2LGGA

Structure of phd domain of uhrf1 in complex with h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lggA00
3O36A 2BAYA 4IC2A 4Q6FA 4GNFA 1FP0A 3LQJA 4YBSA 2Y1MA 2KWNA 3NG2A 3PHDA 3SHBA 4AUQB 5EYAF 5KH7A 4A4CA 3RPGB 4YABA 4AP4A 2AN6A 3O37A 5FEYA 3O33A 4O64A 4YBTA 2MT5A 4FJCA 1Z60A 2YW8A 2LRIC 2DX8A 2KYUA 2LDRA 2KFTA 4QF2A 1WENA 2I50A 4LK9A 2QJ0A 2VPBA 2ECIA 3M63A 3KNVA 2LXPC 2YHNA 5KH3A 2HDPA 4I7CA 5TRBA 2FSAA 1WEWA 2IDAA 3I2DA 2E6RA 5C13A 3SOXA 2NAAA 2K1JA 2LXHC 2RI7A 3IHPA 4QF3A 4WA6A 4V3LC 4YC9A 5TABA 1RMDA 3VK6A 2QIZA 4UI9B 4I7BA 2LGGA 5H1VA 3V43A 4S3OC 1JM7A 1X4UA 3EB5A 2K17A 3PURA 5FB1A 3ASLA 2CKLA 2Y1NA 1ZBDB 3DQVR 2KREA 1WEVA 4GNDA 4AYCB 3LRQA 2OXQC 4FIPA 3ZVZB 3LQHA 2KE1A 2LGVA 2G45A 1Z2QA 4NN2A 5LKUA 4YBMA 5G0FA 4WZ2A 4BBQA 4MSXA 3O34A 1T1HA 2LQ6A 3O70A 2ECTA 2G43A 2KGIA 2KIZA 3RPGC 2YQLA 2L5UA 2VJFA 3L1ZB 4FK5A 2MA6A 3C6WA 1WEEA 3QZVA 3ZTGA 3O35A 5C11A 3HCTA 5J3XA 3ZVYA 2L75A 4CA1A 2CKLB 2EODA 2YQMA 2VJEA 3C5KA 2FUUA 4LJNA 3ZNIA 5B78A 4WZ0A 2LV9A 3KQIA 1E4UA 2H0DA 3N9OA 2ECGA 1WEOA 5D1KB 3KV6A 3M99A 2YURA 4YADA 5FERA 2LGKA 4L58A 4N4FA 4GB0A 1LDKC 4LKAA 5D1LB 4B86C 3SOUA 2ECNA 2E6SA 4ZDTA 2CSYA 4TKPB 4ZUXU 4B7YC 1WIMA 2JMJA 2YREA 2M3HA 2CSZA 1WFKA 1DVPA 5KH9A 1MM3A 5TDRA 5I3LA 2C2VS 3U5OA 5FB0A 4W4UA 1WE9A 1V87A 3LQIA 3EB6A 4A0CD 4ZQLA 3M62A 2L43A 2KU3A 3U5MA 5H9MA 5LCWB 2JRJA 4WZ3B 2MNZA 4R7EA 4C9ZA 3FL2A 4A49A 1WILA 2PUYA 4X3GA 4LADB 2JMDA 4GNGA 2YSJA 2VNFA 4BHWA 2YUCA 1WEPA 3N9LA 5H1UA 2LGLA 5LKTA 2M1RA 3PUQA 3N9NA 2VP7A 2QICA 3U5PA 3GV4A 2L0BA 3MHSA 2F6JA 5TBNA 3ZPV1 1WEQA 1U6GB 3N9QA 2EGPA 4MVTA 2KR4A 2ZETC 1JM7B 3HCUA 2D8SA 3KV5A 1VD4A 2L80A 4UP0A 2FUIA 5DINA 2M85A 3HCSA 3O7AA 5B8DA 2K16A 3L11A 2YT5A 4UP5A 4A4BA 5H1TA 2YU4A 4PTBA 2C2LA 5TDWA 2KWOA 3ZPVE 1JOCA 1WEUA 2MA5A 4LLBA 2F42A 2MNYA 5G05B 3L1XA 2UZGA 1WGMA 4FO9A 4XI1A 1IYMA 2KGGA 4V3KC 2G6QA 4F52B 2VJFB 1N87A 5LKXA 4AVXA 2LN0A 5B79A 3ZYQA 3HTKC 5B76A 1Z6UA 2EA6A 2HYED 3DPLR 3RTRB 1X4JA 5LKZA 2KWJA 2VJEB 2MUMA 5JG6A 2H0DB 2JMIA 4R2YA 1FBVA 4AYCA 1WEMA 4I7DA 2KWKA 4YATA 2K4DA 2VPGA 1K2FA 1CHCA 5B77A 2M6MA 2XB1A 1WESA 4P5OB 2VPDA 2YHOA 5B75A 2VPEA 4IC3A 2ECJA 2XEUA 3GL6A 1HYIA 4PPEA 1LDJB 2CT2A 3MHHA 3SOWA 5AIUA 5DKAA 1G25A 2MD7B 1MM2A 2MD8C 3T7LA 5G04B 2MIQA 1BORA 4N3WA 4YAXA 5AITA 4R8PK 1HYJA 2ECWA 3N9MA 5D1MB 4L7XA 2YSMA 2PNXA 2RSDA 1XWHA 4S3OB 1VFYA 2ECVA 1X4IA 4GNEA 1VYXA 2F6NA 3N9PA 2Y43A 2YYRA 3T6RA 1F62A 4CCGX 3U5NA
