2LGGA

Structure of phd domain of uhrf1 in complex with h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/dna binding protein
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lggA00
4YAXA 3U5MA 4AVXA 4X3GA 3L11A 2MD7B 4WZ3B 4ZQLA 4YADA 4B86C 3T6RA 5B75A 2HDPA 2ECVA 3RPGC 3RPGB 2Y1NA 4PPEA 4GNDA 5D1KB 4FJCA 4A49A 2K1JA 2YREA 5FB1A 1LDKC 2XEUA 3ZNIA 5H1TA 5I3LA 3ZYQA 2LV9A 5TABA 2LQ6A 3HCUA 2EODA 2EGPA 3QZVA 4LKAA 2F42A 2LGKA 3I2DA 2K4DA 2VPDA 5TDWA 2F6NA 4GNGA 3U5PA 1N87A 1K2FA 3O35A 2KIZA 2NAAA 1VFYA 2VNFA 2L43A 2MUMA 2OXQC 2YSJA 4LADB 2LN0A 2ECJA 3N9LA 2LDRA 2F6JA 4QF2A 3O7AA 2M6MA 4FO9A 2YQLA 3ASLA 3HCSA 3KQIA 4GNFA 4Q6FA 4AYCB 5KH7A 1E4UA 2ZETC 5H1VA 3ZTGA 2E6RA 4AYCA 2VJFB 1WEWA 3U5NA 5D1LB 3EB5A 3C6WA 2KWKA 3MHSA 4P5OB 1F62A 2LGVA 1WEOA 4CA1A 2QJ0A 4W4UA 2LGLA 3SHBA 4CCGX 4YC9A 4WZ0A 4YABA 4UP0A 1WENA 3FL2A 1DVPA 2VPEA 5G0FA 4L58A 2M3HA 4A4BA 3M63A 2ECWA 2CKLB 2YW8A 3LRQA 2JMJA 2G43A 2RI7A 2AN6A 5B76A 2CKLA 2M1RA 2LRIC 2YHNA 4BBQA 2FUUA 2IDAA 2KGIA 1FP0A 4UP5A 4UI9B 2VP7A 4S3OC 2EA6A 3M62A 5AITA 4S3OB 4A0CD 1T1HA 5H9MA 1MM2A 3V43A 3O33A 2QICA 2YURA 5KH9A 1WIMA 2JMDA 4ZUXU 2MD8C 3M99A 3GV4A 3HTKC 5TBNA 1FBVA 2YSMA 2LGGA 2L80A 1Z6UA 2CSZA 3PHDA 3O36A 3O34A 5FB0A 1WEEA 4L7XA 2M85A 2ECNA 4YBMA 3KV6A 2D8SA 5B77A 2VJEB 2YUCA 3N9QA 1CHCA 3EB6A 4AP4A 2BAYA 4YBSA 2KGGA 1VYXA 2JRJA 2MIQA 2MNYA 3LQJA 2KWJA 2I50A 1X4IA 4YATA 5FERA 5TRBA 3N9OA 1HYJA 2YU4A 2VPGA 2L75A 2Y43A 3LQHA 2YT5A 2YQMA 1WEQA 5C13A 5LKTA 4R7EA 1LDJB 2K17A 4R2YA 1G25A 2G6QA 2ECIA 1JOCA 2ECTA 3U5OA 2KFTA 4V3LC 1X4JA 3DPLR 4F52B 5LCWB 2LXPC 3SOUA 2MT5A 2Y1MA 2CT2A 2UZGA 3SOWA 2MNZA 1WEVA 2YHOA 3VK6A 2C2LA 2VPBA 5DINA 4NN2A 3HCTA 2VJFA 4WA6A 1BORA 1WE9A 2KYUA 3N9PA 1JM7B 3RTRB 2PNXA 2KE1A 3IHPA 1WFKA 2DX8A 4LJNA 3T7LA 2G45A 2PUYA 2HYED 2KR4A 1X4UA 4C9ZA 3LQIA 5LKZA 3PUQA 1ZBDB 4R8PK 2ECGA 4TKPB 3KNVA 2L5UA 5LKUA 3C5KA 4N3WA 5D1MB 4AUQB 3SOXA 2C2VS 4IC2A 3ZPV1 5B8DA 3ZVYA 5B78A 5EYAF 2KWOA 2KREA 2KWNA 5J3XA 3GL6A 5H1UA 1WEMA 2YYRA 4LLBA 4QF3A 4FK5A 5FEYA 3MHHA 2QIZA 1MM3A 2KU3A 4O64A 4PTBA 3ZPVE 2FSAA 5B79A 4XI1A 2FUIA 3ZVZB 5JG6A 5G04B 4FIPA 1U6GB 4I7BA 2LXHC 5TDRA 2XB1A 3PURA 1V87A 5AIUA 1IYMA 2MA5A 4I7CA 4N4FA 3L1XA 4YBTA 4GB0A 4ZDTA 3N9MA 2VJEA 2K16A 4A4CA 2E6SA 1XWHA 3KV5A 5G05B 2CSYA 3N9NA 5C11A 1WILA 1Z60A 4I7DA 1HYIA 2L0BA 4B7YC 3DQVR 1RMDA 1WGMA 1WEPA 4GNEA 4IC3A 2H0DB 4BHWA 3L1ZB 5LKXA 1WESA 1JM7A 2H0DA 1WEUA 5DKAA 4LK9A 4MVTA 2RSDA 3O37A 4V3KC 1VD4A 3NG2A 1Z2QA 5KH3A 4WZ2A 2JMIA 3O70A 2MA6A 4MSXA
