2LGGA

Structure of phd domain of uhrf1 in complex with h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lggA00
3SOWA 2FUIA 1XWHA 2Y1NA 2F6JA 2LN0A 2MA5A 1JM7A 3MHHA 3N9PA 2RI7A 2K1JA 3N9QA 3C6WA 3ZTGA 2QJ0A 1Z60A 2MIQA 3L1ZB 4A4CA 4O64A 2H0DA 1WILA 4WZ2A 2G45A 2VJEA 4YATA 2YYRA 2LGKA 3KNVA 5H1UA 3ASLA 1X4JA 1WEUA 3O7AA 4GNEA 2VP7A 2M3HA 2KR4A 4PPEA 4PTBA 5LCWB 3O37A 2YURA 4IC2A 5B77A 2MNYA 5TDRA 1ZBDB 3LQHA 1WENA 4GNGA 2QIZA 2L5UA 3GL6A 5G0FA 1X4UA 3PHDA 3U5MA 3N9NA 3EB6A 1Z6UA 2YHNA 3LQJA 2XB1A 4YBMA 1FBVA 2M6MA 4ZDTA 2BAYA 3T7LA 2ECJA 1HYIA 4I7DA 4AP4A 4I7CA 4GNDA 2VPEA 3N9MA 4WZ0A 2LXHC 2F42A 2KWOA 3L11A 5LKZA 4C9ZA 4S3OB 1WEPA 2L0BA 4A0CD 4AYCB 1WESA 2MA6A 5B8DA 5C13A 3U5NA 5D1LB 2YW8A 2YT5A 3HTKC 1BORA 4P5OB 3VK6A 2I50A 2C2VS 2MT5A 4N3WA 2LGGA 2E6SA 3SOXA 5JG6A 2QICA 3V43A 2K16A 4BHWA 4FJCA 3C5KA 1G25A 2M85A 2NAAA 5H1VA 4YADA 1VD4A 1E4UA 2UZGA 1WGMA 4N4FA 5D1MB 2MNZA 2F6NA 2KGIA 2KWJA 2KU3A 4CA1A 2HDPA 5B75A 2M1RA 2VNFA 3LRQA 2KGGA 4R7EA 1Z2QA 1WEMA 2ECNA 1WEEA 1WEQA 2L75A 5C11A 2VPGA 2KE1A 3T6RA 4YC9A 3U5OA 2PUYA 2YU4A 1HYJA 1IYMA 3FL2A 2OXQC 5LKTA 2D8SA 2L80A 2VJFB 4ZQLA 5H9MA 2C2LA 3HCTA 1WE9A 3MHSA 4MVTA 3ZVZB 3HCSA 4BBQA 2CKLB 1N87A 5FEYA 4Q6FA 2JMIA 4FIPA 3ZPV1 2YQMA 3LQIA 5TABA 5FB1A 1LDJB 2LRIC 2RSDA 5KH3A 2CT2A 5D1KB 4NN2A 3NG2A 4UP5A 2KWNA 4X3GA 2YHOA 1WFKA 3O34A 3RPGC 4XI1A 4YBSA 3O35A 2EGPA 2MD7B 3PUQA 1VYXA 5B76A 2VPDA 2LV9A 5EYAF 2VPBA 4AUQB 4A4BA 2DX8A 3M99A 4F52B 2L43A 2YSMA 5DINA 4MSXA 3O33A 4GB0A 4W4UA 5KH7A 4R8PK 2CKLA 3SHBA 2ECTA 2K17A 4WA6A 3HCUA 4FO9A 2CSYA 5B78A 2FSAA 2ECGA 2KFTA 2XEUA 3M62A 3IHPA 1WEOA 1JOCA 5LKXA 5AITA 4V3LC 3KV5A 3L1XA 3GV4A 2YSJA 4LJNA 5LKUA 2K4DA 2PNXA 2E6RA 3N9LA 2ZETC 3ZVYA 4A49A 1V87A 5AIUA 4QF3A 1FP0A 3KV6A 4YAXA 5I3LA 5G04B 1DVPA 1VFYA 3N9OA 2MD8C 4L7XA 4LADB 5B79A 3I2DA 2KREA 3SOUA 2LQ6A 3ZPVE 1WEWA 4AYCA 2KYUA 3O36A 1LDKC 3O70A 1WIMA 1T1HA 2CSZA 4LLBA 2JRJA 3ZNIA 4YABA 4TKPB 5TDWA 2HYED 1WEVA 1CHCA 2YUCA 2ECWA 3KQIA 2KWKA 2KIZA 4QF2A 3M63A 4WZ3B 2LGLA 2YREA 2EODA 1RMDA 5KH9A 2LGVA 2G6QA 4R2YA 2LDRA 5H1TA 3U5PA 4CCGX 4IC3A 1MM2A 1K2FA 4UP0A 3RTRB 2LXPC 5TRBA 1JM7B 2G43A 4FK5A 5FERA 2MUMA 4S3OC 2ECIA 4YBTA 4L58A 5G05B 3RPGB 5DKAA 4AVXA 4B7YC 1X4IA 2Y43A 2IDAA 4GNFA 2H0DB 2FUUA 4LK9A 1MM3A 3DQVR 2JMJA 2VJEB 3EB5A 2VJFA 5TBNA 4B86C 2ECVA 5J3XA 2YQLA 1U6GB 3PURA 3DPLR 4ZUXU 4V3KC 2EA6A 4LKAA 3ZYQA 2JMDA 3QZVA 4UI9B 5FB0A 4I7BA 2AN6A 2Y1MA 1F62A