chains in the Genus database with same CATH superfamily
3O36A 2BAYA 3O47A 4IC2A 4Q6FA 4GNFA 1FP0A 3LQJA 4YBSA 2Y1MA 2EXUA 2KWNA 2B0OE 3NG2A 3PHDA 3SHBA 1MBMA 4AUQB 5EYAF 5KH7A 4A4CA 3RPGB 4YABA 4AP4A 2KKYA 2AN6A 3O37A 5FEYA 2FFWA 3O33A 4O64A 4YBTA 2OWAA 2MT5A 2CRRA 4FJCA 1Z60A 2YW8A 2LRIC 2DX8A 3LJUX 2KYUA 2LDRA 2KFTA 4QF2A 1WENA 2I50A 4LK9A 2QJ0A 2VPBA 2ECIA 3M63A 3KNVA 2LXPC 2YHNA 5KH3A 2HDPA 4I7CA 5TRBA 2FSAA 1WEWA 2IDAA 3I2DA 2E6RA 5C13A 3SOXA 2NAAA 2K1JA 2LXHC 4QQ4A 2RI7A 3IHPA 4QF3A 4WA6A 4V3LC 4YC9A 5TABA 1RMDA 3VK6A 2QIZA 4UI9B 2LAUA 4I7BA 2LGGA 5K3QA 5H1VA 3V43A 4S3OC 1JM7A 2JM3A 1X4UA 3EB5A 2K17A 2XP0A 3PURA 5FB1A 3ASLA 2CKLA 2Y1NA 1ZBDB 3DQVR 2E61A 2KREA 1WEVA 4GNDA 4AYCB 3LRQA 2OXQC 4FIPA 2MKEA 3LQHA 3ZVZB 2KE1A 2LGVA 2G45A 3LVRE 2RR4A 4H9DA 1Z2QA 4NN2A 4O62A 5LKUA 4YBMA 5G0FA 4WZ2A 4BBQA 4MSXA 3O34A 1T1HA 2LQ6A 2P57A 3O70A 2ECTA 2G43A 2KGIA 2XOCA 2KIZA 3RPGC 2YQLA 2L5UA 2VJFA 3L1ZB 4FK5A 2MA6A 3C6WA 1WEEA 3QZVA 3ZTGA 5SVIB 3O35A 5C11A 3HCTA 5J3XA 3ZVYA 2L75A 4CA1A 2CKLB 2EODA 2FD4A 2VJEA 2YQMA 2FUUA 3C5KA 4LJNA 3ZNIA 5B78A 4WZ0A 2LV9A 3KQIA 1E4UA 2H0DA 3N9OA 2ECGA 1WEOA 5D1KB 3KV6A 3M99A 3SUBA 2YURA 4YADA 5FERA 2LGKA 4L58A 4N4FA 4GB0A 1LDKC 4LKAA 5D1LB 4B86C 3SOUA 2ECNA 2E6SA 4ZDTA 2CSYA 4TKPB 2M13A 4ZUXU 2CRWA 4B7YC 1WIMA 2JMJA 2YREA 2M3HA 2CSZA 1WFKA 1DVPA 5KH9A 1MM3A 5TDRA 5I3LA 2C2VS 3U5OA 5FB0A 4W4UA 1WE9A 1V87A 2D8UA 3LQIA 3EB6A 4A0CD 4ZQLA 3M62A 2L43A 2KU3A 3U5MA 2KKXA 5H9MA 5LCWB 5SVYA 2JRJA 2XOZA 3MDBC 4WZ3B 2MNZA 3H7HA 4F1PA 4R7EA 4C9ZA 3FL2A 4A49A 1WILA 2PUYA 3LVQE 4X3GA 4LADB 2JMDA 4GNGA 2YSJA 2VNFA 4BHWA 2YUCA 1WEPA 3JUEA 3N9LA 5H1UA 2LGLA 5LKTA 2M1RA 3PUQA 4OGEA 3N9NA 2VP7A 2QICA 3FJUB 3U5PA 3GV4A 2L0BA 3MHSA 2DSMA 2F6JA 5TBNA 3ZPV1 1WEQA 1U6GB 3N9QA 2DJAA 2EGPA 2CSVA 4MVTA 2KR4A 2ZETC 1JM7B 3HCUA 2D8SA 3KV5A 3DDTA 1VD4A 2L80A 4UP0A 4Z0RA 2FUIA 5DINA 2M85A 3HCSA 3E2DA 3O7AA 4OGCA 5B8DA 2K16A 3L11A 2YT5A 4UP5A 4A4BA 5H1TA 2YU4A 4PTBA 2C2LA 5TDWA 2KWOA 3ZPVE 1JOCA 1WEUA 2MA5A 4LLBA 2F42A 2MNYA 2L7PA 5G05B 3L1XA 2UZGA 3T9KA 2JUNA 1WGMA 4FO9A 4XI1A 1IYMA 2KGGA 4V3KC 2EGMA 3Q1DA 2G6QA 4F52B 2VJFB 1N87A 5LKXA 4AVXA 2LN0A 3FAOA 5B79A 3ZYQA 1DCQA 3HTKC 5B76A 1Z6UA 2EA6A 2HYED 3DPLR 3RTRB 1X4JA 5LKZA 2KWJA 2VJEB 2MUMA 2XOYA 5JG6A 2H0DB 