5AIUA

A complex of rnf4-ring domain, ubc13-ub (isopeptide crosslink)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
129
structure length
123
Chain Sequence
b'SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINRYHPIYIGSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKIYHPIYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF4
publication title Structural Basis for the Ring Catalyzed Synthesis of K63 Linked Ubiquitin Chains
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase/signaling protein
total genus 28
structure length 123
sequence length 129
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5aiuA00
1WILA 2RI7A 3QZVA 5KH7A 4ZUXU 1RMDA 2OXQC 3SHBA 2HYED 1WENA 5D1MB 4C9ZA 2ECJA 2L0BA 2VNFA 4BBQA 1VFYA 5D1LB 2VPGA 1IYMA 2Y1NA 4CCGX 4F52B 2KWNA 3HTKC 2YSJA 3O34A 2LQ6A 4MVTA 2KWKA 2C2VS 2YURA 3U5MA 3LQHA 1K2FA 1X4IA 2LV9A 5TBNA 1VD4A 2ECIA 4LLBA 3C6WA 3VK6A 2LN0A 1WEPA 2ZETC 5J3XA 1N87A 2LRIC 3N9LA 2LGLA 5H9MA 2M85A 5FEYA 4O64A 1LDJB 4A0CD 5H1UA 3SOXA 3L11A 4YBMA 2Y1MA 2YHNA 4S3OB 2H0DA 1Z2QA 4N3WA 3O37A 5B79A 5EYAF 3RTRB 4UI9B 2MT5A 5H1TA 1WIMA 2KREA 3ZVYA 1HYIA 3LRQA 3O35A 3PUQA 5B77A 2LDRA 2YT5A 3N9NA 3T7LA 2LGVA 2QIZA 4S3OC 5FB0A 3M62A 3ZNIA 2MIQA 4WZ3B 4GB0A 5B75A 2MNZA 3DPLR 3RPGB 4FJCA 2VP7A 5TDWA 1T1HA 2M1RA 2I50A 4I7CA 4R8PK 5LKZA 4YBSA 5H1VA 2CSZA 4FK5A 3EB5A 4YBTA 2KR4A 3L1ZB 2Y43A 2L5UA 2CSYA 2YQMA 2K16A 2M3HA 3RPGC 1WEVA 2KU3A 4NN2A 1FBVA 4AYCB 1WESA 4MSXA 4XI1A 1WGMA 2PUYA 2MNYA 1ZBDB 3EB6A 4AP4A 3LQIA 1JOCA 5LKXA 2ECNA 5LKUA 4W4UA 3ZTGA 1WE9A 4V3KC 2JMJA 5I3LA 2YQLA 2EGPA 2FSAA 5G0FA 2LGKA 3MHSA 4IC2A 2YYRA 3L1XA 2MUMA 2M6MA 5AITA 1XWHA 4UP5A 2IDAA 3U5OA 3DQVR 2VPEA 5KH3A 3O33A 3ZPVE 3PURA 4IC3A 4Q6FA 1X4UA 3PHDA 1JM7B 2YW8A 2KGGA 2KWOA 2ECTA 4GNDA 4FIPA 5TRBA 2VJEB 5B8DA 3O70A 2KYUA 2XB1A 3ZYQA 3O7AA 2AN6A 2HDPA 4GNGA 4LJNA 3V43A 5LCWB 1U6GB 2F6JA 5DKAA 2MD7B 1F62A 1WEWA 3GL6A 4AVXA 4FO9A 4I7DA 3M99A 2K1JA 1Z60A 2F42A 2KFTA 3ASLA 3MHHA 2VJEA 2K17A 1FP0A 2QJ0A 4YATA 4PPEA 3SOUA 2D8SA 2LGGA 2YUCA 2G45A 4WA6A 2CKLB 4YAXA 1WEOA 2KGIA 4N4FA 1G25A 2NAAA 1MM2A 5G05B 3ZPV1 2G6QA 5TABA 3FL2A 2RSDA 1WEEA 1BORA 1VYXA 5AIUA 2ECGA 5C13A 3SOWA 4X3GA 4TKPB 1X4JA 3IHPA 5B76A 2LXHC 4AUQB 2VPBA 2F6NA 4V3LC 4A49A 5JG6A 4I7BA 4ZDTA 3HCTA 4R7EA 4R2YA 2L80A 2L43A 4AYCA 2L75A 2VPDA 2EODA 2YSMA 2FUIA 2KIZA 3I2DA 1WEUA 3HCUA 5C11A 4LKAA 2E6SA 5TDRA 2H0DB 3ZVZB 2XEUA 2VJFB 