chains in the Genus database with same CATH superfamily
3SOWA 2FUIA 1XWHA 2Y1NA 2F6JA 2LN0A 2MA5A 1JM7A 2FD4A 3MHHA 3N9PA 2RI7A 4F1PA 2K1JA 3N9QA 3C6WA 3ZTGA 2IQJA 2QJ0A 1Z60A 2MIQA 3L1ZB 4A4CA 4O64A 1MBMA 2H0DA 1WILA 4WZ2A 2G45A 2VJEA 4YATA 2YYRA 2LGKA 3KNVA 2JUNA 5H1UA 3ASLA 1X4JA 1WEUA 3FANA 3O7AA 4GNEA 2VP7A 2M3HA 2KR4A 4PPEA 4PTBA 5LCWB 3O37A 2YURA 4IC2A 5B77A 2MNYA 5TDRA 1ZBDB 3LQHA 1WENA 4GNGA 2QIZA 2L5UA 3GL6A 5G0FA 1X4UA 3PHDA 3U5MA 3N9NA 3EB6A 1Z6UA 2YHNA 3LQJA 2XB1A 4YBMA 2L7PA 2XOYA 1FBVA 2M6MA 3Q1DA 2OWAA 4ZDTA 2BAYA 3T7LA 2ECJA 1HYIA 4I7DA 2FFWA 3FM8C 4AP4A 4I7CA 4GNDA 2VPEA 3N9MA 4WZ0A 2CONA 2LXHC 2F42A 2KWOA 3L11A 3MDBC 4C9ZA 5LKZA 1WEPA 4S3OB 2L0BA 4A0CD 2KKXA 2XOZA 2XOCA 4AYCB 1WESA 2MA6A 3SUBA 5B8DA 5C13A 3U5NA 5D1LB 2YW8A 2YT5A 3HTKC 1BORA 4P5OB 3VK6A 2DJAA 2I50A 2C2VS 2MT5A 4N3WA 2LGGA 2E6SA 3SOXA 5JG6A 2QICA 3V43A 2K16A 3FJUB 4BHWA 4FJCA 3C5KA 1G25A 2M85A 2NAAA 5H1VA 4YADA 1VD4A 1E4UA 2UZGA 1WGMA 4N4FA 5D1MB 2MNZA 2F6NA 3KDEC 2KGIA 2KWJA 2KU3A 4CA1A 2HDPA 2MKEA 5B75A 2M1RA 2VNFA 3LRQA 4O62A 2KGGA 2D8UA 4R7EA 1Z2QA 1WEMA 2ECNA 1WEEA 5SVIB 1WEQA 2L75A 5C11A 2VPGA 2KE1A 3T6RA 4YC9A 3U5OA 2PUYA 2YU4A 1HYJA 1IYMA 3FL2A 2OXQC 2CSVA 5LKTA 2D8SA 2L80A 3H7HA 2VJFB 4ZQLA 5H9MA 2C2LA 3HCTA 1WE9A 3MHSA 2XP0A 4MVTA 3ZVZB 3HCSA 4BBQA 2CKLB 1N87A 5FEYA 4Q6FA 2JMIA 4FIPA 4Z0RA 3ZPV1 2YQMA 3LQIA 5TABA 5FB1A 2B0OE 3LJUX 1LDJB 2LRIC 2RSDA 5KH3A 3LDYA 2CT2A 5D1KB 4NN2A 3NG2A 4UP5A 2KWNA 4X3GA 2YHOA 1WFKA 3O34A 3RPGC 4XI1A 4YBSA 3O35A 2EGPA 2MD7B 3PUQA 3O47A 1VYXA 4OGEA 5B76A 2VPDA 2LV9A 2YVRA 5SVIA 5EYAF 2VPBA 2DSMA 4AUQB 4A4BA 2DX8A 3DWDA 3M99A 4F52B 2L43A 2YSMA 5DINA 4MSXA 3O33A 4GB0A 4W4UA 5KH7A 4R8PK 4QQ4A 2CKLA 3SHBA 2ECTA 2K17A 4WA6A 3HCUA 4FO9A 2CSYA 5B78A 2FSAA 2ECGA 2KFTA 2RR4A 2XEUA 3M62A 3IHPA 2EGMA 1WEOA 1JOCA 5LKXA 5AITA 4V3LC 3KV5A 3L1XA 3GV4A 2YSJA 5SVYA 4LJNA 5LKUA 2K4DA 2PNXA 5SVXA 2E6RA 3N9LA 2ZETC 3ZVYA 4A49A 3JUEA 1V87A 5AIUA 2E61A 4QF3A 3LVQE 1FP0A 3KV6A 4YAXA 5I3LA 5G04B 1DVPA 1VFYA 3N9OA 4L7XA 2MD8C 4LADB 5B79A 3I2DA 1DCQA 2KREA 3SOUA 2LQ6A 3ZPVE 1WEWA 4AYCA 2KYUA 3O36A 1LDKC 3O70A 1WIMA 1T1HA 2CSZA 4LLBA 2JM3A 2JRJA 3ZNIA 2M13A 4YABA 4TKPB 5TDWA 2HYED 1WEVA 1CHCA 2YUCA 2ECWA 3KQIA 2KWKA 3PLWA 2LAUA 2KIZA 4QF2A 2P57A 3M63A 4WZ3B 