2JMIA 4R2YA 1FBVA 4AYCA 2YVRA 2IQJA 3FM8C 1WEMA 4I7DA 2KWKA 4YATA 2K4DA 2VPGA 1K2FA 1CHCA 5B77A 2M6MA 2XB1A 1WESA 4P5OB 2VPDA 2YHOA 5B75A 2VPEA 4IC3A 2CONA 2ECJA 2XEUA 3GL6A 1HYIA 4PPEA 1LDJB 2CT2A 3MHHA 3SOWA 5SVIA 5AIUA 5DKAA 1G25A 2MD7B 3LDYA 4Z0OA 1MM2A 2MD8C 5SVXA 3T7LA 5G04B 2MIQA 1BORA 4N3WA 4YAXA 5AITA 3M7KA 4R8PK 1HYJA 2ECWA 3N9MA 5D1MB 4L7XA 3KDEC 2YSMA 3PLWA 2PNXA 2RSDA 1XWHA 4S3OB 1VFYA 2ECVA 3DWDA 1X4IA 4GNEA 3FEHA 1VYXA 2F6NA 3N9PA 3FANA 2Y43A 2YYRA 3T6RA 1F62A 4CCGX 3U5NA
chains in the Genus database with same CATH topology
3O36A 2BAYA 4IC2A 4Q6FA 4GNFA 1FP0A 3LQJA 4YBSA 2Y1MA 2KWNA 3NG2A 3PHDA 3SHBA 4AUQB 5EYAF 5KH7A 4A4CA 3RPGB 4YABA 4AP4A 2AN6A 3O37A 5FEYA 3O33A 4O64A 4YBTA 2MT5A 4FJCA 1Z60A 2YW8A 2LRIC 2DX8A 2KYUA 2LDRA 2KFTA 4QF2A 1WENA 2I50A 4LK9A 2QJ0A 2VPBA 2ECIA 3M63A 3KNVA 2LXPC 2YHNA 5KH3A 2HDPA 4I7CA 5TRBA 2FSAA 1WEWA 2IDAA 3I2DA 2E6RA 5C13A 3SOXA 2NAAA 2K1JA 2LXHC 2RI7A 3IHPA 4QF3A 4WA6A 4V3LC 4YC9A 5TABA 1RMDA 3VK6A 2QIZA 4UI9B 4I7BA 2LGGA 5H1VA 3V43A 4S3OC 1JM7A 1X4UA 3EB5A 2K17A 3PURA 5FB1A 3ASLA 2CKLA 2Y1NA 1ZBDB 3DQVR 2KREA 1WEVA 4GNDA 4AYCB 3LRQA 2OXQC 4FIPA 3ZVZB 3LQHA 2KE1A 2LGVA 2G45A 1Z2QA 4NN2A 5LKUA 4YBMA 5G0FA 4WZ2A 4BBQA 4MSXA 3O34A 1T1HA 2LQ6A 3O70A 2ECTA 2G43A 2KGIA 2KIZA 3RPGC 2YQLA 2L5UA 2VJFA 3L1ZB 4FK5A 2MA6A 3C6WA 1WEEA 3QZVA 3ZTGA 3O35A 5C11A 3HCTA 5J3XA 3ZVYA 2L75A 4CA1A 2CKLB 2EODA 2YQMA 2VJEA 3C5KA 2FUUA 4LJNA 3ZNIA 5B78A 4WZ0A 2LV9A 3KQIA 1E4UA 2H0DA 3N9OA 2ECGA 1WEOA 5D1KB 3KV6A 3M99A 2YURA 4YADA 5FERA 2LGKA 4L58A 4N4FA 4GB0A 1LDKC 4LKAA 5D1LB 4B86C 3SOUA 2ECNA 2E6SA 4ZDTA 2CSYA 4TKPB 4ZUXU 4B7YC 1WIMA 2JMJA 2YREA 2M3HA 2CSZA 1WFKA 1DVPA 5KH9A 1MM3A 5TDRA 5I3LA 2C2VS 3U5OA 5FB0A 4W4UA 1WE9A 1V87A 3LQIA 3EB6A 4A0CD 4ZQLA 3M62A 2L43A 2KU3A 3U5MA 5H9MA 5LCWB 2JRJA 4WZ3B 2MNZA 4R7EA 4C9ZA 3FL2A 4A49A 1WILA 2PUYA 4X3GA 4LADB 2JMDA 4GNGA 2YSJA 2VNFA 4BHWA 2YUCA 1WEPA 3N9LA 5H1UA 2LGLA 5LKTA 2M1RA 3PUQA 3N9NA 2VP7A 2QICA 3U5PA 3GV4A 2L0BA 3MHSA 2F6JA 5TBNA 3ZPV1 1WEQA 1U6GB 3N9QA 2EGPA 4MVTA 2KR4A 2ZETC 1JM7B 3HCUA 2D8SA 3KV5A 1VD4A 2L80A 4UP0A 2FUIA 5DINA 2M85A 3HCSA 3O7AA 5B8DA 2K16A 3L11A 2YT5A 4UP5A 4A4BA 5H1TA 2YU4A 4PTBA 2C2LA 5TDWA 2KWOA 3ZPVE 1JOCA 1WEUA 2MA5A 4LLBA 2F42A 2MNYA 5G05B 3L1XA 2UZGA 1WGMA 4FO9A 4XI1A 1IYMA 2KGGA 4V3KC 2G6QA 4F52B 2VJFB 1N87A 5LKXA 4AVXA 2LN0A 