLA 4AYCB 2MUMA 4O62A 1WILA 3U5NA 1WEPA 3O34A 5H1VA 2XOCA 3L1ZB 4GNDA 2UZGA 3O7AA 3HTKC 4LJNA 2FUUA 2JMIA 5TABA 4GNGA 4N4FA 2K17A 2PNXA 2YVRA 2K16A 3EB5A 3GV4A 3LVRE 2YURA 2MIQA 1WEMA 1FP0A 2CSVA 1WEVA 4YATA 2JMDA 1IYMA 3V43A 3FEHA 3QZVA 2L7PA 1X4UA 1K2FA 3JUEA 2IQJA 2YHOA 2QIZA 4R7EA 2MKEA 2EXUA 1JM7B 1V87A 5C11A 4MVTA 3KNVA 1ZBDB 2VJFA 2KIZA 5DINA 2KU3A 3DQVR 1WE9A 2YQLA 4LLBA 2XB1A 1XWHA 2D8SA 2M3HA 2E61A 5K3QA 5DKAA 2MA5A 3KDEC 2RSDA 2KGIA 2E6RA 2QJ0A 3LDYA 3ZVZB 3MHHA 3N9NA 2YT5A 2OWAA 2LXHC 3T9KA 1MM3A 2FFWA 4MSXA 1WGMA 1BORA 2KWJA 5SVXA 2KR4A 1G25A 5AITA 1HYJA 2HYED 1U6GB 2IDAA 4F52B 2VP7A 2OXQC 4QF3A 2P57A 4I7BA 5EYAF 4CA1A 2CT2A 3FM8C 3GL6A 3FANA
chains in the Genus database with same CATH topology
3DPLR 1RMDA 2VPBA 5I3LA 2C2VS 3EB6A 1E4UA 3ZTGA 2L0BA 2ECIA 1WFKA 2AN6A 2VJEA 2KWOA 2LGKA 1WEUA 2LRIC 2LGGA 4C9ZA 2F6NA 5H1UA 4V3LC 2FSAA 5B78A 4ZQLA 4ZUXU 1Z6UA 2G43A 4YAXA 3T6RA 2C2LA 4IC3A 2KFTA 5FERA 3ZPVE 3ZVYA 2F6JA 4IC2A 2MD8C 2MA6A 2L43A 3HCUA 2EGPA 3N9MA 5KH7A 3SHBA 3LQIA 2YHNA 4I7CA 4LK9A 5B77A 3N9PA 2CSYA 5C13A 2L5UA 3SOXA 2L75A 2H0DA 2YQMA 2LGVA 1Z2QA 4WZ2A 2MNZA 5LKTA 4B7YC 4CCGX 1WEEA 2ZETC 3ZPV1 2VPDA 4BBQA 2YW8A 3N9OA 5LKUA 3N9LA 4R2YA 4WZ0A 4S3OC 4YBSA 5B79A 2LDRA 4W4UA 4GB0A 5J3XA 2LXPC 5TRBA 4S3OB 4TKPB 3U5PA 2MD7B 2VJEB 1DVPA 3KV6A 5B75A 4PTBA 2EODA 4FIPA 5FB1A 4O64A 5TDWA 4YBMA 3FL2A 4AP4A 2VPGA 2XEUA 4UI9B 1T1HA 1WEOA 1WEWA 2ECTA 4LKAA 3O37A 3KQIA 2BAYA 2YU4A 5FB0A 2JMJA 2K4DA 4Q6FA 3HCSA 4A4CA 3LRQA 4FJCA 3MHSA 2I50A 4P5OB 2NAAA 2LGLA 5H9MA 1VFYA 2LQ6A 4FO9A 1F62A 2CKLA 2H0DB 1LDJB 3M63A 3L1XA 5D1MB 5JG6A 2ECGA 4WZ3B 4A49A 2KREA 4B86C 5LCWB 3VK6A 5H1TA 2VPEA 4L58A 3T7LA 2KWNA 4YABA 2YSMA 3RPGC 3LQHA 5TDRA 2VJFB 3NG2A 2KYUA 4A4BA 5AIUA 4A0CD 3KV5A 1X4IA 2QICA 3PURA 2YUCA 4NN2A 3C5KA 5KH3A 2Y1NA 2F42A 4YADA 4UP5A 1WIMA 4XI1A 4AUQB 5FEYA 2LV9A 2M1RA 3LQJA 3L11A 5LKZA 2G6QA 4V3KC 2M85A 3O35A 2ECJA 5B8DA 5D1LB 4R8PK 3HCTA 3ZYQA 2CSZA 2K1JA 4AYCA 5TBNA 3O33A 2Y1MA 4ZDTA 4YBTA 2YYRA 2KGGA 3C6WA 4QF2A 3IHPA 1CHCA 2PUYA 