chains in the Genus database with same CATH superfamily
4YAXA 5SVIA 3U5MA 5SVYA 4AVXA 4X3GA 3L11A 2MD7B 4WZ3B 4ZQLA 3FAOA 4YADA 4B86C 3T6RA 5B75A 2HDPA 1DCQA 2ECVA 3RPGC 3RPGB 2Y1NA 4PPEA 4GNDA 5D1KB 3MDBC 4FJCA 4A49A 2K1JA 3M7KA 2YREA 5FB1A 1LDKC 2XEUA 3ZNIA 5H1TA 5I3LA 3ZYQA 2LV9A 5TABA 2LQ6A 3HCUA 2EODA 2EGPA 3QZVA 4LKAA 2L7PA 2F42A 2LGKA 3I2DA 2K4DA 2XOCA 2VPDA 5TDWA 2F6NA 4GNGA 3U5PA 1N87A 1K2FA 1MBMA 3O35A 2KIZA 2NAAA 1VFYA 2VNFA 3LVQE 2L43A 2MUMA 2OXQC 2YSJA 4LADB 4OGCA 2LN0A 2ECJA 3N9LA 2LDRA 2F6JA 3FANA 4QF2A 3O7AA 2M6MA 4FO9A 2YQLA 3ASLA 3HCSA 3KQIA 4GNFA 4Q6FA 4AYCB 5KH7A 1E4UA 2ZETC 5H1VA 3ZTGA 2E6RA 4AYCA 2VJFB 1WEWA 3U5NA 2CSVA 5D1LB 2KKXA 3E2DA 3EB5A 3C6WA 2KWKA 3MHSA 4P5OB 1F62A 2LGVA 1WEOA 4CA1A 2QJ0A 4W4UA 2LGLA 3SHBA 4CCGX 2EXUA 4YC9A 4WZ0A 3KDEC 4YABA 4UP0A 2D8UA 1WENA 3FL2A 1DVPA 2VPEA 5G0FA 4L58A 2M3HA 4A4BA 3M63A 2ECWA 2CKLB 2YW8A 3LRQA 2JMJA 2G43A 2RI7A 2AN6A 2KKYA 2XOYA 3Q1DA 3H7HA 5B76A 2CKLA 2M1RA 2LRIC 2YHNA 4BBQA 2FUUA 2IDAA 2KGIA 1FP0A 2E61A 4UP5A 4UI9B 2VP7A 4S3OC 2EA6A 3M62A 5AITA 5SVXA 4S3OB 4A0CD 1T1HA 4Z0OA 5H9MA 1MM2A 3V43A 3O33A 2QICA 2YURA 5KH9A 1WIMA 2MKEA 2JMDA 4ZUXU 2MD8C 3M99A 3GV4A 3HTKC 5TBNA 1FBVA 2YSMA 2RR4A 2XOZA 2LGGA 2L80A 1Z6UA 2CSZA 3DWDA 3PHDA 3O36A 3O34A 5FB0A 2JUNA 1WEEA 4L7XA 2JM3A 3LDYA 2M85A 2ECNA 4YBMA 3KV6A 2D8SA 5B77A 2VJEB 2YUCA 3N9QA 3SUBA 1CHCA 2CRWA 3EB6A 4AP4A 2BAYA 4YBSA 4OGEA 2KGGA 1VYXA 2JRJA 2MIQA 2MNYA 3FEHA 3LQJA 2KWJA 2I50A 1X4IA 3LJUX 4YATA 5FERA 5TRBA 3N9OA 1HYJA 2YU4A 2VPGA 2L75A 2Y43A 3LQHA 2YT5A 2YQMA 1WEQA 5C13A 5LKTA 4R7EA 1LDJB 2K17A 4R2YA 1G25A 2G6QA 2ECIA 1JOCA 2ECTA 3U5OA 2KFTA 4V3LC 1X4JA 4QQ4A 3DPLR 4H9DA 5LCWB 4O62A 4F52B 2LXPC 3SOUA 2CRRA 2MT5A 2Y1MA 2CT2A 2UZGA 3SOWA 2MNZA 1WEVA 2YHOA 3VK6A 2C2LA 2VPBA 5DINA 4NN2A 3HCTA 2VJFA 4WA6A 1BORA 1WE9A 2KYUA 3N9PA 1JM7B 3RTRB 2PNXA 2KE1A 3IHPA 1WFKA 2DX8A 4LJNA 3T7LA 2FFWA 2G45A 2PUYA 2HYED 2KR4A 2IQJA 1X4UA 4C9ZA 3LQIA 5LKZA 3PUQA 1ZBDB 5SVIB 2B0OE 3JUEA 4R8PK 5K3QA 2ECGA 4TKPB 3KNVA 2L5UA 5LKUA 3C5KA 4N3WA 3T9KA 5D1MB 4AUQB 3SOXA 2C2VS 4IC2A 3ZPV1 5B8DA 3ZVYA 5B78A 5EYAF 2KWOA 2KREA 2KWNA 5J3XA 3GL6A 5H1UA 1WEMA 2YYRA 4LLBA 4QF3A 4FK5A 5FEYA 3MHHA 2QIZA 1MM3A 2KU3A 