2LGGA

Structure of phd domain of uhrf1 in complex with h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
molecule keywords E3 ubiquitin-protein ligase UHRF1
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lggA00
5KH3A 3U5MA 2L80A 2KE1A 2VPBA 3O36A 3ASLA 2KWKA 4L58A 3QZVA 5B76A 2EGPA 2L43A 2HYED 5H1UA 2YHOA 2H0DA 5H1TA 2LXPC 4A4BA 3HCTA 5D1LB 4GB0A 3PHDA 3ZVYA 2YHNA 2ECVA 1WEQA 3HCSA 3O33A 4WZ3B 2LRIC 2MA6A 2YQLA 3ZPVE 5JG6A 3LRQA 2JMJA 4R2YA 2KGIA 4L7XA 1VFYA 5C13A 3C6WA 5B75A 2K16A 5EYAF 4LLBA 4AYCB 3O35A 2Y1NA 3IHPA 4LKAA 4AVXA 5TBNA 1FBVA 4FO9A 1LDJB 2VJEB 1VD4A 2MD8C 2RI7A 5H1VA 3ZNIA 4AP4A 5B78A 1WIMA 5B79A 2RSDA 1ZBDB 3KV5A 5H9MA 5AIUA 4P5OB 2E6RA 2F42A 2YQMA 2YW8A 4B7YC 1WEUA 5TDRA 2M85A 2F6JA 2MA5A 2KREA 3KV6A 2FUUA 2CT2A 2VPEA 2KR4A 3RTRB 4GNFA 2MIQA 5FB0A 1HYIA 1WGMA 4A0CD 4UP0A 1K2FA 2VJEA 1Z6UA 3HCUA 3MHSA 3NG2A 4CA1A 3HTKC 2JMIA 1WEMA 1CHCA 2EA6A 4YBMA 4WA6A 2K1JA 4GNEA 5D1MB 4O64A 2E6SA 3O34A 4LK9A 5AITA 4ZQLA 4PPEA 3DQVR 3ZTGA 1JOCA 2OXQC 2KWNA 5LKTA 2F6NA 4ZDTA 2QJ0A 1WFKA 4S3OB 2LV9A 5J3XA 4WZ0A 5D1KB 3O37A 1WE9A 4LJNA 4IC3A 2C2VS 1VYXA 2JMDA 2M3HA 4ZUXU 2LGVA 2KWOA 4LADB 4FIPA 2ECWA 3LQIA 2KYUA 3ZVZB 1WILA 4MSXA 1WEVA 4CCGX 2HDPA 2KFTA 5G04B 3SOUA 4UP5A 4FJCA 3L1XA 3T7LA 5LKXA 2CKLB 4A49A 4YAXA 2YU4A 5TRBA 5KH7A 2MD7B 2QICA 2KIZA 3SOXA 2G45A 3PUQA 4R8PK 3I2DA 2ECGA 1HYJA 2ECJA 3VK6A 1E4UA 3V43A 2JRJA 2ECTA 2L5UA 2IDAA 3C5KA 3T6RA 1FP0A 5DINA 2LGKA 2AN6A 3EB6A 3L11A 4YABA 4GNDA 2MNZA 1Z60A 3GV4A 2D8SA 5LKUA 5I3LA 3SHBA 4MVTA 2LGGA 4W4UA 1LDKC 2L75A 2LQ6A 2CKLA 5LCWB 5FB1A 4TKPB 2YSMA 3M62A 2H0DB 4YATA 2M1RA 1WEWA 2LN0A 1IYMA 1BORA 1MM2A 5LKZA 2M6MA 2K17A 1N87A 1WESA 2XEUA 3M99A 4Q6FA 3RPGC 2Y1MA 2EODA 3L1ZB 4B86C 2G43A 2ECNA 2KU3A 5B8DA 4FK5A 4BHWA 1WEPA 2KWJA 2ZETC 4XI1A 2K4DA 3MHHA 5TABA 4WZ2A 3KQIA 4YBSA 2YT5A 2LGLA 2PUYA 4PTBA 5G0FA 2CSZA 3PURA 2C2LA 5DKAA 4QF2A 4BBQA 1JM7A 1G25A 2XB1A 