4X3GA 2HDPA 5KH9A 2EA6A 2CKLB 2YSJA 5G0FA 5G04B 1WESA 2G45A 2KE1A 1N87A 5G05B 2Y43A 4WA6A 3PHDA 2YREA 3SOWA 2FUIA 2ECWA 1VYXA 3M99A 2ECVA 1X4JA 1HYIA 4BHWA 1JM7A 3O36A 3M62A 4FK5A 3RTRB 4AVXA 4PPEA 2LN0A 2M6MA 3N9QA 2E6SA 5D1KB 2L80A 2RI7A 1WEQA 1Z60A 4UP0A 3ZNIA 1LDKC 2MNYA 4LADB 2MT5A 4I7DA 3I2DA 2VNFA 4GNFA 1FBVA 4L7XA 3U5MA 1WENA 1MM2A 2DX8A 4YC9A 3O70A 1JOCA 4N3WA 5B76A 2KWKA 2ECNA 3U5OA 1VD4A 5LKXA 3PUQA 3SOUA 2JRJA 4GNEA 3RPGB 3ASLA 4AYCB 2MUMA 1WILA 3U5NA 1WEPA 3O34A 5H1VA 4GNDA 3L1ZB 2UZGA 3O7AA 3HTKC 4LJNA 2FUUA 2JMIA 5TABA 4GNGA 4N4FA 2K17A 2PNXA 2K16A 3EB5A 3GV4A 2YURA 2MIQA 1WEMA 1FP0A 1WEVA 4YATA 2JMDA 1IYMA 3V43A 3QZVA 1X4UA 1K2FA 2YHOA 2QIZA 4R7EA 1JM7B 1V87A 5C11A 4MVTA 3KNVA 1ZBDB 2VJFA 2KIZA 5DINA 2KU3A 3DQVR 1WE9A 2YQLA 2XB1A 4LLBA 1XWHA 2D8SA 2M3HA 5DKAA 2MA5A 2RSDA 2KGIA 2E6RA 2QJ0A 3ZVZB 3MHHA 3N9NA 2YT5A 2LXHC 1MM3A 4MSXA 1WGMA 1BORA 2KWJA 2KR4A 1G25A 5AITA 1HYJA 2HYED 1U6GB 2IDAA 4F52B 2VP7A 2OXQC 4QF3A 4I7BA 5EYAF 4CA1A 2CT2A 3GL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPL R;  1RMD A;  2VPB A;  5I3L A;  2C2V S;  3EB6 A;  1E4U A;  3ZTG A;  2L0B A;  2ECI A;  1WFK A;  2AN6 A;  2VJE A;  2KWO A;  2LGK A;  1WEU A;  2LRI C;  2LGG A;  4C9Z A;  2F6N A;  5H1U A;  4V3L C;  2FSA A;  5B78 A;  4ZQL A;  4ZUX U;  1Z6U A;  2G43 A;  4YAX A;  3T6R A;  2C2L A;  4IC3 A;  2KFT A;  5FER A;  3ZPV E;  3ZVY A;  2F6J A;  4IC2 A;  2MD8 C;  2MA6 A;  2L43 A;  3HCU A;  2EGP A;  3N9M A;  5KH7 A;  3SHB A;  3LQI A;  2YHN A;  4I7C A;  4LK9 A;  5B77 A;  3N9P A;  2CSY A;  5C13 A;  2L5U A;  3SOX A;  2L75 A;  2H0D A;  2YQM A;  2LGV A;  1Z2Q A;  4WZ2 A;  2MNZ A;  5LKT A;  4B7Y C;  4CCG X;  1WEE A;  2ZET C;  3ZPV 1;  2VPD A;  4BBQ A;  2YW8 A;  3N9O A;  5LKU A;  3N9L A;  4R2Y A;  4WZ0 A;  4S3O C;  4YBS A;  5B79 A;  2LDR A;  4W4U A;  4GB0 A;  5J3X A;  2LXP C;  5TRB A;  4S3O B;  4TKP B;  3U5P A;  2MD7 B;  2VJE B;  1DVP A;  3KV6 A;  5B75 A;  4PTB A;  2EOD A;  4FIP A;  5FB1 A;  4O64 A;  5TDW A;  4YBM A;  3FL2 A;  4AP4 A;  2VPG A;  2XEU A;  