4O64A 4PTBA 3FJUB 2XP0A 3ZPVE 2FSAA 5B79A 4XI1A 2FUIA 3FM8C 3ZVZB 5JG6A 2YVRA 3LVRE 5G04B 4FIPA 3DDTA 1U6GB 4I7BA 2LXHC 5TDRA 2XB1A 3PURA 1V87A 5AIUA 1IYMA 2MA5A 4I7CA 2M13A 4N4FA 3L1XA 2DSMA 4YBTA 4GB0A 4ZDTA 3N9MA 2VJEA 2K16A 4A4CA 2E6SA 1XWHA 2LAUA 3KV5A 3PLWA 4F1PA 5G05B 2CSYA 3N9NA 5C11A 1WILA 1Z60A 4I7DA 1HYIA 4Z0RA 2L0BA 4B7YC 3DQVR 1RMDA 1WGMA 1WEPA 4GNEA 4IC3A 3O47A 2H0DB 2OWAA 4BHWA 3L1ZB 2EGMA 5LKXA 1WESA 1JM7A 2H0DA 1WEUA 5DKAA 4LK9A 4MVTA 2RSDA 3O37A 4V3KC 1VD4A 3NG2A 2FD4A 1Z2QA 5KH3A 4WZ2A 2JMIA 2P57A 3O70A 2MA6A 2DJAA 4MSXA 2CONA
chains in the Genus database with same CATH topology
4YAXA 3U5MA 4AVXA 4X3GA 3L11A 2MD7B 4WZ3B 4ZQLA 4YADA 4B86C 3T6RA 5B75A 2HDPA 2ECVA 3RPGC 3RPGB 2Y1NA 4PPEA 4GNDA 5D1KB 4FJCA 4A49A 2K1JA 2YREA 5FB1A 1LDKC 2XEUA 3ZNIA 5H1TA 5I3LA 3ZYQA 2LV9A 5TABA 2LQ6A 3HCUA 2EODA 2EGPA 3QZVA 4LKAA 2F42A 2LGKA 3I2DA 2K4DA 2VPDA 5TDWA 2F6NA 4GNGA 3U5PA 1N87A 1K2FA 3O35A 2KIZA 2NAAA 1VFYA 2VNFA 2L43A 2MUMA 2OXQC 2YSJA 4LADB 2LN0A 2ECJA 3N9LA 2LDRA 2F6JA 4QF2A 3O7AA 2M6MA 4FO9A 2YQLA 3ASLA 3HCSA 3KQIA 4GNFA 4Q6FA 4AYCB 5KH7A 1E4UA 2ZETC 5H1VA 3ZTGA 2E6RA 4AYCA 2VJFB 1WEWA 3U5NA 5D1LB 3EB5A 3C6WA 2KWKA 3MHSA 4P5OB 1F62A 2LGVA 1WEOA 4CA1A 2QJ0A 4W4UA 2LGLA 3SHBA 4CCGX 4YC9A 4WZ0A 4YABA 4UP0A 1WENA 3FL2A 1DVPA 2VPEA 5G0FA 4L58A 2M3HA 4A4BA 3M63A 2ECWA 2CKLB 2YW8A 3LRQA 2JMJA 2G43A 2RI7A 2AN6A 5B76A 2CKLA 2M1RA 2LRIC 2YHNA 4BBQA 2FUUA 2IDAA 2KGIA 1FP0A 4UP5A 4UI9B 2VP7A 4S3OC 2EA6A 3M62A 5AITA 4S3OB 4A0CD 1T1HA 5H9MA 1MM2A 3V43A 3O33A 2QICA 2YURA 5KH9A 1WIMA 2JMDA 4ZUXU 2MD8C 3M99A 3GV4A 3HTKC 5TBNA 1FBVA 2YSMA 2LGGA 2L80A 1Z6UA 2CSZA 3PHDA 3O36A 3O34A 5FB0A 1WEEA 4L7XA 2M85A 2ECNA 4YBMA 3KV6A 2D8SA 5B77A 2VJEB 2YUCA 3N9QA 1CHCA 3EB6A 4AP4A 2BAYA 4YBSA 2KGGA 1VYXA 2JRJA 2MIQA 2MNYA 3LQJA 2KWJA 2I50A 1X4IA 4YATA 5FERA 5TRBA 3N9OA 1HYJA 2YU4A 2VPGA 2L75A 2Y43A 3LQHA 2YT5A 2YQMA 1WEQA 5C13A 5LKTA 4R7EA 1LDJB 2K17A 4R2YA 1G25A 2G6QA 2ECIA 1JOCA 2ECTA 3U5OA 2KFTA 4V3LC 1X4JA 3DPLR 4F52B 5LCWB 2LXPC 3SOUA 2MT5A 2Y1MA 2CT2A 2UZGA 3SOWA 2MNZA 1WEVA 2YHOA 3VK6A 2C2LA 2VPBA 5DINA 4NN2A 3HCTA 2VJFA 4WA6A 1BORA 1WE9A 2KYUA 3N9PA 1JM7B 3RTRB 2PNXA 2KE1A 3IHPA 1WFKA 2DX8A 4LJNA 3T7LA 2G45A 2PUYA 2HYED 2KR4A 1X4UA 4C9ZA 3LQIA 5LKZA 3PUQA 1ZBDB 4R8PK 2ECGA 4TKPB 3KNVA 2L5UA 5LKUA 3C5KA 4N3WA 5D1MB 4AUQB 3SOXA 2C2VS 4IC2A 3ZPV1 5B8DA 