3O36A 4UP0A 2MA6A 4LK9A 2KE1A 2CT2A 3LQJA 4A4BA 2FUUA 2UZGA 3U5NA 2C2LA 1WEMA 4YABA 4B7YC 4PTBA 2KWJA 5FERA 2JMDA 2K4DA 5G04B 2JMIA 2ECVA 2DX8A 4BHWA 2YHOA 3M63A 4LADB 5KH9A 4P5OB 2ECWA 2QICA 2YREA 1DVPA 5LKTA 2VJFA 2PNXA 2E6RA 1JM7A 3HCSA 3GV4A 3KV5A 4QF2A 3KNVA 2G43A 4L7XA 3N9PA 2YU4A 1MM3A 4YC9A 2LXPC 1WFKA 4YADA 5B78A 4GNFA 1WEQA 2JRJA 3NG2A 4GNEA 4WZ2A 4CA1A 4QF3A 4B86C 5DINA 2MD8C 4ZQLA 4WZ0A 2EA6A 1CHCA 2MA5A 5D1KB 5FB1A 4A4CA 3N9MA 3KV6A 3T6RA 3KQIA 1LDKC 1E4UA 3U5PA 1V87A 3C5KA 1Z6UA 3N9OA 2CKLA 3N9QA 4L58A 1HYJA 2BAYA
chains in the Genus database with same CATH superfamily
1WILA 2RI7A 3QZVA 5KH7A 4ZUXU 1RMDA 2OXQC 2B0OE 3SHBA 2HYED 1WENA 5D1MB 4C9ZA 2ECJA 2L0BA 3LVRE 2VNFA 4BBQA 1VFYA 5D1LB 2VPGA 1IYMA 2Y1NA 4CCGX 4F52B 4OGEA 2KWNA 3HTKC 2YSJA 2CSVA 3O34A 3M7KA 2LQ6A 4MVTA 2KWKA 2KKYA 2C2VS 2YURA 3U5MA 3LQHA 1K2FA 1X4IA 2LV9A 5SVXA 2DSMA 5TBNA 1VD4A 2ECIA 4LLBA 3C6WA 3VK6A 2LN0A 1WEPA 2L7PA 2ZETC 5J3XA 1N87A 2LRIC 3H7HA 3N9LA 2LGLA 5H9MA 2M85A 5FEYA 3LJUX 4O64A 1LDJB 4A0CD 5H1UA 3SOXA 3L11A 5K3QA 4YBMA 2Y1MA 2YHNA 4S3OB 2H0DA 1Z2QA 4N3WA 3O37A 5B79A 5EYAF 3RTRB 4UI9B 2MT5A 5H1TA 1WIMA 2KREA 3ZVYA 1HYIA 3LRQA 3FM8C 3O35A 3PUQA 5B77A 2LDRA 2YT5A 3N9NA 2LGVA 2QIZA 4S3OC 3T7LA 5FB0A 3M62A 3ZNIA 2MIQA 4WZ3B 3JUEA 4GB0A 5B75A 2MNZA 3DPLR 3RPGB 4FJCA 2VP7A 5TDWA 1T1HA 2M1RA 2I50A 4I7CA 4R8PK 5LKZA 4YBSA 5H1VA 2CSZA 4FK5A 3EB5A 4YBTA 2KR4A 4Z0RA 3O47A 3L1ZB 2Y43A 4Z0OA 2L5UA 2CSYA 2YQMA 2K16A 2M3HA 3RPGC 3KDEC 2CONA 2MKEA 1WEVA 2KU3A 4NN2A 1FBVA 3LDYA 4AYCB 2JM3A 1WESA 4MSXA 4XI1A 1WGMA 3DDTA 2PUYA 2MNYA 1ZBDB 3EB6A 4AP4A 3FJUB 1DCQA 3LQIA 1JOCA 5LKXA 2ECNA 5LKUA 4W4UA 3ZTGA 1WE9A 4V3KC 2FFWA 4QQ4A 4OGCA 2JMJA 5I3LA 2YQLA 2EGPA 2FSAA 5G0FA 2LGKA 3MHSA 4IC2A 2YYRA 3L1XA 2MUMA 2M6MA 5AITA 1XWHA 4UP5A 2IDAA 3U5OA 3DQVR 2VPEA 5KH3A 3O33A 3ZPVE 3PURA 4IC3A 4Q6FA 1X4UA 3PHDA 1JM7B 2YW8A 2KGGA 2KWOA 1MBMA 2ECTA 4GNDA 4FIPA 5TRBA 3Q1DA 2VJEB 5B8DA 3O70A 2KYUA 2XB1A 3ZYQA 3O7AA 2AN6A 2HDPA 4GNGA 3E2DA 4LJNA 5LCWB 3V43A 1U6GB 2F6JA 5DKAA 2MD7B 1F62A 1WEWA 3GL6A 3T9KA 4AVXA 2IQJA 4FO9A 4I7DA 3M99A 2K1JA 1Z60A 2F42A 5SVYA 2KFTA 3ASLA 3MHHA 2XOYA 2VJEA 2K17A 1FP0A 2EXUA 2QJ0A 4YATA 4PPEA 3SOUA 2D8SA 2LGGA 3DWDA 2M13A 2XOCA 2YUCA 2G45A 4F1PA 4WA6A 2CKLB 4YAXA 1WEOA 4O62A 2KGIA 4N4FA 1G25A 2NAAA 1MM2A 5G05B 2CRWA 3SUBA 3FANA 3ZPV1 2EGMA 2G6QA 5TABA 3FL2A 2RSDA 1WEEA 2D8UA 1BORA 2KKXA 1VYXA 5AIUA 5SVIB 2ECGA 