4UI9 B;  1T1H A;  1WEO A;  1WEW A;  2ECT A;  4LKA A;  3O37 A;  3KQI A;  2BAY A;  2YU4 A;  5FB0 A;  2JMJ A;  2K4D A;  4Q6F A;  3HCS A;  4A4C A;  3LRQ A;  4FJC A;  3MHS A;  2I50 A;  4P5O B;  2NAA A;  2LGL A;  5H9M A;  1VFY A;  2LQ6 A;  4FO9 A;  1F62 A;  2CKL A;  2H0D B;  1LDJ B;  3M63 A;  3L1X A;  5D1M B;  5JG6 A;  2ECG A;  4WZ3 B;  4A49 A;  2KRE A;  4B86 C;  5LCW B;  3VK6 A;  5H1T A;  2VPE A;  4L58 A;  3T7L A;  2KWN A;  4YAB A;  2YSM A;  3RPG C;  3LQH A;  5TDR A;  2VJF B;  3NG2 A;  2KYU A;  4A4B A;  5AIU A;  4A0C D;  3KV5 A;  1X4I A;  2QIC A;  3PUR A;  2YUC A;  4NN2 A;  3C5K A;  5KH3 A;  2Y1N A;  2F42 A;  4YAD A;  4UP5 A;  1WIM A;  4XI1 A;  4AUQ B;  5FEY A;  2LV9 A;  2M1R A;  3LQJ A;  3L11 A;  5LKZ A;  2G6Q A;  4V3K C;  2M85 A;  3O35 A;  2ECJ A;  5B8D A;  5D1L B;  4R8P K;  3HCT A;  3ZYQ A;  2CSZ A;  2K1J A;  4AYC A;  5TBN A;  3O33 A;  2Y1M A;  4ZDT A;  4YBT A;  2YYR A;  2KGG A;  3C6W A;  4QF2 A;  3IHP A;  1CHC A;  2PUY A;  4X3G A;  2HDP A;  5KH9 A;  2EA6 A;  2CKL B;  2YSJ A;  5G0F A;  5G04 B;  1WES A;  2G45 A;  2KE1 A;  1N87 A;  5G05 B;  2Y43 A;  4WA6 A;  3PHD A;  2YRE A;  3SOW A;  2FUI A;  2ECW A;  1VYX A;  3M99 A;  2ECV A;  1X4J A;  1HYI A;  4BHW A;  1JM7 A;  3O36 A;  3M62 A;  4FK5 A;  3RTR B;  4AVX A;  4PPE A;  2LN0 A;  2M6M A;  3N9Q A;  2E6S A;  5D1K B;  2L80 A;  2RI7 A;  1WEQ A;  1Z60 A;  4UP0 A;  3ZNI A;  1LDK C;  2MNY A;  4LAD B;  2MT5 A;  4I7D A;  3I2D A;  2VNF A;  4GNF A;  1FBV A;  4L7X A;  3U5M A;  1WEN A;  1MM2 A;  2DX8 A;  4YC9 A;  3O70 A;  1JOC A;  4N3W A;  5B76 A;  2KWK A;  2ECN A;  3U5O A;  1VD4 A;  5LKX A;  3PUQ A;  3SOU A;  2JRJ A;  4GNE A;  3RPG B;  3ASL A;  4AYC B;  2MUM A;  1WIL A;  3U5N A;  1WEP A;  3O34 A;  5H1V A;  4GND A;  3L1Z B;  2UZG A;  3O7A A;  3HTK C;  4LJN A;  2FUU A;  2JMI A;  5TAB A;  4GNG A;  4N4F A;  2K17 A;  2PNX A;  2K16 A;  3EB5 A;  3GV4 A;  2YUR A;  2MIQ A;  1WEM A;  1FP0 A;  1WEV A;  4YAT A;  2JMD A;  1IYM A;  3V43 A;  3QZV A;  1X4U A;  1K2F A;  2YHO A;  2QIZ A;  4R7E A;  1JM7 B;  1V87 A;  5C11 