3ZVYA 5B78A 5EYAF 2KWOA 2KREA 2KWNA 5J3XA 3GL6A 5H1UA 1WEMA 2YYRA 4LLBA 4QF3A 4FK5A 5FEYA 3MHHA 2QIZA 1MM3A 2KU3A 4O64A 4PTBA 3ZPVE 2FSAA 5B79A 4XI1A 2FUIA 3ZVZB 5JG6A 5G04B 4FIPA 1U6GB 4I7BA 2LXHC 5TDRA 2XB1A 3PURA 1V87A 5AIUA 1IYMA 2MA5A 4I7CA 4N4FA 3L1XA 4YBTA 4GB0A 4ZDTA 3N9MA 2VJEA 2K16A 4A4CA 2E6SA 1XWHA 3KV5A 5G05B 2CSYA 3N9NA 5C11A 1WILA 1Z60A 4I7DA 1HYIA 2L0BA 4B7YC 3DQVR 1RMDA 1WGMA 1WEPA 4GNEA 4IC3A 2H0DB 4BHWA 3L1ZB 5LKXA 1WESA 1JM7A 2H0DA 1WEUA 5DKAA 4LK9A 4MVTA 2RSDA 3O37A 4V3KC 1VD4A 3NG2A 1Z2QA 5KH3A 4WZ2A 2JMIA 3O70A 2MA6A 4MSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAX A;  3U5M A;  4AVX A;  4X3G A;  3L11 A;  2MD7 B;  4WZ3 B;  4ZQL A;  4YAD A;  4B86 C;  3T6R A;  5B75 A;  2HDP A;  2ECV A;  3RPG C;  3RPG B;  2Y1N A;  4PPE A;  4GND A;  5D1K B;  4FJC A;  4A49 A;  2K1J A;  2YRE A;  5FB1 A;  1LDK C;  2XEU A;  3ZNI A;  5H1T A;  5I3L A;  3ZYQ A;  2LV9 A;  5TAB A;  2LQ6 A;  3HCU A;  2EOD A;  2EGP A;  3QZV A;  4LKA A;  2F42 A;  2LGK A;  3I2D A;  2K4D A;  2VPD A;  5TDW A;  2F6N A;  4GNG A;  3U5P A;  1N87 A;  1K2F A;  3O35 A;  2KIZ A;  2NAA A;  1VFY A;  2VNF A;  2L43 A;  2MUM A;  2OXQ C;  2YSJ A;  4LAD B;  2LN0 A;  2ECJ A;  3N9L A;  2LDR A;  2F6J A;  4QF2 A;  3O7A A;  2M6M A;  4FO9 A;  2YQL A;  3ASL A;  3HCS A;  3KQI A;  4GNF A;  4Q6F A;  4AYC B;  5KH7 A;  1E4U A;  2ZET C;  5H1V A;  3ZTG A;  2E6R A;  4AYC A;  2VJF B;  1WEW A;  3U5N A;  5D1L B;  3EB5 A;  3C6W A;  2KWK A;  3MHS A;  4P5O B;  1F62 A;  2LGV A;  1WEO A;  4CA1 A;  2QJ0 A;  4W4U A;  2LGL A;  3SHB A;  4CCG X;  4YC9 A;  4WZ0 A;  4YAB A;  4UP0 A;  1WEN A;  3FL2 A;  1DVP A;  2VPE A;  5G0F A;  4L58 A;  2M3H A;  4A4B A;  3M63 A;  2ECW A;  2CKL B;  2YW8 A;  3LRQ A;  2JMJ A;  2G43 A;  2RI7 A;  2AN6 A;  5B76 A;  2CKL A;  2M1R A;  2LRI C;  2YHN A;  4BBQ A;  2FUU A;  2IDA A;  2KGI A;  1FP0 A;  4UP5 A;  4UI9 B;  2VP7 A;  4S3O C;  2EA6 A;  3M62 A;  5AIT A;  4S3O B;  4A0C D;  1T1H A;  5H9M A;  1MM2 A;  3V43 A;  3O33 A;  2QIC A;  2YUR A;  5KH9 A;  1WIM A;  2JMD A;  4ZUX U;  2MD8 C;  3M99 A;  3GV4 A;  3HTK C;  5TBN A;  1FBV A;  2YSM A;  2LGG A;  2L80 A;  1Z6U A;  2CSZ A;  3PHD A;  3O36 A;  3O34 A;  5FB0 A;  1WEE A;  4L7X A;  2M85 A;  2ECN A;  4YBM A;  3KV6 A;  2D8S A;  5B77 A;  2VJE B;  2YUC A;  3N9Q A;  1CHC A;  3EB6 A;  4AP4 A;  2BAY A;  4YBS A;  2KGG A;  1VYX A;  2JRJ A;  