5C13A 3SOWA 4X3GA 2DJAA 4TKPB 1X4JA 3IHPA 5B76A 2LXHC 4AUQB 2VPBA 2F6NA 4V3LC 4A49A 5JG6A 4I7BA 4ZDTA 3HCTA 4R7EA 4R2YA 2L80A 2L43A 4AYCA 2L75A 2VPDA 2EODA 2YSMA 2FUIA 5SVIA 2KIZA 3I2DA 2XOZA 1WEUA 3HCUA 5C11A 4LKAA 2E6SA 5TDRA 2H0DB 3ZVZB 2XEUA 2VJFB 3O36A 3PLWA 2P57A 4UP0A 2OWAA 2MA6A 4LK9A 2KE1A 2CT2A 3LQJA 4A4BA 2FUUA 2UZGA 3U5NA 2C2LA 1WEMA 4YABA 4B7YC 4PTBA 2KWJA 5FERA 2JMDA 2K4DA 2E61A 5G04B 2JMIA 2ECVA 2DX8A 4BHWA 2YHOA 3M63A 4LADB 5KH9A 2FD4A 4P5OB 2ECWA 2QICA 2YREA 1DVPA 5LKTA 2VJFA 2RR4A 2PNXA 2E6RA 1JM7A 3HCSA 3GV4A 3KV5A 4QF2A 3KNVA 2G43A 4L7XA 3N9PA 2YU4A 1MM3A 4YC9A 2LXPC 1WFKA 2CRRA 4YADA 5B78A 4GNFA 1WEQA 2JRJA 3NG2A 4GNEA 4WZ2A 4CA1A 3FEHA 4QF3A 4B86C 5DINA 2MD8C 2XP0A 4ZQLA 4WZ0A 2JUNA 2EA6A 1CHCA 2MA5A 5D1KB 5FB1A 3LVQE 4A4CA 2LAUA 3N9MA 3KV6A 3T6RA 3KQIA 2YVRA 1LDKC 1E4UA 3U5PA 1V87A 4H9DA 3C5KA 3FAOA 1Z6UA 3N9OA 3MDBC 2CKLA 3N9QA 4L58A 1HYJA 2BAYA
chains in the Genus database with same CATH topology
1WILA 2RI7A 3QZVA 5KH7A 4ZUXU 1RMDA 2OXQC 3SHBA 2HYED 1WENA 5D1MB 4C9ZA 2ECJA 2L0BA 2VNFA 4BBQA 1VFYA 5D1LB 2VPGA 1IYMA 2Y1NA 4CCGX 4F52B 2KWNA 3HTKC 2YSJA 3O34A 2LQ6A 4MVTA 2KWKA 2C2VS 2YURA 3U5MA 3LQHA 1K2FA 1X4IA 2LV9A 5TBNA 1VD4A 2ECIA 4LLBA 3C6WA 3VK6A 2LN0A 1WEPA 2ZETC 5J3XA 1N87A 2LRIC 3N9LA 2LGLA 5H9MA 2M85A 5FEYA 4O64A 1LDJB 4A0CD 5H1UA 3SOXA 3L11A 4YBMA 2Y1MA 2YHNA 4S3OB 2H0DA 1Z2QA 4N3WA 3O37A 5B79A 5EYAF 3RTRB 4UI9B 2MT5A 5H1TA 1WIMA 2KREA 3ZVYA 1HYIA 3LRQA 3O35A 3PUQA 5B77A 2LDRA 2YT5A 3N9NA 3T7LA 2LGVA 2QIZA 4S3OC 5FB0A 3M62A 3ZNIA 2MIQA 4WZ3B 4GB0A 5B75A 2MNZA 3DPLR 3RPGB 4FJCA 2VP7A 5TDWA 1T1HA 2M1RA 2I50A 4I7CA 4R8PK 5LKZA 4YBSA 5H1VA 2CSZA 4FK5A 3EB5A 4YBTA 2KR4A 3L1ZB 2Y43A 2L5UA 2CSYA 2YQMA 2K16A 2M3HA 3RPGC 1WEVA 2KU3A 4NN2A 1FBVA 4AYCB 1WESA 4MSXA 4XI1A 1WGMA 2PUYA 2MNYA 1ZBDB 3EB6A 4AP4A 3LQIA 1JOCA 5LKXA 2ECNA 5LKUA 4W4UA 3ZTGA 1WE9A 4V3KC 2JMJA 5I3LA 2YQLA 2EGPA 2FSAA 5G0FA 2LGKA 3MHSA 4IC2A 2YYRA 3L1XA 2MUMA 2M6MA 5AITA 1XWHA 4UP5A 2IDAA 3U5OA 3DQVR 2VPEA 5KH3A 3O33A 3ZPVE 3PURA 4IC3A 4Q6FA 1X4UA 3PHDA 1JM7B 2YW8A 2KGGA 2KWOA 2ECTA 4GNDA 4FIPA 5TRBA 2VJEB 5B8DA 3O70A 2KYUA 2XB1A 3ZYQA 3O7AA 2AN6A 2HDPA 4GNGA 4LJNA 3V43A 5LCWB 1U6GB 2F6JA 5DKAA 2MD7B 1F62A 1WEWA 3GL6A 4AVXA 4FO9A 4I7DA 3M99A 2K1JA 1Z60A 2F42A 2KFTA 3ASLA 3MHHA 2VJEA 2K17A 1FP0A 2QJ0A 4YATA 4PPEA 3SOUA 2D8SA 2LGGA 2YUCA 2G45A 4WA6A 2CKLB 4YAXA 1WEOA 2KGIA 4N4FA 1G25A 2NAAA 1MM2A 5G05B 