2LGLA 2YREA 2CRWA 2EODA 1RMDA 5KH9A 2LGVA 2G6QA 4R2YA 2LDRA 5H1TA 3U5PA 4CCGX 4IC3A 1MM2A 4H9DA 1K2FA 3LVRE 4UP0A 5K3QA 3RTRB 2LXPC 5TRBA 1JM7B 3DDTA 3M7KA 2G43A 4FK5A 5FERA 2EXUA 2MUMA 4S3OC 2ECIA 2KKYA 4YBTA 3T9KA 4L58A 5G05B 3E2DA 3RPGB 5DKAA 4AVXA 4B7YC 1X4IA 2CRRA 2Y43A 2IDAA 4GNFA 2H0DB 2FUUA 4LK9A 1MM3A 3DQVR 2JMJA 2VJEB 3EB5A 2VJFA 5TBNA 3FAOA 4B86C 2ECVA 5J3XA 2YQLA 1U6GB 3PURA 3DPLR 4ZUXU 4V3KC 2EA6A 4LKAA 3ZYQA 4OGCA 2JMDA 3QZVA 4UI9B 4I7BA 5FB0A 2AN6A 2Y1MA 4Z0OA 3FEHA 1F62A
chains in the Genus database with same CATH topology
3SOWA 2FUIA 1XWHA 2Y1NA 2F6JA 2LN0A 2MA5A 1JM7A 3MHHA 3N9PA 2RI7A 2K1JA 3N9QA 3C6WA 3ZTGA 2QJ0A 1Z60A 2MIQA 3L1ZB 4A4CA 4O64A 2H0DA 1WILA 4WZ2A 2G45A 2VJEA 4YATA 2YYRA 2LGKA 3KNVA 5H1UA 3ASLA 1X4JA 1WEUA 3O7AA 4GNEA 2VP7A 2M3HA 2KR4A 4PPEA 4PTBA 5LCWB 3O37A 2YURA 4IC2A 5B77A 2MNYA 5TDRA 1ZBDB 3LQHA 1WENA 4GNGA 2QIZA 2L5UA 3GL6A 5G0FA 1X4UA 3PHDA 3U5MA 3N9NA 3EB6A 1Z6UA 2YHNA 3LQJA 2XB1A 4YBMA 1FBVA 2M6MA 4ZDTA 2BAYA 3T7LA 2ECJA 1HYIA 4I7DA 4AP4A 4I7CA 4GNDA 2VPEA 3N9MA 4WZ0A 2LXHC 2F42A 2KWOA 3L11A 5LKZA 4C9ZA 4S3OB 1WEPA 2L0BA 4A0CD 4AYCB 1WESA 2MA6A 5B8DA 5C13A 3U5NA 5D1LB 2YW8A 2YT5A 3HTKC 1BORA 4P5OB 3VK6A 2I50A 2C2VS 2MT5A 4N3WA 2LGGA 2E6SA 3SOXA 5JG6A 2QICA 3V43A 2K16A 4BHWA 4FJCA 3C5KA 1G25A 2M85A 2NAAA 5H1VA 4YADA 1VD4A 1E4UA 2UZGA 1WGMA 4N4FA 5D1MB 2MNZA 2F6NA 2KGIA 2KWJA 2KU3A 4CA1A 2HDPA 5B75A 2M1RA 2VNFA 3LRQA 2KGGA 4R7EA 1Z2QA 1WEMA 2ECNA 1WEEA 1WEQA 2L75A 5C11A 2VPGA 2KE1A 3T6RA 4YC9A 3U5OA 2PUYA 2YU4A 1HYJA 1IYMA 3FL2A 2OXQC 5LKTA 2D8SA 2L80A 2VJFB 4ZQLA 5H9MA 2C2LA 3HCTA 1WE9A 3MHSA 4MVTA 3ZVZB 3HCSA 4BBQA 2CKLB 1N87A 5FEYA 4Q6FA 2JMIA 4FIPA 3ZPV1 2YQMA 3LQIA 5TABA 5FB1A 1LDJB 2LRIC 2RSDA 5KH3A 2CT2A 5D1KB 4NN2A 3NG2A 4UP5A 2KWNA 4X3GA 2YHOA 1WFKA 3O34A 3RPGC 4XI1A 4YBSA 3O35A 2EGPA 2MD7B 3PUQA 1VYXA 5B76A 2VPDA 2LV9A 5EYAF 2VPBA 4AUQB 4A4BA 2DX8A 3M99A 4F52B 2L43A 2YSMA 5DINA 4MSXA 3O33A 4GB0A 4W4UA 5KH7A 4R8PK 2CKLA 3SHBA 2ECTA 2K17A 4WA6A 3HCUA 4FO9A 2CSYA 5B78A 2FSAA 2ECGA 2KFTA 2XEUA 3M62A 3IHPA 1WEOA 1JOCA 5LKXA 5AITA 4V3LC 3KV5A 3L1XA 3GV4A 2YSJA 4LJNA 5LKUA 2K4DA 2PNXA 2E6RA 3N9LA 2ZETC 3ZVYA 4A49A 1V87A 5AIUA 4QF3A 1FP0A 3KV6A 4YAXA 5I3LA 5G04B 1DVPA 1VFYA 3N9OA 2MD8C 4L7XA 4LADB 5B79A 3I2DA 2KREA 3SOUA 2LQ6A 3ZPVE 1WEWA 4AYCA 2KYUA 3O36A 1LDKC 3O70A 1WIMA 1T1HA 2CSZA 