4AYCA 4N4FA 3LQHA 4I7BA 3N9NA 3N9QA 1RMDA 2YYRA 1F62A 2ECIA 4YADA 5TDWA 2FSAA 2FUIA 2YSJA 2NAAA 3RPGB 2VJFB 3FL2A 1U6GB 3SOWA 4V3KC 1X4IA 4I7CA 2CSYA 2G6QA 3ZPV1 2KGGA 2VPGA 3N9PA 4N3WA 2PNXA 4GNGA 4AUQB 4QF3A 2VJFA 3U5OA 3U5NA 1WEOA 2UZGA 2QIZA 1X4UA 2BAYA 2MUMA 2VNFA 2YURA 3N9LA 2VP7A 4YC9A 4A4CA 4YBTA 4S3OC 3ZYQA 3EB5A 3O70A 2DX8A 2YREA 2I50A 2MT5A 3N9OA 2VPDA 1T1HA 4C9ZA 5FERA 2LXHC 3N9MA 1WENA 2L0BA 1XWHA 1Z2QA 3U5PA 1WEEA 3DPLR 3KNVA 3GL6A 3O7AA 1JM7B 4I7DA 2LDRA 2YUCA 4V3LC 1DVPA 5G05B 1MM3A 4X3GA 4IC2A 1X4JA 1V87A 5KH9A 4UI9B 5FEYA 4NN2A 3LQJA 4F52B 2MNYA 2Y43A 3M63A 5B77A 5C11A 4R7EA
chains in the Genus database with same CATH superfamily
5KH3A 3U5MA 2L80A 2XOCA 2KE1A 2VPBA 3O36A 3ASLA 2KWKA 4L58A 3QZVA 5B76A 3FANA 2EGPA 2L43A 2HYED 5H1UA 3LVQE 2YHOA 2H0DA 5H1TA 3FJUB 2LXPC 4A4BA 3HCTA 5D1LB 4GB0A 2DJAA 3PHDA 3ZVYA 2YHNA 2ECVA 1WEQA 3HCSA 3O33A 4WZ3B 2E61A 2LRIC 2YVRA 5SVIB 2MKEA 2MA6A 2YQLA 3ZPVE 5JG6A 3LRQA 2JMJA 4R2YA 2KGIA 4L7XA 1VFYA 5C13A 3C6WA 5B75A 2K16A 4H9DA 5K3QA 5EYAF 4LLBA 4AYCB 3O35A 2Y1NA 3IHPA 4LKAA 4AVXA 5TBNA 1FBVA 4FO9A 1LDJB 2VJEB 1VD4A 2MD8C 2RI7A 5H1VA 3ZNIA 4AP4A 5B78A 1WIMA 3MDBC 5B79A 2RSDA 1ZBDB 3KV5A 5SVYA 4P5OB 5AIUA 2E6RA 5H9MA 2F42A 2YQMA 2YW8A 4B7YC 3LDYA 2CRWA 1WEUA 5TDRA 2M85A 2F6JA 2MA5A 2KREA 3FEHA 3KV6A 2FUUA 2KKXA 2CT2A 2VPEA 2KR4A 3RTRB 4GNFA 2MIQA 5FB0A 1HYIA 1WGMA 4UP0A 4A0CD 1K2FA 2VJEA 1Z6UA 3HCUA 3MHSA 3NG2A 4CA1A 3HTKC 2JMIA 3SUBA 1WEMA 1CHCA 2EA6A 4YBMA 4WA6A 2K1JA 4GNEA 2FFWA 5D1MB 2JUNA 4O64A 2E6SA 3JUEA 3O34A 4LK9A 5AITA 5SVXA 2CRRA 4ZQLA 5SVIA 4PPEA 2L7PA 3DQVR 3ZTGA 1JOCA 2OXQC 2XP0A 3DWDA 2KWNA 5LKTA 2F6NA 4ZDTA 2QJ0A 3PLWA 1WFKA 4QQ4A 4S3OB 2LV9A 5J3XA 4WZ0A 5D1KB 1DCQA 3O37A 1WE9A 4LJNA 4IC3A 2C2VS 1VYXA 2JMDA 2M3HA 3Q1DA 4ZUXU 2LGVA 2KWOA 4LADB 4FIPA 3FM8C 2ECWA 3LQIA 2KYUA 3ZVZB 1WILA 4MSXA 1WEVA 4CCGX 2HDPA 2KFTA 5G04B 3SOUA 4UP5A 4FJCA 3L1XA 3T7LA 5LKXA 