3ZPV1 2G6QA 5TABA 3FL2A 2RSDA 1WEEA 1BORA 1VYXA 5AIUA 2ECGA 5C13A 3SOWA 4X3GA 4TKPB 1X4JA 3IHPA 5B76A 2LXHC 4AUQB 2VPBA 2F6NA 4V3LC 4A49A 5JG6A 4I7BA 4ZDTA 3HCTA 4R7EA 4R2YA 2L80A 2L43A 4AYCA 2L75A 2VPDA 2EODA 2YSMA 2FUIA 2KIZA 3I2DA 1WEUA 3HCUA 5C11A 4LKAA 2E6SA 5TDRA 2H0DB 3ZVZB 2XEUA 2VJFB 3O36A 4UP0A 2MA6A 4LK9A 2KE1A 2CT2A 3LQJA 4A4BA 2FUUA 2UZGA 3U5NA 2C2LA 1WEMA 4YABA 4B7YC 4PTBA 2KWJA 5FERA 2JMDA 2K4DA 5G04B 2JMIA 2ECVA 2DX8A 4BHWA 2YHOA 3M63A 4LADB 5KH9A 4P5OB 2ECWA 2QICA 2YREA 1DVPA 5LKTA 2VJFA 2PNXA 2E6RA 1JM7A 3HCSA 3GV4A 3KV5A 4QF2A 3KNVA 2G43A 4L7XA 3N9PA 2YU4A 1MM3A 4YC9A 2LXPC 1WFKA 4YADA 5B78A 4GNFA 1WEQA 2JRJA 3NG2A 4GNEA 4WZ2A 4CA1A 4QF3A 4B86C 5DINA 2MD8C 4ZQLA 4WZ0A 2EA6A 1CHCA 2MA5A 5D1KB 5FB1A 4A4CA 3N9MA 3KV6A 3T6RA 3KQIA 1LDKC 1E4UA 3U5PA 1V87A 3C5KA 1Z6UA 3N9OA 2CKLA 3N9QA 4L58A 1HYJA 2BAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIL A;  2RI7 A;  3QZV A;  5KH7 A;  4ZUX U;  1RMD A;  2OXQ C;  3SHB A;  2HYE D;  1WEN A;  5D1M B;  4C9Z A;  2ECJ A;  2L0B A;  2VNF A;  4BBQ A;  1VFY A;  5D1L B;  2VPG A;  1IYM A;  2Y1N A;  4CCG X;  4F52 B;  2KWN A;  3HTK C;  2YSJ A;  3O34 A;  2LQ6 A;  4MVT A;  2KWK A;  2C2V S;  2YUR A;  3U5M A;  3LQH A;  1K2F A;  1X4I A;  2LV9 A;  5TBN A;  1VD4 A;  2ECI A;  4LLB A;  3C6W A;  3VK6 A;  2LN0 A;  1WEP A;  2ZET C;  5J3X A;  1N87 A;  2LRI C;  3N9L A;  2LGL A;  5H9M A;  2M85 A;  5FEY A;  4O64 A;  1LDJ B;  4A0C D;  5H1U A;  3SOX A;  3L11 A;  4YBM A;  2Y1M A;  2YHN A;  4S3O B;  2H0D A;  1Z2Q A;  4N3W A;  3O37 A;  5B79 A;  5EYA F;  3RTR B;  4UI9 B;  2MT5 A;  5H1T A;  1WIM A;  2KRE A;  3ZVY A;  1HYI A;  3LRQ A;  3O35 A;  3PUQ A;  5B77 A;  2LDR A;  2YT5 A;  3N9N A;  3T7L A;  2LGV A;  2QIZ A;  4S3O C;  5FB0 A;  3M62 A;  3ZNI A;  2MIQ A;  4WZ3 B;  4GB0 A;  5B75 A;  2MNZ A;  3DPL R;  3RPG B;  4FJC A;  2VP7 A;  5TDW A;  1T1H A;  2M1R A;  2I50 A;  4I7C A;  4R8P K;  5LKZ A;  4YBS A;  5H1V A;  2CSZ A;  4FK5 A;  3EB5 A;  4YBT A;  2KR4 A;  3L1Z B;  2Y43 A;  2L5U A;  2CSY A;  2YQM A;  2K16 A;  2M3H A;  3RPG C;  1WEV A;  2KU3 A;  4NN2 A;  1FBV A;  4AYC B;  1WES A;  4MSX A;  4XI1 A;  1WGM A;  2PUY A;  2MNY A;  1ZBD B;  3EB6 A;  4AP4 A;  3LQI A;  1JOC A;  5LKX A;  2ECN A;  5LKU A;  4W4U A;  3ZTG A;  1WE9 A;  4V3K C;  2JMJ A;  5I3L A;  2YQL A;  2EGP A;  2FSA A;  5G0F A;  2LGK A;  3MHS A;  4IC2 A;  2YYR A;  3L1X A;  2MUM A;  2M6M A;  5AIT A;  1XWH A;  4UP5 