4LLBA 2JRJA 3ZNIA 4YABA 4TKPB 5TDWA 2HYED 1WEVA 1CHCA 2YUCA 2ECWA 3KQIA 2KWKA 2KIZA 4QF2A 3M63A 4WZ3B 2LGLA 2YREA 2EODA 1RMDA 5KH9A 2LGVA 2G6QA 4R2YA 2LDRA 5H1TA 3U5PA 4CCGX 4IC3A 1MM2A 1K2FA 4UP0A 3RTRB 2LXPC 5TRBA 1JM7B 2G43A 4FK5A 5FERA 2MUMA 4S3OC 2ECIA 4YBTA 4L58A 5G05B 3RPGB 5DKAA 4AVXA 4B7YC 1X4IA 2Y43A 2IDAA 4GNFA 2H0DB 2FUUA 4LK9A 1MM3A 3DQVR 2JMJA 2VJEB 3EB5A 2VJFA 5TBNA 4B86C 2ECVA 5J3XA 2YQLA 1U6GB 3PURA 3DPLR 4ZUXU 4V3KC 2EA6A 4LKAA 3ZYQA 2JMDA 3QZVA 4UI9B 5FB0A 4I7BA 2AN6A 2Y1MA 1F62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOW A;  2FUI A;  1XWH A;  2Y1N A;  2F6J A;  2LN0 A;  2MA5 A;  1JM7 A;  3MHH A;  3N9P A;  2RI7 A;  2K1J A;  3N9Q A;  3C6W A;  3ZTG A;  2QJ0 A;  1Z60 A;  2MIQ A;  3L1Z B;  4A4C A;  4O64 A;  2H0D A;  1WIL A;  4WZ2 A;  2G45 A;  2VJE A;  4YAT A;  2YYR A;  2LGK A;  3KNV A;  5H1U A;  3ASL A;  1X4J A;  1WEU A;  3O7A A;  4GNE A;  2VP7 A;  2M3H A;  2KR4 A;  4PPE A;  4PTB A;  5LCW B;  3O37 A;  2YUR A;  4IC2 A;  5B77 A;  2MNY A;  5TDR A;  1ZBD B;  3LQH A;  1WEN A;  4GNG A;  2QIZ A;  2L5U A;  3GL6 A;  5G0F A;  1X4U A;  3PHD A;  3U5M A;  3N9N A;  3EB6 A;  1Z6U A;  2YHN A;  3LQJ A;  2XB1 A;  4YBM A;  1FBV A;  2M6M A;  4ZDT A;  2BAY A;  3T7L A;  2ECJ A;  1HYI A;  4I7D A;  4AP4 A;  4I7C A;  4GND A;  2VPE A;  3N9M A;  4WZ0 A;  2LXH C;  2F42 A;  2KWO A;  3L11 A;  5LKZ A;  4C9Z A;  4S3O B;  1WEP A;  2L0B A;  4A0C D;  4AYC B;  1WES A;  2MA6 A;  5B8D A;  5C13 A;  3U5N A;  5D1L B;  2YW8 A;  2YT5 A;  3HTK C;  1BOR A;  4P5O B;  3VK6 A;  2I50 A;  2C2V S;  2MT5 A;  4N3W A;  2LGG A;  2E6S A;  3SOX A;  5JG6 A;  2QIC A;  3V43 A;  2K16 A;  4BHW A;  4FJC A;  3C5K A;  1G25 A;  2M85 A;  2NAA A;  5H1V A;  4YAD A;  1VD4 A;  1E4U A;  2UZG A;  1WGM A;  4N4F A;  5D1M B;  2MNZ A;  2F6N A;  2KGI A;  2KWJ A;  2KU3 A;  4CA1 A;  2HDP A;  5B75 A;  2M1R A;  2VNF A;  3LRQ A;  2KGG A;  4R7E A;  1Z2Q A;  1WEM A;  2ECN A;  1WEE A;  1WEQ A;  2L75 A;  5C11 A;  2VPG A;  2KE1 A;  3T6R A;  4YC9 A;  3U5O A;  2PUY A;  2YU4 A;  1HYJ A;  1IYM A;  3FL2 A;  2OXQ C;  5LKT A;  2D8S A;  2L80 A;  2VJF B;  4ZQL A;  5H9M A;  2C2L A;  3HCT A;  1WE9 A;  3MHS A;  4MVT A;  3ZVZ B;  3HCS A;  4BBQ A;  2CKL B;  1N87 A;  5FEY A;  4Q6F A;  2JMI A;  4FIP A;  3ZPV 1;  2YQM A;  3LQI A;  5TAB A;  5FB1 A;  1LDJ B;  2LRI C;  2RSD A;  5KH3 A;  2CT2 A;  5D1K B;  4NN2 