2MIQ A;  2MNY A;  3LQJ A;  2KWJ A;  2I50 A;  1X4I A;  4YAT A;  5FER A;  5TRB A;  3N9O A;  1HYJ A;  2YU4 A;  2VPG A;  2L75 A;  2Y43 A;  3LQH A;  2YT5 A;  2YQM A;  1WEQ A;  5C13 A;  5LKT A;  4R7E A;  1LDJ B;  2K17 A;  4R2Y A;  1G25 A;  2G6Q A;  2ECI A;  1JOC A;  2ECT A;  3U5O A;  2KFT A;  4V3L C;  1X4J A;  3DPL R;  4F52 B;  5LCW B;  2LXP C;  3SOU A;  2MT5 A;  2Y1M A;  2CT2 A;  2UZG A;  3SOW A;  2MNZ A;  1WEV A;  2YHO A;  3VK6 A;  2C2L A;  2VPB A;  5DIN A;  4NN2 A;  3HCT A;  2VJF A;  4WA6 A;  1BOR A;  1WE9 A;  2KYU A;  3N9P A;  1JM7 B;  3RTR B;  2PNX A;  2KE1 A;  3IHP A;  1WFK A;  2DX8 A;  4LJN A;  3T7L A;  2G45 A;  2PUY A;  2HYE D;  2KR4 A;  1X4U A;  4C9Z A;  3LQI A;  5LKZ A;  3PUQ A;  1ZBD B;  4R8P K;  2ECG A;  4TKP B;  3KNV A;  2L5U A;  5LKU A;  3C5K A;  4N3W A;  5D1M B;  4AUQ B;  3SOX A;  2C2V S;  4IC2 A;  3ZPV 1;  5B8D A;  3ZVY A;  5B78 A;  5EYA F;  2KWO A;  2KRE A;  2KWN A;  5J3X A;  3GL6 A;  5H1U A;  1WEM A;  2YYR A;  4LLB A;  4QF3 A;  4FK5 A;  5FEY A;  3MHH A;  2QIZ A;  1MM3 A;  2KU3 A;  4O64 A;  4PTB A;  3ZPV E;  2FSA A;  5B79 A;  4XI1 A;  2FUI A;  3ZVZ B;  5JG6 A;  5G04 B;  4FIP A;  1U6G B;  4I7B A;  2LXH C;  5TDR A;  2XB1 A;  3PUR A;  1V87 A;  5AIU A;  1IYM A;  2MA5 A;  4I7C A;  4N4F A;  3L1X A;  4YBT A;  4GB0 A;  4ZDT A;  3N9M A;  2VJE A;  2K16 A;  4A4C A;  2E6S A;  1XWH A;  3KV5 A;  5G05 B;  2CSY A;  3N9N A;  5C11 A;  1WIL A;  1Z60 A;  4I7D A;  1HYI A;  2L0B A;  4B7Y C;  3DQV R;  1RMD A;  1WGM A;  1WEP A;  4GNE A;  4IC3 A;  2H0D B;  4BHW A;  3L1Z B;  5LKX A;  1WES A;  1JM7 A;  2H0D A;  1WEU A;  5DKA A;  4LK9 A;  4MVT A;  2RSD A;  3O37 A;  4V3K C;  1VD4 A;  3NG2 A;  1Z2Q A;  5KH3 A;  4WZ2 A;  2JMI A;  3O70 A;  2MA6 A;  4MSX A; 
#chains in the Genus database with same CATH topology
 4YAX A;  5SVI A;  3U5M A;  5SVY A;  4AVX A;  4X3G A;  3L11 A;  2MD7 B;  4WZ3 B;  4ZQL A;  3FAO A;  4YAD A;  4B86 C;  3T6R A;  5B75 A;  2HDP A;  1DCQ A;  2ECV A;  3RPG C;  3RPG B;  2Y1N A;  4PPE A;  4GND A;  5D1K B;  3MDB C;  4FJC A;  4A49 A;  2K1J A;  3M7K A;  2YRE A;  5FB1 A;  1LDK C;  2XEU A;  3ZNI A;  5H1T A;  5I3L A;  3ZYQ A;  2LV9 A;  5TAB A;  2LQ6 A;  3HCU A;  2EOD A;  2EGP A;  3QZV A;  4LKA A;  2L7P A;  2F42 A;  2LGK A;  3I2D A;  2K4D A;  2XOC A;  2VPD A;  5TDW A;  2F6N A;  4GNG A;  3U5P A;  1N87 A;  1K2F A;  1MBM A;  3O35 A;  2KIZ A;  2NAA A;  