5B79A 3ZYQA 3HTKC 5B76A 1Z6UA 2EA6A 2HYED 3DPLR 3RTRB 1X4JA 5LKZA 2KWJA 2VJEB 2MUMA 5JG6A 2H0DB 2JMIA 4R2YA 1FBVA 4AYCA 1WEMA 4I7DA 2KWKA 4YATA 2K4DA 2VPGA 1K2FA 1CHCA 5B77A 2M6MA 2XB1A 1WESA 4P5OB 2VPDA 2YHOA 5B75A 2VPEA 4IC3A 2ECJA 2XEUA 3GL6A 1HYIA 4PPEA 1LDJB 2CT2A 3MHHA 3SOWA 5AIUA 5DKAA 1G25A 2MD7B 1MM2A 2MD8C 3T7LA 5G04B 2MIQA 1BORA 4N3WA 4YAXA 5AITA 4R8PK 1HYJA 2ECWA 3N9MA 5D1MB 4L7XA 2YSMA 2PNXA 2RSDA 1XWHA 4S3OB 1VFYA 2ECVA 1X4IA 4GNEA 1VYXA 2F6NA 3N9PA 2Y43A 2YYRA 3T6RA 1F62A 4CCGX 3U5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O36 A;  2BAY A;  4IC2 A;  4Q6F A;  4GNF A;  1FP0 A;  3LQJ A;  4YBS A;  2Y1M A;  2KWN A;  3NG2 A;  3PHD A;  3SHB A;  4AUQ B;  5EYA F;  5KH7 A;  4A4C A;  3RPG B;  4YAB A;  4AP4 A;  2AN6 A;  3O37 A;  5FEY A;  3O33 A;  4O64 A;  4YBT A;  2MT5 A;  4FJC A;  1Z60 A;  2YW8 A;  2LRI C;  2DX8 A;  2KYU A;  2LDR A;  2KFT A;  4QF2 A;  1WEN A;  2I50 A;  4LK9 A;  2QJ0 A;  2VPB A;  2ECI A;  3M63 A;  3KNV A;  2LXP C;  2YHN A;  5KH3 A;  2HDP A;  4I7C A;  5TRB A;  2FSA A;  1WEW A;  2IDA A;  3I2D A;  2E6R A;  5C13 A;  3SOX A;  2NAA A;  2K1J A;  2LXH C;  2RI7 A;  3IHP A;  4QF3 A;  4WA6 A;  4V3L C;  4YC9 A;  5TAB A;  1RMD A;  3VK6 A;  2QIZ A;  4UI9 B;  4I7B A;  2LGG A;  5H1V A;  3V43 A;  4S3O C;  1JM7 A;  1X4U A;  3EB5 A;  2K17 A;  3PUR A;  5FB1 A;  3ASL A;  2CKL A;  2Y1N A;  1ZBD B;  3DQV R;  2KRE A;  1WEV A;  4GND A;  4AYC B;  3LRQ A;  2OXQ C;  4FIP A;  3ZVZ B;  3LQH A;  2KE1 A;  2LGV A;  2G45 A;  1Z2Q A;  4NN2 A;  5LKU A;  4YBM A;  5G0F A;  4WZ2 A;  4BBQ A;  4MSX A;  3O34 A;  1T1H A;  2LQ6 A;  3O70 A;  2ECT A;  2G43 A;  2KGI A;  2KIZ A;  3RPG C;  2YQL A;  2L5U A;  2VJF A;  3L1Z B;  4FK5 A;  2MA6 A;  3C6W A;  1WEE A;  3QZV A;  3ZTG A;  3O35 A;  5C11 A;  3HCT A;  5J3X A;  3ZVY A;  2L75 A;  4CA1 A;  2CKL B;  2EOD A;  2YQM A;  2VJE A;  3C5K A;  2FUU A;  4LJN A;  3ZNI A;  5B78 A;  4WZ0 A;  2LV9 A;  3KQI A;  1E4U A;  2H0D A;  3N9O A;  2ECG A;  1WEO A;  5D1K B;  3KV6 A;  3M99 A;  2YUR A;  4YAD A;  5FER A;  2LGK A;  4L58 A;  4N4F A;  4GB0 A;  1LDK C;  4LKA A;  5D1L B;  4B86 C;  3SOU A;  2ECN A;  2E6S A;  4ZDT A;  2CSY A;  4TKP B;  4ZUX U;  4B7Y C;  1WIM A;  2JMJ A;  2YRE A;  2M3H A;  2CSZ A;  1WFK A;  1DVP A;  5KH9 A;  1MM3 A;  5TDR A;  5I3L A;  2C2V S;  3U5O A;  5FB0 A;  4W4U A;  1WE9 A;  1V87 A;  3LQI A;  