A;  2IDA A;  3U5O A;  3DQV R;  2VPE A;  5KH3 A;  3O33 A;  3ZPV E;  3PUR A;  4IC3 A;  4Q6F A;  1X4U A;  3PHD A;  1JM7 B;  2YW8 A;  2KGG A;  2KWO A;  2ECT A;  4GND A;  4FIP A;  5TRB A;  2VJE B;  5B8D A;  3O70 A;  2KYU A;  2XB1 A;  3ZYQ A;  3O7A A;  2AN6 A;  2HDP A;  4GNG A;  4LJN A;  3V43 A;  5LCW B;  1U6G B;  2F6J A;  5DKA A;  2MD7 B;  1F62 A;  1WEW A;  3GL6 A;  4AVX A;  4FO9 A;  4I7D A;  3M99 A;  2K1J A;  1Z60 A;  2F42 A;  2KFT A;  3ASL A;  3MHH A;  2VJE A;  2K17 A;  1FP0 A;  2QJ0 A;  4YAT A;  4PPE A;  3SOU A;  2D8S A;  2LGG A;  2YUC A;  2G45 A;  4WA6 A;  2CKL B;  4YAX A;  1WEO A;  2KGI A;  4N4F A;  1G25 A;  2NAA A;  1MM2 A;  5G05 B;  3ZPV 1;  2G6Q A;  5TAB A;  3FL2 A;  2RSD A;  1WEE A;  1BOR A;  1VYX A;  5AIU A;  2ECG A;  5C13 A;  3SOW A;  4X3G A;  4TKP B;  1X4J A;  3IHP A;  5B76 A;  2LXH C;  4AUQ B;  2VPB A;  2F6N A;  4V3L C;  4A49 A;  5JG6 A;  4I7B A;  4ZDT A;  3HCT A;  4R7E A;  4R2Y A;  2L80 A;  2L43 A;  4AYC A;  2L75 A;  2VPD A;  2EOD A;  2YSM A;  2FUI A;  2KIZ A;  3I2D A;  1WEU A;  3HCU A;  5C11 A;  4LKA A;  2E6S A;  5TDR A;  2H0D B;  3ZVZ B;  2XEU A;  2VJF B;  3O36 A;  4UP0 A;  2MA6 A;  4LK9 A;  2KE1 A;  2CT2 A;  3LQJ A;  4A4B A;  2FUU A;  2UZG A;  3U5N A;  2C2L A;  1WEM A;  4YAB A;  4B7Y C;  4PTB A;  2KWJ A;  5FER A;  2JMD A;  2K4D A;  5G04 B;  2JMI A;  2ECV A;  2DX8 A;  4BHW A;  2YHO A;  3M63 A;  4LAD B;  5KH9 A;  4P5O B;  2ECW A;  2QIC A;  2YRE A;  1DVP A;  5LKT A;  2VJF A;  2PNX A;  2E6R A;  1JM7 A;  3HCS A;  3GV4 A;  3KV5 A;  4QF2 A;  3KNV A;  2G43 A;  4L7X A;  3N9P A;  2YU4 A;  1MM3 A;  4YC9 A;  2LXP C;  1WFK A;  4YAD A;  5B78 A;  4GNF A;  1WEQ A;  2JRJ A;  3NG2 A;  4GNE A;  4WZ2 A;  4CA1 A;  4QF3 A;  4B86 C;  5DIN A;  2MD8 C;  4ZQL A;  4WZ0 A;  2EA6 A;  1CHC A;  2MA5 A;  5D1K B;  5FB1 A;  4A4C A;  3N9M A;  3KV6 A;  3T6R A;  3KQI A;  1LDK C;  1E4U A;  3U5P A;  1V87 A;  3C5K A;  1Z6U A;  3N9O A;  2CKL A;  3N9Q A;  4L58 A;  1HYJ A;  2BAY A; 
#chains in the Genus database with same CATH topology
 1WIL A;  2RI7 A;  3QZV A;  5KH7 A;  4ZUX U;  1RMD A;  2OXQ C;  2B0O E;  3SHB A;  2HYE D;  1WEN A;  5D1M B;  4C9Z A;  2ECJ A;  2L0B A;  3LVR E;  2VNF A;  4BBQ A;  1VFY A;  5D1L B;  2VPG A;  1IYM A;  2Y1N A;  4CCG X;  4F52 B;  4OGE A;  2KWN A;  3HTK C;  2YSJ A;  2CSV A;  3O34 A;  3M7K A;  2LQ6 A;  4MVT A;  2KWK A;  2KKY A;  2C2V S;  2YUR A;  3U5M A;  3LQH A;  1K2F A;  1X4I A;  2LV9 A;  5SVX