1VFY A;  2VNF A;  3LVQ E;  2L43 A;  2MUM A;  2OXQ C;  2YSJ A;  4LAD B;  4OGC A;  2LN0 A;  2ECJ A;  3N9L A;  2LDR A;  2F6J A;  3FAN A;  4QF2 A;  3O7A A;  2M6M A;  4FO9 A;  2YQL A;  3ASL A;  3HCS A;  3KQI A;  4GNF A;  4Q6F A;  4AYC B;  5KH7 A;  1E4U A;  2ZET C;  5H1V A;  3ZTG A;  2E6R A;  4AYC A;  2VJF B;  1WEW A;  3U5N A;  2CSV A;  5D1L B;  2KKX A;  3E2D A;  3EB5 A;  3C6W A;  2KWK A;  3MHS A;  4P5O B;  1F62 A;  2LGV A;  1WEO A;  4CA1 A;  2QJ0 A;  4W4U A;  2LGL A;  3SHB A;  4CCG X;  2EXU A;  4YC9 A;  4WZ0 A;  3KDE C;  4YAB A;  4UP0 A;  2D8U A;  1WEN A;  3FL2 A;  1DVP A;  2VPE A;  5G0F A;  4L58 A;  2M3H A;  4A4B A;  3M63 A;  2ECW A;  2CKL B;  2YW8 A;  3LRQ A;  2JMJ A;  2G43 A;  2RI7 A;  2AN6 A;  2KKY A;  2XOY A;  3Q1D A;  3H7H A;  5B76 A;  2CKL A;  2M1R A;  2LRI C;  2YHN A;  4BBQ A;  2FUU A;  2IDA A;  2KGI A;  1FP0 A;  2E61 A;  4UP5 A;  4UI9 B;  2VP7 A;  4S3O C;  2EA6 A;  3M62 A;  5AIT A;  5SVX A;  4S3O B;  4A0C D;  1T1H A;  4Z0O A;  5H9M A;  1MM2 A;  3V43 A;  3O33 A;  2QIC A;  2YUR A;  5KH9 A;  1WIM A;  2MKE A;  2JMD A;  4ZUX U;  2MD8 C;  3M99 A;  3GV4 A;  3HTK C;  5TBN A;  1FBV A;  2YSM A;  2RR4 A;  2XOZ A;  2LGG A;  2L80 A;  1Z6U A;  2CSZ A;  3DWD A;  3PHD A;  3O36 A;  3O34 A;  5FB0 A;  2JUN A;  1WEE A;  4L7X A;  2JM3 A;  3LDY A;  2M85 A;  2ECN A;  4YBM A;  3KV6 A;  2D8S A;  5B77 A;  2VJE B;  2YUC A;  3N9Q A;  3SUB A;  1CHC A;  2CRW A;  3EB6 A;  4AP4 A;  2BAY A;  4YBS A;  4OGE A;  2KGG A;  1VYX A;  2JRJ A;  2MIQ A;  2MNY A;  3FEH A;  3LQJ A;  2KWJ A;  2I50 A;  1X4I A;  3LJU X;  4YAT A;  5FER A;  5TRB A;  3N9O A;  1HYJ A;  2YU4 A;  2VPG A;  2L75 A;  2Y43 A;  3LQH A;  2YT5 A;  2YQM A;  1WEQ A;  5C13 A;  5LKT A;  4R7E A;  1LDJ B;  2K17 A;  4R2Y A;  1G25 A;  2G6Q A;  2ECI A;  1JOC A;  2ECT A;  3U5O A;  2KFT A;  4V3L C;  1X4J A;  4QQ4 A;  3DPL R;  4H9D A;  5LCW B;  4O62 A;  4F52 B;  2LXP C;  3SOU A;  2CRR A;  2MT5 A;  2Y1M A;  2CT2 A;  2UZG A;  3SOW A;  2MNZ A;  1WEV A;  2YHO A;  3VK6 A;  2C2L A;  2VPB A;  5DIN A;  4NN2 A;  3HCT A;  2VJF A;  4WA6 A;  1BOR A;  1WE9 A;  2KYU A;  3N9P A;  1JM7 B;  3RTR B;  2PNX A;  2KE1 A;  3IHP A;  1WFK A;  2DX8 A;  4LJN A;  3T7L A;  2FFW A;  2G45 A;  2PUY A;  2HYE D;  2KR4 A;  2IQJ A;  1X4U A;  4C9Z A;  3LQI A;  5LKZ A;  3PUQ A;  1ZBD B;  5SVI B;  2B0O E;  3JUE A;  4R8P K;  5K3Q A;  2ECG A;  4TKP B;  3KNV A;  