3EB6 A;  4A0C D;  4ZQL A;  3M62 A;  2L43 A;  2KU3 A;  3U5M A;  5H9M A;  5LCW B;  2JRJ A;  4WZ3 B;  2MNZ A;  4R7E A;  4C9Z A;  3FL2 A;  4A49 A;  1WIL A;  2PUY A;  4X3G A;  4LAD B;  2JMD A;  4GNG A;  2YSJ A;  2VNF A;  4BHW A;  2YUC A;  1WEP A;  3N9L A;  5H1U A;  2LGL A;  5LKT A;  2M1R A;  3PUQ A;  3N9N A;  2VP7 A;  2QIC A;  3U5P A;  3GV4 A;  2L0B A;  3MHS A;  2F6J A;  5TBN A;  3ZPV 1;  1WEQ A;  1U6G B;  3N9Q A;  2EGP A;  4MVT A;  2KR4 A;  2ZET C;  1JM7 B;  3HCU A;  2D8S A;  3KV5 A;  1VD4 A;  2L80 A;  4UP0 A;  2FUI A;  5DIN A;  2M85 A;  3HCS A;  3O7A A;  5B8D A;  2K16 A;  3L11 A;  2YT5 A;  4UP5 A;  4A4B A;  5H1T A;  2YU4 A;  4PTB A;  2C2L A;  5TDW A;  2KWO A;  3ZPV E;  1JOC A;  1WEU A;  2MA5 A;  4LLB A;  2F42 A;  2MNY A;  5G05 B;  3L1X A;  2UZG A;  1WGM A;  4FO9 A;  4XI1 A;  1IYM A;  2KGG A;  4V3K C;  2G6Q A;  4F52 B;  2VJF B;  1N87 A;  5LKX A;  4AVX A;  2LN0 A;  5B79 A;  3ZYQ A;  3HTK C;  5B76 A;  1Z6U A;  2EA6 A;  2HYE D;  3DPL R;  3RTR B;  1X4J A;  5LKZ A;  2KWJ A;  2VJE B;  2MUM A;  5JG6 A;  2H0D B;  2JMI A;  4R2Y A;  1FBV A;  4AYC A;  1WEM A;  4I7D A;  2KWK A;  4YAT A;  2K4D A;  2VPG A;  1K2F A;  1CHC A;  5B77 A;  2M6M A;  2XB1 A;  1WES A;  4P5O B;  2VPD A;  2YHO A;  5B75 A;  2VPE A;  4IC3 A;  2ECJ A;  2XEU A;  3GL6 A;  1HYI A;  4PPE A;  1LDJ B;  2CT2 A;  3MHH A;  3SOW A;  5AIU A;  5DKA A;  1G25 A;  2MD7 B;  1MM2 A;  2MD8 C;  3T7L A;  5G04 B;  2MIQ A;  1BOR A;  4N3W A;  4YAX A;  5AIT A;  4R8P K;  1HYJ A;  2ECW A;  3N9M A;  5D1M B;  4L7X A;  2YSM A;  2PNX A;  2RSD A;  1XWH A;  4S3O B;  1VFY A;  2ECV A;  1X4I A;  4GNE A;  1VYX A;  2F6N A;  3N9P A;  2Y43 A;  2YYR A;  3T6R A;  1F62 A;  4CCG X;  3U5N A; 
#chains in the Genus database with same CATH topology
 3O36 A;  2BAY A;  3O47 A;  4IC2 A;  4Q6F A;  4GNF A;  1FP0 A;  3LQJ A;  4YBS A;  2Y1M A;  2EXU A;  2KWN A;  2B0O E;  3NG2 A;  3PHD A;  3SHB A;  1MBM A;  4AUQ B;  5EYA F;  5KH7 A;  4A4C A;  3RPG B;  4YAB A;  4AP4 A;  2KKY A;  2AN6 A;  3O37 A;  5FEY A;  2FFW A;  3O33 A;  4O64 A;  4YBT A;  2OWA A;  2MT5 A;  2CRR A;  4FJC A;  1Z60 A;  2YW8 A;  2LRI C;  2DX8 A;  3LJU X;  2KYU A;  2LDR A;  2KFT A;  4QF2 A;  1WEN A;  2I50 A;  4LK9 A;  2QJ0 A;  2VPB A;  2ECI A;  3M63 A;  3KNV A;  2LXP C;  2YHN A;  5KH3 A;  2HDP A;  4I7C A;  5TRB A;  2FSA A;  1WEW A;  2IDA A;  3I2D A;  2E6R A;  5C13 A;  