A;  4MVT A;  3KNV A;  1ZBD B;  2VJF A;  2KIZ A;  5DIN A;  2KU3 A;  3DQV R;  1WE9 A;  2YQL A;  2XB1 A;  4LLB A;  1XWH A;  2D8S A;  2M3H A;  5DKA A;  2MA5 A;  2RSD A;  2KGI A;  2E6R A;  2QJ0 A;  3ZVZ B;  3MHH A;  3N9N A;  2YT5 A;  2LXH C;  1MM3 A;  4MSX A;  1WGM A;  1BOR A;  2KWJ A;  2KR4 A;  1G25 A;  5AIT A;  1HYJ A;  2HYE D;  1U6G B;  2IDA A;  4F52 B;  2VP7 A;  2OXQ C;  4QF3 A;  4I7B A;  5EYA F;  4CA1 A;  2CT2 A;  3GL6 A; 
#chains in the Genus database with same CATH topology
 3DPL R;  1RMD A;  2VPB A;  5I3L A;  2C2V S;  3EB6 A;  1E4U A;  3ZTG A;  2L0B A;  2ECI A;  1WFK A;  2AN6 A;  2VJE A;  3H7H A;  2KWO A;  2LGK A;  1WEU A;  2LRI C;  2LGG A;  4C9Z A;  2F6N A;  5H1U A;  4V3L C;  2FSA A;  5B78 A;  4ZQL A;  4ZUX U;  2CRR A;  1Z6U A;  2G43 A;  4YAX A;  4Z0O A;  3T6R A;  2C2L A;  4IC3 A;  2KFT A;  5FER A;  3ZPV E;  3ZVY A;  2F6J A;  4IC2 A;  2MD8 C;  2MA6 A;  4QQ4 A;  2L43 A;  3HCU A;  2EGP A;  3N9M A;  5KH7 A;  3SHB A;  3LQI A;  2YHN A;  4I7C A;  4LK9 A;  5B77 A;  3N9P A;  2CSY A;  2KKY A;  5SVY A;  5C13 A;  2L5U A;  3SOX A;  2L75 A;  2H0D A;  2YQM A;  2LGV A;  1Z2Q A;  4WZ2 A;  2MNZ A;  3Q1D A;  5LKT A;  4B7Y C;  4CCG X;  1WEE A;  2ZET C;  3ZPV 1;  2VPD A;  4BBQ A;  2YW8 A;  2JUN A;  3N9O A;  5LKU A;  3N9L A;  4R2Y A;  4WZ0 A;  4S3O C;  4YBS A;  5B79 A;  2LDR A;  4W4U A;  4GB0 A;  5J3X A;  2LXP C;  3LJU X;  5TRB A;  3FAO A;  2M13 A;  4S3O B;  2CRW A;  4TKP B;  3U5P A;  2MD7 B;  2VJE B;  1DVP A;  3KV6 A;  4F1P A;  5B75 A;  4PTB A;  2EOD A;  4FIP A;  5FB1 A;  4O64 A;  5TDW A;  4YBM A;  3FL2 A;  4AP4 A;  2VPG A;  2XEU A;  4UI9 B;  1T1H A;  1WEO A;  1WEW A;  2ECT A;  4LKA A;  5SVI A;  3O37 A;  2D8U A;  3KQI A;  3M7K A;  2BAY A;  2LAU A;  2YU4 A;  5FB0 A;  2DJA A;  2JMJ A;  2K4D A;  4Q6F A;  3HCS A;  4A4C A;  3LRQ A;  4FJC A;  3MHS A;  2I50 A;  4P5O B;  2NAA A;  2LGL A;  5H9M A;  1VFY A;  2LQ6 A;  4FO9 A;  1F62 A;  2CKL A;  2H0D B;  1LDJ B;  3M63 A;  3L1X A;  5D1M B;  5JG6 A;  2ECG A;  4WZ3 B;  4A49 A;  2KRE A;  4B86 C;  5LCW B;  3O47 A;  