A;  3NG2 A;  4UP5 A;  2KWN A;  4X3G A;  2YHO A;  1WFK A;  3O34 A;  3RPG C;  4XI1 A;  4YBS A;  3O35 A;  2EGP A;  2MD7 B;  3PUQ A;  1VYX A;  5B76 A;  2VPD A;  2LV9 A;  5EYA F;  2VPB A;  4AUQ B;  4A4B A;  2DX8 A;  3M99 A;  4F52 B;  2L43 A;  2YSM A;  5DIN A;  4MSX A;  3O33 A;  4GB0 A;  4W4U A;  5KH7 A;  4R8P K;  2CKL A;  3SHB A;  2ECT A;  2K17 A;  4WA6 A;  3HCU A;  4FO9 A;  2CSY A;  5B78 A;  2FSA A;  2ECG A;  2KFT A;  2XEU A;  3M62 A;  3IHP A;  1WEO A;  1JOC A;  5LKX A;  5AIT A;  4V3L C;  3KV5 A;  3L1X A;  3GV4 A;  2YSJ A;  4LJN A;  5LKU A;  2K4D A;  2PNX A;  2E6R A;  3N9L A;  2ZET C;  3ZVY A;  4A49 A;  1V87 A;  5AIU A;  4QF3 A;  1FP0 A;  3KV6 A;  4YAX A;  5I3L A;  5G04 B;  1DVP A;  1VFY A;  3N9O A;  2MD8 C;  4L7X A;  4LAD B;  5B79 A;  3I2D A;  2KRE A;  3SOU A;  2LQ6 A;  3ZPV E;  1WEW A;  4AYC A;  2KYU A;  3O36 A;  1LDK C;  3O70 A;  1WIM A;  1T1H A;  2CSZ A;  4LLB A;  2JRJ A;  3ZNI A;  4YAB A;  4TKP B;  5TDW A;  2HYE D;  1WEV A;  1CHC A;  2YUC A;  2ECW A;  3KQI A;  2KWK A;  2KIZ A;  4QF2 A;  3M63 A;  4WZ3 B;  2LGL A;  2YRE A;  2EOD A;  1RMD A;  5KH9 A;  2LGV A;  2G6Q A;  4R2Y A;  2LDR A;  5H1T A;  3U5P A;  4CCG X;  4IC3 A;  1MM2 A;  1K2F A;  4UP0 A;  3RTR B;  2LXP C;  5TRB A;  1JM7 B;  2G43 A;  4FK5 A;  5FER A;  2MUM A;  4S3O C;  2ECI A;  4YBT A;  4L58 A;  5G05 B;  3RPG B;  5DKA A;  4AVX A;  4B7Y C;  1X4I A;  2Y43 A;  2IDA A;  4GNF A;  2H0D B;  2FUU A;  4LK9 A;  1MM3 A;  3DQV R;  2JMJ A;  2VJE B;  3EB5 A;  2VJF A;  5TBN A;  4B86 C;  2ECV A;  5J3X A;  2YQL A;  1U6G B;  3PUR A;  3DPL R;  4ZUX U;  4V3K C;  2EA6 A;  4LKA A;  3ZYQ A;  2JMD A;  3QZV A;  4UI9 B;  5FB0 A;  4I7B A;  2AN6 A;  2Y1M A;  1F62 A; 
#chains in the Genus database with same CATH topology
 3SOW A;  2FUI A;  1XWH A;  2Y1N A;  2F6J A;  2LN0 A;  2MA5 A;  1JM7 A;  2FD4 A;  3MHH A;  3N9P A;  2RI7 A;  4F1P A;  2K1J A;  3N9Q A;  3C6W A;  3ZTG A;  2IQJ A;  2QJ0 A;  1Z60 A;  2MIQ A;  3L1Z B;  4A4C A;  4O64 A;  1MBM A;  2H0D A;  1WIL A;  4WZ2 A;  2G45 A;  2VJE A;  4YAT A;  2YYR A;  2LGK A;  3KNV A;  2JUN A;  5H1U A;  3ASL A;  1X4J A;  1WEU A;  3FAN A;  3O7A A;  4GNE A;  2VP7 A;  2M3H A;  2KR4 A;  4PPE A;  4PTB A;  5LCW B;  3O37 A;  2YUR A;  4IC2 A;  5B77 A;  2MNY A;  5TDR A;  1ZBD B;  3LQH A;  1WEN A;  4GNG A;  2QIZ A;  2L5U A;  3GL6 A;  5G0F A;  1X4U A;  3PHD A;  3U5M A;  