3SOX A;  2NAA A;  2K1J A;  2LXH C;  4QQ4 A;  2RI7 A;  3IHP A;  4QF3 A;  4WA6 A;  4V3L C;  4YC9 A;  5TAB A;  1RMD A;  3VK6 A;  2QIZ A;  4UI9 B;  2LAU A;  4I7B A;  2LGG A;  5K3Q A;  5H1V A;  3V43 A;  4S3O C;  1JM7 A;  2JM3 A;  1X4U A;  3EB5 A;  2K17 A;  2XP0 A;  3PUR A;  5FB1 A;  3ASL A;  2CKL A;  2Y1N A;  1ZBD B;  3DQV R;  2E61 A;  2KRE A;  1WEV A;  4GND A;  4AYC B;  3LRQ A;  2OXQ C;  4FIP A;  2MKE A;  3LQH A;  3ZVZ B;  2KE1 A;  2LGV A;  2G45 A;  3LVR E;  2RR4 A;  4H9D A;  1Z2Q A;  4NN2 A;  4O62 A;  5LKU A;  4YBM A;  5G0F A;  4WZ2 A;  4BBQ A;  4MSX A;  3O34 A;  1T1H A;  2LQ6 A;  2P57 A;  3O70 A;  2ECT A;  2G43 A;  2KGI A;  2XOC A;  2KIZ A;  3RPG C;  2YQL A;  2L5U A;  2VJF A;  3L1Z B;  4FK5 A;  2MA6 A;  3C6W A;  1WEE A;  3QZV A;  3ZTG A;  5SVI B;  3O35 A;  5C11 A;  3HCT A;  5J3X A;  3ZVY A;  2L75 A;  4CA1 A;  2CKL B;  2EOD A;  2FD4 A;  2VJE A;  2YQM A;  2FUU A;  3C5K A;  4LJN A;  3ZNI A;  5B78 A;  4WZ0 A;  2LV9 A;  3KQI A;  1E4U A;  2H0D A;  3N9O A;  2ECG A;  1WEO A;  5D1K B;  3KV6 A;  3M99 A;  3SUB A;  2YUR A;  4YAD A;  5FER A;  2LGK A;  4L58 A;  4N4F A;  4GB0 A;  1LDK C;  4LKA A;  5D1L B;  4B86 C;  3SOU A;  2ECN A;  2E6S A;  4ZDT A;  2CSY A;  4TKP B;  2M13 A;  4ZUX U;  2CRW A;  4B7Y C;  1WIM A;  2JMJ A;  2YRE A;  2M3H A;  2CSZ A;  1WFK A;  1DVP A;  5KH9 A;  1MM3 A;  5TDR A;  5I3L A;  2C2V S;  3U5O A;  5FB0 A;  4W4U A;  1WE9 A;  1V87 A;  2D8U A;  3LQI A;  3EB6 A;  4A0C D;  4ZQL A;  3M62 A;  2L43 A;  2KU3 A;  3U5M A;  2KKX A;  5H9M A;  5LCW B;  5SVY A;  2JRJ A;  2XOZ A;  3MDB C;  4WZ3 B;  2MNZ A;  3H7H A;  4F1P A;  4R7E A;  4C9Z A;  3FL2 A;  4A49 A;  1WIL A;  2PUY A;  3LVQ E;  4X3G A;  4LAD B;  2JMD A;  4GNG A;  2YSJ A;  2VNF A;  4BHW A;  2YUC A;  1WEP A;  3JUE A;  3N9L A;  5H1U A;  2LGL A;  5LKT A;  2M1R A;  3PUQ A;  4OGE A;  3N9N A;  2VP7 A;  2QIC A;  3FJU B;  3U5P A;  3GV4 A;  2L0B A;  3MHS A;  2DSM A;  2F6J A;  5TBN A;  3ZPV 1;  1WEQ A;  1U6G B;  3N9Q A;  2DJA A;  2EGP A;  2CSV A;  4MVT A;  2KR4 A;  2ZET C;  1JM7 B;  3HCU A;  2D8S A;  3KV5 A;  3DDT A;  1VD4 A;  2L80 A;  4UP0 A;  4Z0R A;  2FUI A;  5DIN A;  2M85 A;  3HCS A;  3E2D A;  3O7A A;  4OGC A;  5B8D A;  2K16 A;  3L11 A;  2YT5 A;  4UP5 A;  4A4B A;  5H1T A;  2YU4 A;  4PTB A;  2C2L A;  5TDW A;  2KWO A;  3ZPV E;  1JOC A;  1WEU A;  2MA5 A;  4LLB A;  2F42 A;  2MNY A;  2L7P A;  