2CKLB 4A49A 4Z0RA 2OWAA 4YAXA 2YU4A 5TRBA 1MBMA 5KH7A 2MD7B 2QICA 2KIZA 3SOXA 2G45A 3PUQA 4R8PK 3I2DA 2ECGA 1HYJA 2ECJA 3VK6A 1E4UA 3V43A 2JRJA 3O47A 2FD4A 2ECTA 2L5UA 2IDAA 3C5KA 3T6RA 1FP0A 5DINA 2B0OE 2LGKA 2AN6A 3EB6A 3L11A 4YABA 4GNDA 2MNZA 1Z60A 3GV4A 2D8SA 5LKUA 5I3LA 3SHBA 4MVTA 2LGGA 4W4UA 1LDKC 2JM3A 2L75A 2LQ6A 2CKLA 5LCWB 5FB1A 4TKPB 2YSMA 3M62A 2H0DB 4YATA 2M1RA 1WEWA 2LN0A 1IYMA 1BORA 1MM2A 5LKZA 2M6MA 2K17A 1N87A 1WESA 2XEUA 3M99A 2EGMA 4Q6FA 3RPGC 2Y1MA 2IQJA 2EODA 3L1ZB 4B86C 2G43A 2ECNA 2LAUA 2KU3A 5B8DA 4FK5A 4BHWA 2XOYA 3M7KA 1WEPA 2KWJA 2ZETC 4XI1A 2K4DA 3MHHA 4WZ2A 5TABA 3KQIA 4YBSA 2YT5A 2LGLA 2PUYA 4PTBA 5G0FA 2CSZA 3PURA 2C2LA 5DKAA 3KDEC 3H7HA 4QF2A 4BBQA 1JM7A 1G25A 2XB1A 2M13A 4AYCA 4N4FA 3LQHA 3LVRE 4I7BA 3N9NA 4F1PA 3N9QA 1RMDA 2YYRA 1F62A 2ECIA 4YADA 5TDWA 2FSAA 2FUIA 2YSJA 2NAAA 3RPGB 4Z0OA 2VJFB 3FL2A 1U6GB 3SOWA 4V3KC 1X4IA 4I7CA 2CSYA 2G6QA 3ZPV1 2KGGA 2DSMA 2VPGA 3N9PA 4N3WA 4O62A 2PNXA 4GNGA 4AUQB 4QF3A 2VJFA 2EXUA 3U5OA 3U5NA 1WEOA 2UZGA 2QIZA 2D8UA 1X4UA 2BAYA 2MUMA 2VNFA 2YURA 3N9LA 2VP7A 4OGCA 4YC9A 4A4CA 2XOZA 4YBTA 4S3OC 2RR4A 3ZYQA 3EB5A 3O70A 2DX8A 2YREA 2I50A 2MT5A 3N9OA 2VPDA 1T1HA 4C9ZA 5FERA 2LXHC 3DDTA 1WENA 3N9MA 2L0BA 1XWHA 1Z2QA 3U5PA 1WEEA 3DPLR 3KNVA 3GL6A 3O7AA 3FAOA 1JM7B 2CONA 4I7DA 2LDRA 2YUCA 4V3LC 1DVPA 5G05B 1MM3A 4X3GA 3LJUX 2CSVA 4IC2A 1X4JA 1V87A 2P57A 5KH9A 4UI9B 5FEYA 4NN2A 4OGEA 3LQJA 4F52B 2MNYA 2Y43A 3M63A 5B77A 2KKYA 5C11A 3T9KA 3E2DA 4R7EA
chains in the Genus database with same CATH topology
5KH3A 3U5MA 2L80A 2KE1A 2VPBA 3O36A 3ASLA 2KWKA 4L58A 3QZVA 5B76A 2EGPA 2L43A 2HYED 5H1UA 2YHOA 2H0DA 5H1TA 2LXPC 4A4BA 3HCTA 5D1LB 4GB0A 3PHDA 3ZVYA 2YHNA 2ECVA 1WEQA 3HCSA 3O33A 4WZ3B 2LRIC 2MA6A 2YQLA 3ZPVE 5JG6A 3LRQA 2JMJA 4R2YA 2KGIA 4L7XA 1VFYA 5C13A 3C6WA 5B75A 2K16A 5EYAF 4LLBA 4AYCB 3O35A 2Y1NA 3IHPA 4LKAA 4AVXA 5TBNA 1FBVA 4FO9A 1LDJB 2VJEB 1VD4A 