2L5U A;  5LKU A;  3C5K A;  4N3W A;  3T9K A;  5D1M B;  4AUQ B;  3SOX A;  2C2V S;  4IC2 A;  3ZPV 1;  5B8D A;  3ZVY A;  5B78 A;  5EYA F;  2KWO A;  2KRE A;  2KWN A;  5J3X A;  3GL6 A;  5H1U A;  1WEM A;  2YYR A;  4LLB A;  4QF3 A;  4FK5 A;  5FEY A;  3MHH A;  2QIZ A;  1MM3 A;  2KU3 A;  4O64 A;  4PTB A;  3FJU B;  2XP0 A;  3ZPV E;  2FSA A;  5B79 A;  4XI1 A;  2FUI A;  3FM8 C;  3ZVZ B;  5JG6 A;  2YVR A;  3LVR E;  5G04 B;  4FIP A;  3DDT A;  1U6G B;  4I7B A;  2LXH C;  5TDR A;  2XB1 A;  3PUR A;  1V87 A;  5AIU A;  1IYM A;  2MA5 A;  4I7C A;  2M13 A;  4N4F A;  3L1X A;  2DSM A;  4YBT A;  4GB0 A;  4ZDT A;  3N9M A;  2VJE A;  2K16 A;  4A4C A;  2E6S A;  1XWH A;  2LAU A;  3KV5 A;  3PLW A;  4F1P A;  5G05 B;  2CSY A;  3N9N A;  5C11 A;  1WIL A;  1Z60 A;  4I7D A;  1HYI A;  4Z0R A;  2L0B A;  4B7Y C;  3DQV R;  1RMD A;  1WGM A;  1WEP A;  4GNE A;  4IC3 A;  3O47 A;  2H0D B;  2OWA A;  4BHW A;  3L1Z B;  2EGM A;  5LKX A;  1WES A;  1JM7 A;  2H0D A;  1WEU A;  5DKA A;  4LK9 A;  4MVT A;  2RSD A;  3O37 A;  4V3K C;  1VD4 A;  3NG2 A;  2FD4 A;  1Z2Q A;  5KH3 A;  4WZ2 A;  2JMI A;  2P57 A;  3O70 A;  2MA6 A;  2DJA A;  4MSX A;  2CON A; 
#chains in the Genus database with same CATH homology
 4YAX A;  3U5M A;  4AVX A;  4X3G A;  3L11 A;  2MD7 B;  4WZ3 B;  4ZQL A;  4YAD A;  4B86 C;  3T6R A;  5B75 A;  2HDP A;  2ECV A;  3RPG C;  3RPG B;  2Y1N A;  4PPE A;  4GND A;  5D1K B;  4FJC A;  4A49 A;  2K1J A;  2YRE A;  5FB1 A;  1LDK C;  2XEU A;  3ZNI A;  5H1T A;  5I3L A;  3ZYQ A;  2LV9 A;  5TAB A;  2LQ6 A;  3HCU A;  2EOD A;  2EGP A;  3QZV A;  4LKA A;  2F42 A;  2LGK A;  3I2D A;  2K4D A;  2VPD A;  5TDW A;  2F6N A;  4GNG A;  3U5P A;  1N87 A;  1K2F A;  3O35 A;  2KIZ A;  2NAA A;  1VFY A;  2VNF A;  2L43 A;  2MUM A;  2OXQ C;  2YSJ A;  4LAD B;  2LN0 A;  2ECJ A;  3N9L A;  2LDR A;  2F6J A;  4QF2 A;  3O7A A;  2M6M A;  4FO9 A;  2YQL A;  3ASL A;  3HCS A;  3KQI A;  4GNF A;  4Q6F A;  4AYC B;  5KH7 A;  1E4U A;  2ZET C;  5H1V A;  3ZTG A;  2E6R A;  4AYC A;  2VJF B;  1WEW A;  3U5N A;  5D1L B;  3EB5 A;  3C6W A;  2KWK A;  3MHS A;  4P5O B;  1F62 A;  2LGV A;  1WEO A;  4CA1 A;  2QJ0 A;  4W4U A;  2LGL A;  3SHB A;  4CCG X;  4YC9 A;  4WZ0 A;  4YAB A;  4UP0 A;  1WEN A;  3FL2 A;  1DVP A;  2VPE A;  5G0F A;  4L58 A;  2M3H A;  4A4B A;  3M63 A;  2ECW A;  2CKL B;  2YW8 A;  3LRQ A;  2JMJ A;  2G43 A;  2RI7 A;  2AN6 A;  5B76 A;  2CKL