A;  2DSM A;  5TBN A;  1VD4 A;  2ECI A;  4LLB A;  3C6W A;  3VK6 A;  2LN0 A;  1WEP A;  2L7P A;  2ZET C;  5J3X A;  1N87 A;  2LRI C;  3H7H A;  3N9L A;  2LGL A;  5H9M A;  2M85 A;  5FEY A;  3LJU X;  4O64 A;  1LDJ B;  4A0C D;  5H1U A;  3SOX A;  3L11 A;  5K3Q A;  4YBM A;  2Y1M A;  2YHN A;  4S3O B;  2H0D A;  1Z2Q A;  4N3W A;  3O37 A;  5B79 A;  5EYA F;  3RTR B;  4UI9 B;  2MT5 A;  5H1T A;  1WIM A;  2KRE A;  3ZVY A;  1HYI A;  3LRQ A;  3FM8 C;  3O35 A;  3PUQ A;  5B77 A;  2LDR A;  2YT5 A;  3N9N A;  2LGV A;  2QIZ A;  4S3O C;  3T7L A;  5FB0 A;  3M62 A;  3ZNI A;  2MIQ A;  4WZ3 B;  3JUE A;  4GB0 A;  5B75 A;  2MNZ A;  3DPL R;  3RPG B;  4FJC A;  2VP7 A;  5TDW A;  1T1H A;  2M1R A;  2I50 A;  4I7C A;  4R8P K;  5LKZ A;  4YBS A;  5H1V A;  2CSZ A;  4FK5 A;  3EB5 A;  4YBT A;  2KR4 A;  4Z0R A;  3O47 A;  3L1Z B;  2Y43 A;  4Z0O A;  2L5U A;  2CSY A;  2YQM A;  2K16 A;  2M3H A;  3RPG C;  3KDE C;  2CON A;  2MKE A;  1WEV A;  2KU3 A;  4NN2 A;  1FBV A;  3LDY A;  4AYC B;  2JM3 A;  1WES A;  4MSX A;  4XI1 A;  1WGM A;  3DDT A;  2PUY A;  2MNY A;  1ZBD B;  3EB6 A;  4AP4 A;  3FJU B;  1DCQ A;  3LQI A;  1JOC A;  5LKX A;  2ECN A;  5LKU A;  4W4U A;  3ZTG A;  1WE9 A;  4V3K C;  2FFW A;  4QQ4 A;  4OGC A;  2JMJ A;  5I3L A;  2YQL A;  2EGP A;  2FSA A;  5G0F A;  2LGK A;  3MHS A;  4IC2 A;  2YYR A;  3L1X A;  2MUM A;  2M6M A;  5AIT A;  1XWH A;  4UP5 A;  2IDA A;  3U5O A;  3DQV R;  2VPE A;  5KH3 A;  3O33 A;  3ZPV E;  3PUR A;  4IC3 A;  4Q6F A;  1X4U A;  3PHD A;  1JM7 B;  2YW8 A;  2KGG A;  2KWO A;  1MBM A;  2ECT A;  4GND A;  4FIP A;  5TRB A;  3Q1D A;  2VJE B;  5B8D A;  3O70 A;  2KYU A;  2XB1 A;  3ZYQ A;  3O7A A;  2AN6 A;  2HDP A;  4GNG A;  3E2D A;  4LJN A;  5LCW B;  3V43 A;  1U6G B;  2F6J A;  5DKA A;  2MD7 B;  1F62 A;  1WEW A;  3GL6 A;  3T9K A;  4AVX A;  2IQJ A;  4FO9 A;  4I7D A;  3M99 A;  2K1J A;  1Z60 A;  2F42 A;  5SVY A;  2KFT A;  3ASL A;  3MHH A;  2XOY A;  2VJE A;  2K17 A;  1FP0 A;  2EXU A;  2QJ0 A;  4YAT A;  4PPE A;  3SOU A;  2D8S A;  2LGG A;  3DWD A;  2M13 A;  2XOC A;  2YUC A;  2G45 A;  4F1P A;  4WA6 A;  2CKL B;  4YAX A;  1WEO A;  4O62 A;  2KGI A;  4N4F A;  1G25 A;  2NAA A;  1MM2 A;  5G05 B;  2CRW A;  3SUB A;  3FAN A;  3ZPV 1;  2EGM A;  2G6Q A;  5TAB A;  3FL2 A;  2RSD A;  1WEE A;  2D8U A;  1BOR A;  2KKX A;  1VYX A;  5AIU A;  5SVI B;  2ECG A;  5C13 A;  3SOW A;  4X3G A;  2DJA A;  4TKP B;  1X4J A;  3IHP A;  5B76 A;  2LXH C;  4AUQ B;  2VPB A;  2F6N