3VK6 A;  5H1T A;  4OGE A;  2VPE A;  4L58 A;  2CON A;  3T7L A;  2KWN A;  4YAB A;  2YSM A;  3RPG C;  3LQH A;  5TDR A;  2VJF B;  3NG2 A;  2KYU A;  4A4B A;  3MDB C;  5AIU A;  4A0C D;  3KV5 A;  1X4I A;  2QIC A;  3PUR A;  2YUC A;  4NN2 A;  3C5K A;  5KH3 A;  1MBM A;  2Y1N A;  2F42 A;  4YAD A;  4UP5 A;  1WIM A;  4XI1 A;  4AUQ B;  5FEY A;  2LV9 A;  2M1R A;  3LQJ A;  3L11 A;  5LKZ A;  2G6Q A;  4V3K C;  2M85 A;  3O35 A;  2ECJ A;  5SVI B;  1DCQ A;  5B8D A;  5D1L B;  4R8P K;  3HCT A;  3ZYQ A;  2CSZ A;  2K1J A;  4AYC A;  3SUB A;  5TBN A;  3DWD A;  3O33 A;  2Y1M A;  4ZDT A;  4YBT A;  2YYR A;  2KGG A;  3C6W A;  4QF2 A;  2XOY A;  3IHP A;  1CHC A;  2PUY A;  4X3G A;  2HDP A;  5KH9 A;  2EA6 A;  3LVQ E;  2CKL B;  2JM3 A;  2YSJ A;  5G0F A;  5G04 B;  1WES A;  2G45 A;  2KE1 A;  1N87 A;  5G05 B;  2Y43 A;  2XP0 A;  4WA6 A;  2FD4 A;  3PHD A;  2YRE A;  3SOW A;  2FUI A;  2ECW A;  1VYX A;  3M99 A;  2ECV A;  4H9D A;  1X4J A;  1HYI A;  4BHW A;  1JM7 A;  2KKX A;  3O36 A;  3M62 A;  4FK5 A;  3RTR B;  4AVX A;  4PPE A;  2LN0 A;  2M6M A;  3N9Q A;  2E6S A;  4OGC A;  5D1K B;  2L80 A;  2RI7 A;  1WEQ A;  2DSM A;  2XOZ A;  1Z60 A;  4UP0 A;  3ZNI A;  1LDK C;  2MNY A;  2B0O E;  4LAD B;  2MT5 A;  3FJU B;  4I7D A;  3I2D A;  2VNF A;  4GNF A;  2EGM A;  1FBV A;  4L7X A;  3U5M A;  1WEN A;  1MM2 A;  2DX8 A;  4YC9 A;  3O70 A;  1JOC A;  4N3W A;  4Z0R A;  2RR4 A;  5B76 A;  3PLW A;  2KWK A;  2ECN A;  3U5O A;  3DDT A;  3E2D A;  1VD4 A;  5LKX A;  3PUQ A;  3SOU A;  2JRJ A;  4GNE A;  3RPG B;  3ASL A;  4AYC B;  2MUM A;  4O62 A;  1WIL A;  3U5N A;  1WEP A;  3O34 A;  5H1V A;  2XOC A;  3L1Z B;  4GND A;  2UZG A;  3O7A A;  3HTK C;  4LJN A;  2FUU A;  2JMI A;  5TAB A;  4GNG A;  4N4F A;  2K17 A;  2PNX A;  2YVR A;  2K16 A;  3EB5 A;  3GV4 A;  3LVR E;  2YUR A;  2MIQ A;  1WEM A;  1FP0 A;  2CSV A;  1WEV A;  4YAT A;  2JMD A;  1IYM A;  3V43 A;  3FEH A;  3QZV A;  2L7P A;  1X4U A;  1K2F A;  3JUE A;  2IQJ A;  2YHO A;  2QIZ A;  4R7E A;  2MKE A;  2EXU A;  1JM7 B;  1V87 A;  5C11 A;  4MVT A;  3KNV A;  1ZBD B;  2VJF