A;  2M1R A;  2LRI C;  2YHN A;  4BBQ A;  2FUU A;  2IDA A;  2KGI A;  1FP0 A;  4UP5 A;  4UI9 B;  2VP7 A;  4S3O C;  2EA6 A;  3M62 A;  5AIT A;  4S3O B;  4A0C D;  1T1H A;  5H9M A;  1MM2 A;  3V43 A;  3O33 A;  2QIC A;  2YUR A;  5KH9 A;  1WIM A;  2JMD A;  4ZUX U;  2MD8 C;  3M99 A;  3GV4 A;  3HTK C;  5TBN A;  1FBV A;  2YSM A;  2LGG A;  2L80 A;  1Z6U A;  2CSZ A;  3PHD A;  3O36 A;  3O34 A;  5FB0 A;  1WEE A;  4L7X A;  2M85 A;  2ECN A;  4YBM A;  3KV6 A;  2D8S A;  5B77 A;  2VJE B;  2YUC A;  3N9Q A;  1CHC A;  3EB6 A;  4AP4 A;  2BAY A;  4YBS A;  2KGG A;  1VYX A;  2JRJ A;  2MIQ A;  2MNY A;  3LQJ A;  2KWJ A;  2I50 A;  1X4I A;  4YAT A;  5FER A;  5TRB A;  3N9O A;  1HYJ A;  2YU4 A;  2VPG A;  2L75 A;  2Y43 A;  3LQH A;  2YT5 A;  2YQM A;  1WEQ A;  5C13 A;  5LKT A;  4R7E A;  1LDJ B;  2K17 A;  4R2Y A;  1G25 A;  2G6Q A;  2ECI A;  1JOC A;  2ECT A;  3U5O A;  2KFT A;  4V3L C;  1X4J A;  3DPL R;  4F52 B;  5LCW B;  2LXP C;  3SOU A;  2MT5 A;  2Y1M A;  2CT2 A;  2UZG A;  3SOW A;  2MNZ A;  1WEV A;  2YHO A;  3VK6 A;  2C2L A;  2VPB A;  5DIN A;  4NN2 A;  3HCT A;  2VJF A;  4WA6 A;  1BOR A;  1WE9 A;  2KYU A;  3N9P A;  1JM7 B;  3RTR B;  2PNX A;  2KE1 A;  3IHP A;  1WFK A;  2DX8 A;  4LJN A;  3T7L A;  2G45 A;  2PUY A;  2HYE D;  2KR4 A;  1X4U A;  4C9Z A;  3LQI A;  5LKZ A;  3PUQ A;  1ZBD B;  4R8P K;  2ECG A;  4TKP B;  3KNV A;  2L5U A;  5LKU A;  3C5K A;  4N3W A;  5D1M B;  4AUQ B;  3SOX A;  2C2V S;  4IC2 A;  3ZPV 1;  5B8D A;  3ZVY A;  5B78 A;  5EYA F;  2KWO A;  2KRE A;  2KWN A;  5J3X A;  3GL6 A;  5H1U A;  1WEM A;  2YYR A;  4LLB A;  4QF3 A;  4FK5 A;  5FEY A;  3MHH A;  2QIZ A;  1MM3 A;  2KU3 A;  4O64 A;  4PTB A;  3ZPV E;  2FSA A;  5B79 A;  4XI1 A;  2FUI A;  3ZVZ B;  5JG6 A;  5G04 B;  4FIP A;  1U6G B;  4I7B A;  2LXH C;  5TDR A;  2XB1 A;  3PUR A;  1V87 A;  5AIU A;  1IYM A;  2MA5 A;  4I7C A;  4N4F A;  3L1X A;  4YBT A;  4GB0 A;  4ZDT A;  3N9M A;  2VJE A;  2K16 A;  4A4C A;  2E6S A;  1XWH A;  3KV5 A;  5G05 B;  2CSY A;  3N9N A;  5C11 A;  1WIL A;  1Z60 A;  4I7D A;  1HYI A;  2L0B A;  4B7Y C;  3DQV R;  1RMD A;  1WGM A;  1WEP A;  4GNE A;  4IC3 A;  2H0D B;  4BHW A;  3L1Z B;  5LKX A;  1WES A;  1JM7 A;  2H0D A;  1WEU A;  5DKA A;  4LK9 A;  4MVT A;  2RSD A;  3O37 A;  4V3K C;  1VD4 A;  3NG2 A;  1Z2Q A;  5KH3 A;  4WZ2 A;  2JMI A;  3O70 A;  2MA6 A;  4MSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...