3N9N A;  3EB6 A;  1Z6U A;  2YHN A;  3LQJ A;  2XB1 A;  4YBM A;  2L7P A;  2XOY A;  1FBV A;  2M6M A;  3Q1D A;  2OWA A;  4ZDT A;  2BAY A;  3T7L A;  2ECJ A;  1HYI A;  4I7D A;  2FFW A;  3FM8 C;  4AP4 A;  4I7C A;  4GND A;  2VPE A;  3N9M A;  4WZ0 A;  2CON A;  2LXH C;  2F42 A;  2KWO A;  3L11 A;  3MDB C;  4C9Z A;  5LKZ A;  1WEP A;  4S3O B;  2L0B A;  4A0C D;  2KKX A;  2XOZ A;  2XOC A;  4AYC B;  1WES A;  2MA6 A;  3SUB A;  5B8D A;  5C13 A;  3U5N A;  5D1L B;  2YW8 A;  2YT5 A;  3HTK C;  1BOR A;  4P5O B;  3VK6 A;  2DJA A;  2I50 A;  2C2V S;  2MT5 A;  4N3W A;  2LGG A;  2E6S A;  3SOX A;  5JG6 A;  2QIC A;  3V43 A;  2K16 A;  3FJU B;  4BHW A;  4FJC A;  3C5K A;  1G25 A;  2M85 A;  2NAA A;  5H1V A;  4YAD A;  1VD4 A;  1E4U A;  2UZG A;  1WGM A;  4N4F A;  5D1M B;  2MNZ A;  2F6N A;  3KDE C;  2KGI A;  2KWJ A;  2KU3 A;  4CA1 A;  2HDP A;  2MKE A;  5B75 A;  2M1R A;  2VNF A;  3LRQ A;  4O62 A;  2KGG A;  2D8U A;  4R7E A;  1Z2Q A;  1WEM A;  2ECN A;  1WEE A;  5SVI B;  1WEQ A;  2L75 A;  5C11 A;  2VPG A;  2KE1 A;  3T6R A;  4YC9 A;  3U5O A;  2PUY A;  2YU4 A;  1HYJ A;  1IYM A;  3FL2 A;  2OXQ C;  2CSV A;  5LKT A;  2D8S A;  2L80 A;  3H7H A;  2VJF B;  4ZQL A;  5H9M A;  2C2L A;  3HCT A;  1WE9 A;  3MHS A;  2XP0 A;  4MVT A;  3ZVZ B;  3HCS A;  4BBQ A;  2CKL B;  1N87 A;  5FEY A;  4Q6F A;  2JMI A;  4FIP A;  4Z0R A;  3ZPV 1;  2YQM A;  3LQI A;  5TAB A;  5FB1 A;  2B0O E;  3LJU X;  1LDJ B;  2LRI C;  2RSD A;  5KH3 A;  3LDY A;  2CT2 A;  5D1K B;  4NN2 A;  3NG2 A;  4UP5 A;  2KWN A;  4X3G A;  2YHO A;  1WFK A;  3O34 A;  3RPG C;  4XI1 A;  4YBS A;  3O35 A;  2EGP A;  2MD7 B;  3PUQ A;  3O47 A;  1VYX A;  4OGE A;  5B76 A;  2VPD A;  2LV9 A;  2YVR A;  5SVI A;  5EYA F;  2VPB A;  2DSM A;  4AUQ B;  4A4B A;  2DX8 A;  3DWD A;  3M99 A;  4F52 B;  2L43 A;  2YSM A;  5DIN A;  4MSX A;  3O33 A;  4GB0 A;  4W4U A;  5KH7 A;  4R8P K;  4QQ4 A;  2CKL A;  3SHB A;  2ECT A;  2K17 A;  4WA6 A;  3HCU A;  4FO9 A;  2CSY A;  5B78 A;  2FSA A;  2ECG A;  2KFT A;  2RR4 A;  2XEU A;  3M62 A;  3IHP A;  2EGM A;  1WEO A;  1JOC A;  5LKX A;  5AIT A;  4V3L C;  3KV5 A;  3L1X A;  3GV4 A;  2YSJ A;  5SVY A;  4LJN A;  5LKU A;  2K4D A;  2PNX A;  5SVX A;  2E6R A;  3N9L A;  2ZET C;  3ZVY A;  4A49 A;  3JUE A;  1V87 A;  5AIU A;  2E61 A;  4QF3 A;  3LVQ E;  1FP0 A;  3KV6 A;  4YAX A;  5I3L A;  5G04 B;  1DVP A;  1VFY A;  3N9O A;  4L7X A;  2MD8 C;  