2MD8C 2RI7A 5H1VA 3ZNIA 4AP4A 5B78A 1WIMA 5B79A 2RSDA 1ZBDB 3KV5A 5H9MA 5AIUA 4P5OB 2E6RA 2F42A 2YQMA 2YW8A 4B7YC 1WEUA 5TDRA 2M85A 2F6JA 2MA5A 2KREA 3KV6A 2FUUA 2CT2A 2VPEA 2KR4A 3RTRB 4GNFA 2MIQA 5FB0A 1HYIA 1WGMA 4A0CD 4UP0A 1K2FA 2VJEA 1Z6UA 3HCUA 3MHSA 3NG2A 4CA1A 3HTKC 2JMIA 1WEMA 1CHCA 2EA6A 4YBMA 4WA6A 2K1JA 4GNEA 5D1MB 4O64A 2E6SA 3O34A 4LK9A 5AITA 4ZQLA 4PPEA 3DQVR 3ZTGA 1JOCA 2OXQC 2KWNA 5LKTA 2F6NA 4ZDTA 2QJ0A 1WFKA 4S3OB 2LV9A 5J3XA 4WZ0A 5D1KB 3O37A 1WE9A 4LJNA 4IC3A 2C2VS 1VYXA 2JMDA 2M3HA 4ZUXU 2LGVA 2KWOA 4LADB 4FIPA 2ECWA 3LQIA 2KYUA 3ZVZB 1WILA 4MSXA 1WEVA 4CCGX 2HDPA 2KFTA 5G04B 3SOUA 4UP5A 4FJCA 3L1XA 3T7LA 5LKXA 2CKLB 4A49A 4YAXA 2YU4A 5TRBA 5KH7A 2MD7B 2QICA 2KIZA 3SOXA 2G45A 3PUQA 4R8PK 3I2DA 2ECGA 1HYJA 2ECJA 3VK6A 1E4UA 3V43A 2JRJA 2ECTA 2L5UA 2IDAA 3C5KA 3T6RA 1FP0A 5DINA 2LGKA 2AN6A 3EB6A 3L11A 4YABA 4GNDA 2MNZA 1Z60A 3GV4A 2D8SA 5LKUA 5I3LA 3SHBA 4MVTA 2LGGA 4W4UA 1LDKC 2L75A 2LQ6A 2CKLA 5LCWB 5FB1A 4TKPB 2YSMA 3M62A 2H0DB 4YATA 2M1RA 1WEWA 2LN0A 1IYMA 1BORA 1MM2A 5LKZA 2M6MA 2K17A 1N87A 1WESA 2XEUA 3M99A 4Q6FA 3RPGC 2Y1MA 2EODA 3L1ZB 4B86C 2G43A 2ECNA 2KU3A 5B8DA 4FK5A 4BHWA 1WEPA 2KWJA 2ZETC 4XI1A 2K4DA 3MHHA 5TABA 4WZ2A 3KQIA 4YBSA 2YT5A 2LGLA 2PUYA 4PTBA 5G0FA 2CSZA 3PURA 2C2LA 5DKAA 4QF2A 4BBQA 1JM7A 1G25A 2XB1A 4AYCA 4N4FA 3LQHA 4I7BA 3N9NA 3N9QA 1RMDA 2YYRA 1F62A 2ECIA 4YADA 5TDWA 2FSAA 2FUIA 2YSJA 2NAAA 3RPGB 2VJFB 3FL2A 1U6GB 3SOWA 4V3KC 1X4IA 4I7CA 2CSYA 2G6QA 3ZPV1 2KGGA 2VPGA 3N9PA 4N3WA 2PNXA 4GNGA 4AUQB 4QF3A 2VJFA 3U5OA 3U5NA 1WEOA 2UZGA 2QIZA 1X4UA 2BAYA 2MUMA 2VNFA 2YURA 3N9LA 2VP7A 4YC9A 4A4CA 4YBTA 4S3OC 3ZYQA 3EB5A 3O70A 2DX8A 2YREA 2I50A 2MT5A 3N9OA 2VPDA 1T1HA 4C9ZA 5FERA 2LXHC 3N9MA 1WENA 2L0BA 1XWHA 1Z2QA 3U5PA 1WEEA 3DPLR 3KNVA 3GL6A 3O7AA 1JM7B 4I7DA 2LDRA 2YUCA 4V3LC 1DVPA 5G05B 1MM3A 4X3GA 4IC2A 1X4JA 1V87A 5KH9A 4UI9B 5FEYA 4NN2A 3LQJA 4F52B 2MNYA 2Y43A 3M63A 