A;  2KIZ A;  5DIN A;  2KU3 A;  3DQV R;  1WE9 A;  2YQL A;  4LLB A;  2XB1 A;  1XWH A;  2D8S A;  2M3H A;  2E61 A;  5K3Q A;  5DKA A;  2MA5 A;  3KDE C;  2RSD A;  2KGI A;  2E6R A;  2QJ0 A;  3LDY A;  3ZVZ B;  3MHH A;  3N9N A;  2YT5 A;  2OWA A;  2LXH C;  3T9K A;  1MM3 A;  2FFW A;  4MSX A;  1WGM A;  1BOR A;  2KWJ A;  5SVX A;  2KR4 A;  1G25 A;  5AIT A;  1HYJ A;  2HYE D;  1U6G B;  2IDA A;  4F52 B;  2VP7 A;  2OXQ C;  4QF3 A;  2P57 A;  4I7B A;  5EYA F;  4CA1 A;  2CT2 A;  3FM8 C;  3GL6 A;  3FAN A; 
#chains in the Genus database with same CATH homology
 3DPL R;  1RMD A;  2VPB A;  5I3L A;  2C2V S;  3EB6 A;  1E4U A;  3ZTG A;  2L0B A;  2ECI A;  1WFK A;  2AN6 A;  2VJE A;  2KWO A;  2LGK A;  1WEU A;  2LRI C;  2LGG A;  4C9Z A;  2F6N A;  5H1U A;  4V3L C;  2FSA A;  5B78 A;  4ZQL A;  4ZUX U;  1Z6U A;  2G43 A;  4YAX A;  3T6R A;  2C2L A;  4IC3 A;  2KFT A;  5FER A;  3ZPV E;  3ZVY A;  2F6J A;  4IC2 A;  2MD8 C;  2MA6 A;  2L43 A;  3HCU A;  2EGP A;  3N9M A;  5KH7 A;  3SHB A;  3LQI A;  2YHN A;  4I7C A;  4LK9 A;  5B77 A;  3N9P A;  2CSY A;  5C13 A;  2L5U A;  3SOX A;  2L75 A;  2H0D A;  2YQM A;  2LGV A;  1Z2Q A;  4WZ2 A;  2MNZ A;  5LKT A;  4B7Y C;  4CCG X;  1WEE A;  2ZET C;  3ZPV 1;  2VPD A;  4BBQ A;  2YW8 A;  3N9O A;  5LKU A;  3N9L A;  4R2Y A;  4WZ0 A;  4S3O C;  4YBS A;  5B79 A;  2LDR A;  4W4U A;  4GB0 A;  5J3X A;  2LXP C;  5TRB A;  4S3O B;  4TKP B;  3U5P A;  2MD7 B;  2VJE B;  1DVP A;  3KV6 A;  5B75 A;  4PTB A;  2EOD A;  4FIP A;  5FB1 A;  4O64 A;  5TDW A;  4YBM A;  3FL2 A;  4AP4 A;  2VPG A;  2XEU A;  4UI9 B;  1T1H A;  1WEO A;  1WEW A;  2ECT A;  4LKA A;  3O37 A;  3KQI A;  2BAY A;  2YU4 A;  5FB0 A;  2JMJ A;  2K4D A;  4Q6F A;  3HCS A;  4A4C A;  3LRQ A;  4FJC A;  3MHS A;  2I50 A;  4P5O B;  2NAA A;  2LGL A;  5H9M A;  1VFY A;  2LQ6 A;  4FO9 A;  1F62 A;  2CKL A;  2H0D B;  1LDJ B;  3M63 A;  3L1X A;  5D1M B;  5JG6 A;  2ECG A;  4WZ3 B;  4A49 A;  2KRE A;  4B86 C;  5LCW B;  3VK6 A;  5H1T A;  2VPE A;  4L58 A;  3T7L A;  2KWN A;  4YAB A;  2YSM A;  3RPG C;  3LQH A;  5TDR A;  2VJF B;  