4LAD B;  5B79 A;  3I2D A;  1DCQ A;  2KRE A;  3SOU A;  2LQ6 A;  3ZPV E;  1WEW A;  4AYC A;  2KYU A;  3O36 A;  1LDK C;  3O70 A;  1WIM A;  1T1H A;  2CSZ A;  4LLB A;  2JM3 A;  2JRJ A;  3ZNI A;  2M13 A;  4YAB A;  4TKP B;  5TDW A;  2HYE D;  1WEV A;  1CHC A;  2YUC A;  2ECW A;  3KQI A;  2KWK A;  3PLW A;  2LAU A;  2KIZ A;  4QF2 A;  2P57 A;  3M63 A;  4WZ3 B;  2LGL A;  2YRE A;  2CRW A;  2EOD A;  1RMD A;  5KH9 A;  2LGV A;  2G6Q A;  4R2Y A;  2LDR A;  5H1T A;  3U5P A;  4CCG X;  4IC3 A;  1MM2 A;  4H9D A;  1K2F A;  3LVR E;  4UP0 A;  5K3Q A;  3RTR B;  2LXP C;  5TRB A;  1JM7 B;  3DDT A;  3M7K A;  2G43 A;  4FK5 A;  5FER A;  2EXU A;  2MUM A;  4S3O C;  2ECI A;  2KKY A;  4YBT A;  3T9K A;  4L58 A;  5G05 B;  3E2D A;  3RPG B;  5DKA A;  4AVX A;  4B7Y C;  1X4I A;  2CRR A;  2Y43 A;  2IDA A;  4GNF A;  2H0D B;  2FUU A;  4LK9 A;  1MM3 A;  3DQV R;  2JMJ A;  2VJE B;  3EB5 A;  2VJF A;  5TBN A;  3FAO A;  4B86 C;  2ECV A;  5J3X A;  2YQL A;  1U6G B;  3PUR A;  3DPL R;  4ZUX U;  4V3K C;  2EA6 A;  4LKA A;  3ZYQ A;  4OGC A;  2JMD A;  3QZV A;  4UI9 B;  4I7B A;  5FB0 A;  2AN6 A;  2Y1M A;  4Z0O A;  3FEH A;  1F62 A; 
#chains in the Genus database with same CATH homology
 3SOW A;  2FUI A;  1XWH A;  2Y1N A;  2F6J A;  2LN0 A;  2MA5 A;  1JM7 A;  3MHH A;  3N9P A;  2RI7 A;  2K1J A;  3N9Q A;  3C6W A;  3ZTG A;  2QJ0 A;  1Z60 A;  2MIQ A;  3L1Z B;  4A4C A;  4O64 A;  2H0D A;  1WIL A;  4WZ2 A;  2G45 A;  2VJE A;  4YAT A;  2YYR A;  2LGK A;  3KNV A;  5H1U A;  3ASL A;  1X4J A;  1WEU A;  3O7A A;  4GNE A;  2VP7 A;  2M3H A;  2KR4 A;  4PPE A;  4PTB A;  5LCW B;  3O37 A;  2YUR A;  4IC2 A;  5B77 A;  2MNY A;  5TDR A;  1ZBD B;  3LQH A;  1WEN A;  4GNG A;  2QIZ A;  2L5U A;  3GL6 A;  5G0F A;  1X4U A;  3PHD A;  3U5M A;  3N9N A;  3EB6 A;  1Z6U A;  2YHN A;  3LQJ A;  2XB1 A;  4YBM A;  1FBV A;  2M6M A;  4ZDT A;  2BAY A;  3T7L A;  2ECJ A;  1HYI A;  4I7D A;  4AP4 A;  4I7C A;  4GND A;  2VPE A;  3N9M A;  4WZ0 A;  2LXH C;  2F42 A;  2KWO A;  3L11 A;  5LKZ A;  4C9Z A;  4S3O B;  1WEP A;  2L0B A;  4A0C D;  4AYC B;  1WES A;  2MA6 A;  5B8D A;  5C13 A;  3U5N A;  5D1L B;  2YW8 A;  2YT5 A;  3HTK C;  1BOR A;  4P5O B;  3VK6 A;  2I50 A;  2C2V S;  2MT5 A;  4N3W A;  2LGG A;  2E6S A;  3SOX A;  5JG6 A;  2QIC A;  3V43 A;  2K16 A;  4BHW A;  4FJC A;  3C5K A;  1G25 A;  2M85 A;  2NAA A;  5H1V A;  4YAD A;  1VD4 A;  1E4U A;  2UZG