5B77A 5C11A 4R7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH3 A;  3U5M A;  2L80 A;  2KE1 A;  2VPB A;  3O36 A;  3ASL A;  2KWK A;  4L58 A;  3QZV A;  5B76 A;  2EGP A;  2L43 A;  2HYE D;  5H1U A;  2YHO A;  2H0D A;  5H1T A;  2LXP C;  4A4B A;  3HCT A;  5D1L B;  4GB0 A;  3PHD A;  3ZVY A;  2YHN A;  2ECV A;  1WEQ A;  3HCS A;  3O33 A;  4WZ3 B;  2LRI C;  2MA6 A;  2YQL A;  3ZPV E;  5JG6 A;  3LRQ A;  2JMJ A;  4R2Y A;  2KGI A;  4L7X A;  1VFY A;  5C13 A;  3C6W A;  5B75 A;  2K16 A;  5EYA F;  4LLB A;  4AYC B;  3O35 A;  2Y1N A;  3IHP A;  4LKA A;  4AVX A;  5TBN A;  1FBV A;  4FO9 A;  1LDJ B;  2VJE B;  1VD4 A;  2MD8 C;  2RI7 A;  5H1V A;  3ZNI A;  4AP4 A;  5B78 A;  1WIM A;  5B79 A;  2RSD A;  1ZBD B;  3KV5 A;  5H9M A;  5AIU A;  4P5O B;  2E6R A;  2F42 A;  2YQM A;  2YW8 A;  4B7Y C;  1WEU A;  5TDR A;  2M85 A;  2F6J A;  2MA5 A;  2KRE A;  3KV6 A;  2FUU A;  2CT2 A;  2VPE A;  2KR4 A;  3RTR B;  4GNF A;  2MIQ A;  5FB0 A;  1HYI A;  1WGM A;  4A0C D;  4UP0 A;  1K2F A;  2VJE A;  1Z6U A;  3HCU A;  3MHS A;  3NG2 A;  4CA1 A;  3HTK C;  2JMI A;  1WEM A;  1CHC A;  2EA6 A;  4YBM A;  4WA6 A;  2K1J A;  4GNE A;  5D1M B;  4O64 A;  2E6S A;  3O34 A;  4LK9 A;  5AIT A;  4ZQL A;  4PPE A;  3DQV R;  3ZTG A;  1JOC A;  2OXQ C;  2KWN A;  5LKT A;  2F6N A;  4ZDT A;  2QJ0 A;  1WFK A;  4S3O B;  2LV9 A;  5J3X A;  4WZ0 A;  5D1K B;  3O37 A;  1WE9 A;  4LJN A;  4IC3 A;  2C2V S;  1VYX A;  2JMD A;  2M3H A;  4ZUX U;  2LGV A;  2KWO A;  4LAD B;  4FIP A;  2ECW A;  3LQI A;  2KYU A;  3ZVZ B;  1WIL A;  4MSX A;  1WEV A;  4CCG X;  2HDP A;  2KFT A;  5G04 B;  3SOU A;  4UP5 A;  4FJC A;  3L1X A;  3T7L A;  5LKX A;  2CKL B;  4A49 A;  4YAX A;  2YU4 A;  5TRB A;  5KH7 A;  2MD7 B;  2QIC A;  2KIZ A;  3SOX A;  2G45 A;  3PUQ A;  4R8P K;  3I2D A;  2ECG A;  1HYJ A;  2ECJ A;  3VK6 A;  1E4U A;  3V43 A;  2JRJ A;  2ECT A;  2L5U A;  2IDA A;  3C5K A;  3T6R A;  1FP0 A;  5DIN A;  2LGK A;  2AN6 A;  3EB6 A;  