3NG2 A;  2KYU A;  4A4B A;  5AIU A;  4A0C D;  3KV5 A;  1X4I A;  2QIC A;  3PUR A;  2YUC A;  4NN2 A;  3C5K A;  5KH3 A;  2Y1N A;  2F42 A;  4YAD A;  4UP5 A;  1WIM A;  4XI1 A;  4AUQ B;  5FEY A;  2LV9 A;  2M1R A;  3LQJ A;  3L11 A;  5LKZ A;  2G6Q A;  4V3K C;  2M85 A;  3O35 A;  2ECJ A;  5B8D A;  5D1L B;  4R8P K;  3HCT A;  3ZYQ A;  2CSZ A;  2K1J A;  4AYC A;  5TBN A;  3O33 A;  2Y1M A;  4ZDT A;  4YBT A;  2YYR A;  2KGG A;  3C6W A;  4QF2 A;  3IHP A;  1CHC A;  2PUY A;  4X3G A;  2HDP A;  5KH9 A;  2EA6 A;  2CKL B;  2YSJ A;  5G0F A;  5G04 B;  1WES A;  2G45 A;  2KE1 A;  1N87 A;  5G05 B;  2Y43 A;  4WA6 A;  3PHD A;  2YRE A;  3SOW A;  2FUI A;  2ECW A;  1VYX A;  3M99 A;  2ECV A;  1X4J A;  1HYI A;  4BHW A;  1JM7 A;  3O36 A;  3M62 A;  4FK5 A;  3RTR B;  4AVX A;  4PPE A;  2LN0 A;  2M6M A;  3N9Q A;  2E6S A;  5D1K B;  2L80 A;  2RI7 A;  1WEQ A;  1Z60 A;  4UP0 A;  3ZNI A;  1LDK C;  2MNY A;  4LAD B;  2MT5 A;  4I7D A;  3I2D A;  2VNF A;  4GNF A;  1FBV A;  4L7X A;  3U5M A;  1WEN A;  1MM2 A;  2DX8 A;  4YC9 A;  3O70 A;  1JOC A;  4N3W A;  5B76 A;  2KWK A;  2ECN A;  3U5O A;  1VD4 A;  5LKX A;  3PUQ A;  3SOU A;  2JRJ A;  4GNE A;  3RPG B;  3ASL A;  4AYC B;  2MUM A;  1WIL A;  3U5N A;  1WEP A;  3O34 A;  5H1V A;  4GND A;  3L1Z B;  2UZG A;  3O7A A;  3HTK C;  4LJN A;  2FUU A;  2JMI A;  5TAB A;  4GNG A;  4N4F A;  2K17 A;  2PNX A;  2K16 A;  3EB5 A;  3GV4 A;  2YUR A;  2MIQ A;  1WEM A;  1FP0 A;  1WEV A;  4YAT A;  2JMD A;  1IYM A;  3V43 A;  3QZV A;  1X4U A;  1K2F A;  2YHO A;  2QIZ A;  4R7E A;  1JM7 B;  1V87 A;  5C11 A;  4MVT A;  3KNV A;  1ZBD B;  2VJF A;  2KIZ A;  5DIN A;  2KU3 A;  3DQV R;  1WE9 A;  2YQL A;  2XB1 A;  4LLB A;  1XWH A;  2D8S A;  2M3H A;  5DKA A;  2MA5 A;  2RSD A;  2KGI A;  2E6R A;  2QJ0 A;  3ZVZ B;  3MHH A;  3N9N A;  2YT5 A;  2LXH C;  1MM3 A;  4MSX A;  1WGM A;  1BOR A;  2KWJ A;  2KR4 A;  1G25 A;  5AIT A;  1HYJ A;  2HYE D;  1U6G B;  2IDA A;  4F52 B;  2VP7 A;  2OXQ C;  4QF3 A;  4I7B A;  5EYA F;  4CA1 A;  2CT2 A;  3GL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...