A;  4V3L C;  4A49 A;  5JG6 A;  4I7B A;  4ZDT A;  3HCT A;  4R7E A;  4R2Y A;  2L80 A;  2L43 A;  4AYC A;  2L75 A;  2VPD A;  2EOD A;  2YSM A;  2FUI A;  5SVI A;  2KIZ A;  3I2D A;  2XOZ A;  1WEU A;  3HCU A;  5C11 A;  4LKA A;  2E6S A;  5TDR A;  2H0D B;  3ZVZ B;  2XEU A;  2VJF B;  3O36 A;  3PLW A;  2P57 A;  4UP0 A;  2OWA A;  2MA6 A;  4LK9 A;  2KE1 A;  2CT2 A;  3LQJ A;  4A4B A;  2FUU A;  2UZG A;  3U5N A;  2C2L A;  1WEM A;  4YAB A;  4B7Y C;  4PTB A;  2KWJ A;  5FER A;  2JMD A;  2K4D A;  2E61 A;  5G04 B;  2JMI A;  2ECV A;  2DX8 A;  4BHW A;  2YHO A;  3M63 A;  4LAD B;  5KH9 A;  2FD4 A;  4P5O B;  2ECW A;  2QIC A;  2YRE A;  1DVP A;  5LKT A;  2VJF A;  2RR4 A;  2PNX A;  2E6R A;  1JM7 A;  3HCS A;  3GV4 A;  3KV5 A;  4QF2 A;  3KNV A;  2G43 A;  4L7X A;  3N9P A;  2YU4 A;  1MM3 A;  4YC9 A;  2LXP C;  1WFK A;  2CRR A;  4YAD A;  5B78 A;  4GNF A;  1WEQ A;  2JRJ A;  3NG2 A;  4GNE A;  4WZ2 A;  4CA1 A;  3FEH A;  4QF3 A;  4B86 C;  5DIN A;  2MD8 C;  2XP0 A;  4ZQL A;  4WZ0 A;  2JUN A;  2EA6 A;  1CHC A;  2MA5 A;  5D1K B;  5FB1 A;  3LVQ E;  4A4C A;  2LAU A;  3N9M A;  3KV6 A;  3T6R A;  3KQI A;  2YVR A;  1LDK C;  1E4U A;  3U5P A;  1V87 A;  4H9D A;  3C5K A;  3FAO A;  1Z6U A;  3N9O A;  3MDB C;  2CKL A;  3N9Q A;  4L58 A;  1HYJ A;  2BAY A; 
#chains in the Genus database with same CATH homology
 1WIL A;  2RI7 A;  3QZV A;  5KH7 A;  4ZUX U;  1RMD A;  2OXQ C;  3SHB A;  2HYE D;  1WEN A;  5D1M B;  4C9Z A;  2ECJ A;  2L0B A;  2VNF A;  4BBQ A;  1VFY A;  5D1L B;  2VPG A;  1IYM A;  2Y1N A;  4CCG X;  4F52 B;  2KWN A;  3HTK C;  2YSJ A;  3O34 A;  2LQ6 A;  4MVT A;  2KWK A;  2C2V S;  2YUR A;  3U5M A;  3LQH A;  1K2F A;  1X4I A;  2LV9 A;  5TBN A;  1VD4 A;  2ECI A;  4LLB A;  3C6W A;  3VK6 A;  2LN0 A;  1WEP A;  2ZET C;  5J3X A;  1N87 A;  2LRI C;  3N9L A;  2LGL A;  5H9M A;  2M85 A;  5FEY A;  4O64 A;  1LDJ B;  4A0C D;  5H1U A;  3SOX A;  3L11 A;  4YBM A;  2Y1M A;  2YHN A;  4S3O B;  2H0D A;  1Z2Q A;  4N3W A;  3O37 A;  5B79 A;  5EYA F;  3RTR B;  4UI9 B;  2MT5 A;  5H1T A;  1WIM A;  2KRE A;  3ZVY A;  1HYI A;  3LRQ A;  3O35 A;  3PUQ A;  5B77 A;  2LDR A;  2YT5 A;  3N9N A;  3T7L A;  2LGV A;  2QIZ A;  4S3O C;  5FB0 A;  3M62 A;  3ZNI A;  2MIQ A;  4WZ3 B;  4GB0 A;  5B75 A;  2MNZ A;  3DPL R;  3RPG B;  4FJC A;  2VP7 A;  5TDW A;  1T1H A;  2M1R A;  2I50 A;  4I7C A;  4R8P K;  5LKZ A;  4YBS A;  5H1V A;  2CSZ A;  4FK5 A;  3EB5 A;  4YBT A;  2KR4 A;  3L1Z B;  2Y43 A;  2L5U