3L11 A;  4YAB A;  4GND A;  2MNZ A;  1Z60 A;  3GV4 A;  2D8S A;  5LKU A;  5I3L A;  3SHB A;  4MVT A;  2LGG A;  4W4U A;  1LDK C;  2L75 A;  2LQ6 A;  2CKL A;  5LCW B;  5FB1 A;  4TKP B;  2YSM A;  3M62 A;  2H0D B;  4YAT A;  2M1R A;  1WEW A;  2LN0 A;  1IYM A;  1BOR A;  1MM2 A;  5LKZ A;  2M6M A;  2K17 A;  1N87 A;  1WES A;  2XEU A;  3M99 A;  4Q6F A;  3RPG C;  2Y1M A;  2EOD A;  3L1Z B;  4B86 C;  2G43 A;  2ECN A;  2KU3 A;  5B8D A;  4FK5 A;  4BHW A;  1WEP A;  2KWJ A;  2ZET C;  4XI1 A;  2K4D A;  3MHH A;  5TAB A;  4WZ2 A;  3KQI A;  4YBS A;  2YT5 A;  2LGL A;  2PUY A;  4PTB A;  5G0F A;  2CSZ A;  3PUR A;  2C2L A;  5DKA A;  4QF2 A;  4BBQ A;  1JM7 A;  1G25 A;  2XB1 A;  4AYC A;  4N4F A;  3LQH A;  4I7B A;  3N9N A;  3N9Q A;  1RMD A;  2YYR A;  1F62 A;  2ECI A;  4YAD A;  5TDW A;  2FSA A;  2FUI A;  2YSJ A;  2NAA A;  3RPG B;  2VJF B;  3FL2 A;  1U6G B;  3SOW A;  4V3K C;  1X4I A;  4I7C A;  2CSY A;  2G6Q A;  3ZPV 1;  2KGG A;  2VPG A;  3N9P A;  4N3W A;  2PNX A;  4GNG A;  4AUQ B;  4QF3 A;  2VJF A;  3U5O A;  3U5N A;  1WEO A;  2UZG A;  2QIZ A;  1X4U A;  2BAY A;  2MUM A;  2VNF A;  2YUR A;  3N9L A;  2VP7 A;  4YC9 A;  4A4C A;  4YBT A;  4S3O C;  3ZYQ A;  3EB5 A;  3O70 A;  2DX8 A;  2YRE A;  2I50 A;  2MT5 A;  3N9O A;  2VPD A;  1T1H A;  4C9Z A;  5FER A;  2LXH C;  3N9M A;  1WEN A;  2L0B A;  1XWH A;  1Z2Q A;  3U5P A;  1WEE A;  3DPL R;  3KNV A;  3GL6 A;  3O7A A;  1JM7 B;  4I7D A;  2LDR A;  2YUC A;  4V3L C;  1DVP A;  5G05 B;  1MM3 A;  4X3G A;  4IC2 A;  1X4J A;  1V87 A;  5KH9 A;  4UI9 B;  5FEY A;  4NN2 A;  3LQJ A;  4F52 B;  2MNY A;  2Y43 A;  3M63 A;  5B77 A;  5C11 A;  4R7E A; 
#chains in the Genus database with same CATH topology