5G05 B;  3L1X A;  2UZG A;  3T9K A;  2JUN A;  1WGM A;  4FO9 A;  4XI1 A;  1IYM A;  2KGG A;  4V3K C;  2EGM A;  3Q1D A;  2G6Q A;  4F52 B;  2VJF B;  1N87 A;  5LKX A;  4AVX A;  2LN0 A;  3FAO A;  5B79 A;  3ZYQ A;  1DCQ A;  3HTK C;  5B76 A;  1Z6U A;  2EA6 A;  2HYE D;  3DPL R;  3RTR B;  1X4J A;  5LKZ A;  2KWJ A;  2VJE B;  2MUM A;  2XOY A;  5JG6 A;  2H0D B;  2JMI A;  4R2Y A;  1FBV A;  4AYC A;  2YVR A;  2IQJ A;  3FM8 C;  1WEM A;  4I7D A;  2KWK A;  4YAT A;  2K4D A;  2VPG A;  1K2F A;  1CHC A;  5B77 A;  2M6M A;  2XB1 A;  1WES A;  4P5O B;  2VPD A;  2YHO A;  5B75 A;  2VPE A;  4IC3 A;  2CON A;  2ECJ A;  2XEU A;  3GL6 A;  1HYI A;  4PPE A;  1LDJ B;  2CT2 A;  3MHH A;  3SOW A;  5SVI A;  5AIU A;  5DKA A;  1G25 A;  2MD7 B;  3LDY A;  4Z0O A;  1MM2 A;  2MD8 C;  5SVX A;  3T7L A;  5G04 B;  2MIQ A;  1BOR A;  4N3W A;  4YAX A;  5AIT A;  3M7K A;  4R8P K;  1HYJ A;  2ECW A;  3N9M A;  5D1M B;  4L7X A;  3KDE C;  2YSM A;  3PLW A;  2PNX A;  2RSD A;  1XWH A;  4S3O B;  1VFY A;  2ECV A;  3DWD A;  1X4I A;  4GNE A;  3FEH A;  1VYX A;  2F6N A;  3N9P A;  3FAN A;  2Y43 A;  2YYR A;  3T6R A;  1F62 A;  4CCG X;  3U5N A; 
#chains in the Genus database with same CATH homology
 3O36 A;  2BAY A;  4IC2 A;  4Q6F A;  4GNF A;  1FP0 A;  3LQJ A;  4YBS A;  2Y1M A;  2KWN A;  3NG2 A;  3PHD A;  3SHB A;  4AUQ B;  5EYA F;  5KH7 A;  4A4C A;  3RPG B;  4YAB A;  4AP4 A;  2AN6 A;  3O37 A;  5FEY A;  3O33 A;  4O64 A;  4YBT A;  2MT5 A;  4FJC A;  1Z60 A;  2YW8 A;  2LRI C;  2DX8 A;  2KYU A;  2LDR A;  2KFT A;  4QF2 A;  1WEN A;  2I50 A;  4LK9 A;  2QJ0 A;  2VPB A;  2ECI A;  3M63 A;  3KNV A;  2LXP C;  2YHN A;  5KH3 A;  2HDP A;  4I7C A;  5TRB A;  2FSA A;  1WEW A;  2IDA A;  3I2D A;  2E6R A;  5C13 A;  3SOX A;  2NAA A;  2K1J A;  2LXH C;  2RI7 A;  3IHP A;  4QF3 A;  4WA6 A;  4V3L C;  4YC9 A;  5TAB A;  1RMD A;  3VK6 A;  2QIZ A;  4UI9 B;  4I7B A;  2LGG A;  5H1V A;  3V43 A;  4S3O C;  1JM7 A;  1X4U A;  3EB5 A;  2K17 A;  3PUR A;  5FB1 A;  3ASL A;  2CKL A;  2Y1N A;  1ZBD B;  3DQV R;  2KRE A;  1WEV A;  4GND A;  4AYC B;  3LRQ A;  2OXQ C;  4FIP A;  3ZVZ B;  3LQH A;  2KE1 A;  2LGV A;  2G45 A;  1Z2Q A;  4NN2 A;  5LKU A;  4YBM A;  5G0F A;  4WZ2 A;  4BBQ A;  4MSX A;  3O34 A;  1T1H A;  2LQ6 A;  3O70 A;  2ECT A;  2G43 A;  2KGI A;  2KIZ A;  3RPG C;  2YQL A;  2L5U A;  2VJF A;  3L1Z B;  4FK5 A;  2MA6 A;  3C6W A;  1WEE A;  3QZV