A;  2CSY A;  2YQM A;  2K16 A;  2M3H A;  3RPG C;  1WEV A;  2KU3 A;  4NN2 A;  1FBV A;  4AYC B;  1WES A;  4MSX A;  4XI1 A;  1WGM A;  2PUY A;  2MNY A;  1ZBD B;  3EB6 A;  4AP4 A;  3LQI A;  1JOC A;  5LKX A;  2ECN A;  5LKU A;  4W4U A;  3ZTG A;  1WE9 A;  4V3K C;  2JMJ A;  5I3L A;  2YQL A;  2EGP A;  2FSA A;  5G0F A;  2LGK A;  3MHS A;  4IC2 A;  2YYR A;  3L1X A;  2MUM A;  2M6M A;  5AIT A;  1XWH A;  4UP5 A;  2IDA A;  3U5O A;  3DQV R;  2VPE A;  5KH3 A;  3O33 A;  3ZPV E;  3PUR A;  4IC3 A;  4Q6F A;  1X4U A;  3PHD A;  1JM7 B;  2YW8 A;  2KGG A;  2KWO A;  2ECT A;  4GND A;  4FIP A;  5TRB A;  2VJE B;  5B8D A;  3O70 A;  2KYU A;  2XB1 A;  3ZYQ A;  3O7A A;  2AN6 A;  2HDP A;  4GNG A;  4LJN A;  3V43 A;  5LCW B;  1U6G B;  2F6J A;  5DKA A;  2MD7 B;  1F62 A;  1WEW A;  3GL6 A;  4AVX A;  4FO9 A;  4I7D A;  3M99 A;  2K1J A;  1Z60 A;  2F42 A;  2KFT A;  3ASL A;  3MHH A;  2VJE A;  2K17 A;  1FP0 A;  2QJ0 A;  4YAT A;  4PPE A;  3SOU A;  2D8S A;  2LGG A;  2YUC A;  2G45 A;  4WA6 A;  2CKL B;  4YAX A;  1WEO A;  2KGI A;  4N4F A;  1G25 A;  2NAA A;  1MM2 A;  5G05 B;  3ZPV 1;  2G6Q A;  5TAB A;  3FL2 A;  2RSD A;  1WEE A;  1BOR A;  1VYX A;  5AIU A;  2ECG A;  5C13 A;  3SOW A;  4X3G A;  4TKP B;  1X4J A;  3IHP A;  5B76 A;  2LXH C;  4AUQ B;  2VPB A;  2F6N A;  4V3L C;  4A49 A;  5JG6 A;  4I7B A;  4ZDT A;  3HCT A;  4R7E A;  4R2Y A;  2L80 A;  2L43 A;  4AYC A;  2L75 A;  2VPD A;  2EOD A;  2YSM A;  2FUI A;  2KIZ A;  3I2D A;  1WEU A;  3HCU A;  5C11 A;  4LKA A;  2E6S A;  5TDR A;  2H0D B;  3ZVZ B;  2XEU A;  2VJF B;  3O36 A;  4UP0 A;  2MA6 A;  4LK9 A;  2KE1 A;  2CT2 A;  3LQJ A;  4A4B A;  2FUU A;  2UZG A;  3U5N A;  2C2L A;  1WEM A;  4YAB A;  4B7Y C;  4PTB A;  2KWJ A;  5FER A;  2JMD A;  2K4D A;  5G04 B;  2JMI A;  2ECV A;  2DX8 A;  4BHW A;  2YHO A;  3M63 A;  4LAD B;  5KH9 A;  4P5O B;  2ECW A;  2QIC A;  2YRE A;  1DVP A;  5LKT A;  2VJF A;  2PNX A;  2E6R A;  1JM7 A;  3HCS A;  3GV4 A;  3KV5 A;  4QF2 A;  3KNV A;  2G43 A;  4L7X A;  3N9P A;  2YU4 A;  1MM3 A;  4YC9 A;  2LXP C;  1WFK A;  4YAD A;  5B78 A;  4GNF A;  1WEQ A;  2JRJ A;  3NG2 A;  4GNE A;  4WZ2 A;  4CA1 A;  4QF3 A;  4B86 C;  5DIN A;  2MD8 C;  4ZQL A;  4WZ0 A;  2EA6 A;  1CHC A;  2MA5 A;  5D1K B;  5FB1 A;  4A4C A;  3N9M A;  3KV6 A;  3T6R A;  3KQI A;  1LDK C;  1E4U A;  3U5P A;  1V87 A;  3C5K A;  1Z6U A;  3N9O A;  2CKL A;  3N9Q A;  4L58 A;  1HYJ A;  2BAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...