 5KH3 A;  3U5M A;  2L80 A;  2XOC A;  2KE1 A;  2VPB A;  3O36 A;  3ASL A;  2KWK A;  4L58 A;  3QZV A;  5B76 A;  3FAN A;  2EGP A;  2L43 A;  2HYE D;  5H1U A;  3LVQ E;  2YHO A;  2H0D A;  5H1T A;  3FJU B;  2LXP C;  4A4B A;  3HCT A;  5D1L B;  4GB0 A;  2DJA A;  3PHD A;  3ZVY A;  2YHN A;  2ECV A;  1WEQ A;  3HCS A;  3O33 A;  4WZ3 B;  2E61 A;  2LRI C;  2YVR A;  5SVI B;  2MKE A;  2MA6 A;  2YQL A;  3ZPV E;  5JG6 A;  3LRQ A;  2JMJ A;  4R2Y A;  2KGI A;  4L7X A;  1VFY A;  5C13 A;  3C6W A;  5B75 A;  2K16 A;  4H9D A;  5K3Q A;  5EYA F;  4LLB A;  4AYC B;  3O35 A;  2Y1N A;  3IHP A;  4LKA A;  4AVX A;  5TBN A;  1FBV A;  4FO9 A;  1LDJ B;  2VJE B;  1VD4 A;  2MD8 C;  2RI7 A;  5H1V A;  3ZNI A;  4AP4 A;  5B78 A;  1WIM A;  3MDB C;  5B79 A;  2RSD A;  1ZBD B;  3KV5 A;  5SVY A;  4P5O B;  5AIU A;  2E6R A;  5H9M A;  2F42 A;  2YQM A;  2YW8 A;  4B7Y C;  3LDY A;  2CRW A;  1WEU A;  5TDR A;  2M85 A;  2F6J A;  2MA5 A;  2KRE A;  3FEH A;  3KV6 A;  2FUU A;  2KKX A;  2CT2 A;  2VPE A;  2KR4 A;  3RTR B;  4GNF A;  2MIQ A;  5FB0 A;  1HYI A;  1WGM A;  4UP0 A;  4A0C D;  1K2F A;  2VJE A;  1Z6U A;  3HCU A;  3MHS A;  3NG2 A;  4CA1 A;  3HTK C;  2JMI A;  3SUB A;  1WEM A;  1CHC A;  2EA6 A;  4YBM A;  4WA6 A;  2K1J A;  4GNE A;  2FFW A;  5D1M B;  2JUN A;  4O64 A;  2E6S A;  3JUE A;  3O34 A;  4LK9 A;  5AIT A;  5SVX A;  2CRR A;  4ZQL A;  5SVI A;  4PPE A;  2L7P A;  3DQV R;  3ZTG A;  1JOC A;  2OXQ C;  2XP0 A;  3DWD A;  2KWN A;  5LKT A;  2F6N A;  4ZDT A;  2QJ0 A;  3PLW A;  1WFK A;  4QQ4 A;  4S3O B;  2LV9 A;  5J3X A;  4WZ0 A;  5D1K B;  1DCQ A;  3O37 A;  1WE9 A;  4LJN A;  4IC3 A;  2C2V S;  1VYX A;  2JMD A;  2M3H A;  3Q1D A;  4ZUX U;  2LGV A;  2KWO A;  4LAD B;  4FIP A;  3FM8 C;  2ECW A;  3LQI A;  2KYU A;  3ZVZ B;  1WIL A;  4MSX A;  1WEV A;  4CCG X;  2HDP A;  2KFT A;  5G04 B;  3SOU A;  4UP5 A;  4FJC A;  3L1X A;  3T7L A;  5LKX A;  2CKL B;  4A49 A;  4Z0R A;  2OWA A;  4YAX A;  2YU4 A;  5TRB A;  1MBM A;  5KH7 A;  2MD7 B;  2QIC A;  2KIZ A;  3SOX A;  2G45 A;  3PUQ A;  4R8P K;  3I2D A;  2ECG A;  1HYJ A;  2ECJ A;  3VK6 A;  1E4U A;  3V43 A;  2JRJ A;  3O47 A;  2FD4 A;  2ECT A;  2L5U A;  2IDA A;  3C5K A;  3T6R A;  1FP0 A;  5DIN