A;  1WGM A;  4N4F A;  5D1M B;  2MNZ A;  2F6N A;  2KGI A;  2KWJ A;  2KU3 A;  4CA1 A;  2HDP A;  5B75 A;  2M1R A;  2VNF A;  3LRQ A;  2KGG A;  4R7E A;  1Z2Q A;  1WEM A;  2ECN A;  1WEE A;  1WEQ A;  2L75 A;  5C11 A;  2VPG A;  2KE1 A;  3T6R A;  4YC9 A;  3U5O A;  2PUY A;  2YU4 A;  1HYJ A;  1IYM A;  3FL2 A;  2OXQ C;  5LKT A;  2D8S A;  2L80 A;  2VJF B;  4ZQL A;  5H9M A;  2C2L A;  3HCT A;  1WE9 A;  3MHS A;  4MVT A;  3ZVZ B;  3HCS A;  4BBQ A;  2CKL B;  1N87 A;  5FEY A;  4Q6F A;  2JMI A;  4FIP A;  3ZPV 1;  2YQM A;  3LQI A;  5TAB A;  5FB1 A;  1LDJ B;  2LRI C;  2RSD A;  5KH3 A;  2CT2 A;  5D1K B;  4NN2 A;  3NG2 A;  4UP5 A;  2KWN A;  4X3G A;  2YHO A;  1WFK A;  3O34 A;  3RPG C;  4XI1 A;  4YBS A;  3O35 A;  2EGP A;  2MD7 B;  3PUQ A;  1VYX A;  5B76 A;  2VPD A;  2LV9 A;  5EYA F;  2VPB A;  4AUQ B;  4A4B A;  2DX8 A;  3M99 A;  4F52 B;  2L43 A;  2YSM A;  5DIN A;  4MSX A;  3O33 A;  4GB0 A;  4W4U A;  5KH7 A;  4R8P K;  2CKL A;  3SHB A;  2ECT A;  2K17 A;  4WA6 A;  3HCU A;  4FO9 A;  2CSY A;  5B78 A;  2FSA A;  2ECG A;  2KFT A;  2XEU A;  3M62 A;  3IHP A;  1WEO A;  1JOC A;  5LKX A;  5AIT A;  4V3L C;  3KV5 A;  3L1X A;  3GV4 A;  2YSJ A;  4LJN A;  5LKU A;  2K4D A;  2PNX A;  2E6R A;  3N9L A;  2ZET C;  3ZVY A;  4A49 A;  1V87 A;  5AIU A;  4QF3 A;  1FP0 A;  3KV6 A;  4YAX A;  5I3L A;  5G04 B;  1DVP A;  1VFY A;  3N9O A;  2MD8 C;  4L7X A;  4LAD B;  5B79 A;  3I2D A;  2KRE A;  3SOU A;  2LQ6 A;  3ZPV E;  1WEW A;  4AYC A;  2KYU A;  3O36 A;  1LDK C;  3O70 A;  1WIM A;  1T1H A;  2CSZ A;  4LLB A;  2JRJ A;  3ZNI A;  4YAB A;  4TKP B;  5TDW A;  2HYE D;  1WEV A;  1CHC A;  2YUC A;  2ECW A;  3KQI A;  2KWK A;  2KIZ A;  4QF2 A;  3M63 A;  4WZ3 B;  2LGL A;  2YRE A;  2EOD A;  1RMD A;  5KH9 A;  2LGV A;  2G6Q A;  4R2Y A;  2LDR A;  5H1T A;  3U5P A;  4CCG X;  4IC3 A;  1MM2 A;  1K2F A;  4UP0 A;  3RTR B;  2LXP C;  5TRB A;  1JM7 B;  2G43 A;  4FK5 A;  5FER A;  2MUM A;  4S3O C;  2ECI A;  4YBT A;  4L58 A;  5G05 B;  3RPG B;  5DKA A;  4AVX A;  4B7Y C;  1X4I A;  2Y43 A;  2IDA A;  4GNF A;  2H0D B;  2FUU A;  4LK9 A;  1MM3 A;  3DQV R;  2JMJ A;  2VJE B;  3EB5 A;  2VJF A;  5TBN A;  4B86 C;  2ECV A;  5J3X A;  2YQL A;  1U6G B;  3PUR A;  3DPL R;  4ZUX U;  4V3K C;  2EA6 A;  4LKA A;  3ZYQ A;  2JMD A;  3QZV A;  4UI9 B;  5FB0 A;  4I7B A;  2AN6 A;  2Y1M A;  1F62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...