A;  3ZTG A;  3O35 A;  5C11 A;  3HCT A;  5J3X A;  3ZVY A;  2L75 A;  4CA1 A;  2CKL B;  2EOD A;  2YQM A;  2VJE A;  3C5K A;  2FUU A;  4LJN A;  3ZNI A;  5B78 A;  4WZ0 A;  2LV9 A;  3KQI A;  1E4U A;  2H0D A;  3N9O A;  2ECG A;  1WEO A;  5D1K B;  3KV6 A;  3M99 A;  2YUR A;  4YAD A;  5FER A;  2LGK A;  4L58 A;  4N4F A;  4GB0 A;  1LDK C;  4LKA A;  5D1L B;  4B86 C;  3SOU A;  2ECN A;  2E6S A;  4ZDT A;  2CSY A;  4TKP B;  4ZUX U;  4B7Y C;  1WIM A;  2JMJ A;  2YRE A;  2M3H A;  2CSZ A;  1WFK A;  1DVP A;  5KH9 A;  1MM3 A;  5TDR A;  5I3L A;  2C2V S;  3U5O A;  5FB0 A;  4W4U A;  1WE9 A;  1V87 A;  3LQI A;  3EB6 A;  4A0C D;  4ZQL A;  3M62 A;  2L43 A;  2KU3 A;  3U5M A;  5H9M A;  5LCW B;  2JRJ A;  4WZ3 B;  2MNZ A;  4R7E A;  4C9Z A;  3FL2 A;  4A49 A;  1WIL A;  2PUY A;  4X3G A;  4LAD B;  2JMD A;  4GNG A;  2YSJ A;  2VNF A;  4BHW A;  2YUC A;  1WEP A;  3N9L A;  5H1U A;  2LGL A;  5LKT A;  2M1R A;  3PUQ A;  3N9N A;  2VP7 A;  2QIC A;  3U5P A;  3GV4 A;  2L0B A;  3MHS A;  2F6J A;  5TBN A;  3ZPV 1;  1WEQ A;  1U6G B;  3N9Q A;  2EGP A;  4MVT A;  2KR4 A;  2ZET C;  1JM7 B;  3HCU A;  2D8S A;  3KV5 A;  1VD4 A;  2L80 A;  4UP0 A;  2FUI A;  5DIN A;  2M85 A;  3HCS A;  3O7A A;  5B8D A;  2K16 A;  3L11 A;  2YT5 A;  4UP5 A;  4A4B A;  5H1T A;  2YU4 A;  4PTB A;  2C2L A;  5TDW A;  2KWO A;  3ZPV E;  1JOC A;  1WEU A;  2MA5 A;  4LLB A;  2F42 A;  2MNY A;  5G05 B;  3L1X A;  2UZG A;  1WGM A;  4FO9 A;  4XI1 A;  1IYM A;  2KGG A;  4V3K C;  2G6Q A;  4F52 B;  2VJF B;  1N87 A;  5LKX A;  4AVX A;  2LN0 A;  5B79 A;  3ZYQ A;  3HTK C;  5B76 A;  1Z6U A;  2EA6 A;  2HYE D;  3DPL R;  3RTR B;  1X4J A;  5LKZ A;  2KWJ A;  2VJE B;  2MUM A;  5JG6 A;  2H0D B;  2JMI A;  4R2Y A;  1FBV A;  4AYC A;  1WEM A;  4I7D A;  2KWK A;  4YAT A;  2K4D A;  2VPG A;  1K2F A;  1CHC A;  5B77 A;  2M6M A;  2XB1 A;  1WES A;  4P5O B;  2VPD A;  2YHO A;  5B75 A;  2VPE A;  4IC3 A;  2ECJ A;  2XEU A;  3GL6 A;  1HYI A;  4PPE A;  1LDJ B;  2CT2 A;  3MHH A;  3SOW A;  5AIU A;  5DKA A;  1G25 A;  2MD7 B;  1MM2 A;  2MD8 C;  3T7L A;  5G04 B;  2MIQ A;  1BOR A;  4N3W A;  4YAX A;  5AIT A;  4R8P K;  1HYJ A;  2ECW A;  3N9M A;  5D1M B;  4L7X A;  2YSM A;  2PNX A;  2RSD A;  1XWH A;  4S3O B;  1VFY A;  2ECV A;  1X4I A;  4GNE A;  1VYX A;  2F6N A;  3N9P A;  2Y43 A;  2YYR A;  3T6R A;  1F62 A;  4CCG X;  3U5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...