A;  2B0O E;  2LGK A;  2AN6 A;  3EB6 A;  3L11 A;  4YAB A;  4GND A;  2MNZ A;  1Z60 A;  3GV4 A;  2D8S A;  5LKU A;  5I3L A;  3SHB A;  4MVT A;  2LGG A;  4W4U A;  1LDK C;  2JM3 A;  2L75 A;  2LQ6 A;  2CKL A;  5LCW B;  5FB1 A;  4TKP B;  2YSM A;  3M62 A;  2H0D B;  4YAT A;  2M1R A;  1WEW A;  2LN0 A;  1IYM A;  1BOR A;  1MM2 A;  5LKZ A;  2M6M A;  2K17 A;  1N87 A;  1WES A;  2XEU A;  3M99 A;  2EGM A;  4Q6F A;  3RPG C;  2Y1M A;  2IQJ A;  2EOD A;  3L1Z B;  4B86 C;  2G43 A;  2ECN A;  2LAU A;  2KU3 A;  5B8D A;  4FK5 A;  4BHW A;  2XOY A;  3M7K A;  1WEP A;  2KWJ A;  2ZET C;  4XI1 A;  2K4D A;  3MHH A;  4WZ2 A;  5TAB A;  3KQI A;  4YBS A;  2YT5 A;  2LGL A;  2PUY A;  4PTB A;  5G0F A;  2CSZ A;  3PUR A;  2C2L A;  5DKA A;  3KDE C;  3H7H A;  4QF2 A;  4BBQ A;  1JM7 A;  1G25 A;  2XB1 A;  2M13 A;  4AYC A;  4N4F A;  3LQH A;  3LVR E;  4I7B A;  3N9N A;  4F1P A;  3N9Q A;  1RMD A;  2YYR A;  1F62 A;  2ECI A;  4YAD A;  5TDW A;  2FSA A;  2FUI A;  2YSJ A;  2NAA A;  3RPG B;  4Z0O A;  2VJF B;  3FL2 A;  1U6G B;  3SOW A;  4V3K C;  1X4I A;  4I7C A;  2CSY A;  2G6Q A;  3ZPV 1;  2KGG A;  2DSM A;  2VPG A;  3N9P A;  4N3W A;  4O62 A;  2PNX A;  4GNG A;  4AUQ B;  4QF3 A;  2VJF A;  2EXU A;  3U5O A;  3U5N A;  1WEO A;  2UZG A;  2QIZ A;  2D8U A;  1X4U A;  2BAY A;  2MUM A;  2VNF A;  2YUR A;  3N9L A;  2VP7 A;  4OGC A;  4YC9 A;  4A4C A;  2XOZ A;  4YBT A;  4S3O C;  2RR4 A;  3ZYQ A;  3EB5 A;  3O70 A;  2DX8 A;  2YRE A;  2I50 A;  2MT5 A;  3N9O A;  2VPD A;  1T1H A;  4C9Z A;  5FER A;  2LXH C;  3DDT A;  1WEN A;  3N9M A;  2L0B A;  1XWH A;  1Z2Q A;  3U5P A;  1WEE A;  3DPL R;  3KNV A;  3GL6 A;  3O7A A;  3FAO A;  1JM7 B;  2CON A;  4I7D A;  2LDR A;  2YUC A;  4V3L C;  1DVP A;  5G05 B;  1MM3 A;  4X3G A;  3LJU X;  2CSV A;  4IC2 A;  1X4J A;  1V87 A;  2P57 A;  5KH9 A;  4UI9 B;  5FEY A;  4NN2 A;  4OGE A;  3LQJ A;  4F52 B;  2MNY A;  2Y43 A;  3M63 A;  5B77 A;  2KKY A;  5C11 A;  3T9K A;  3E2D A;  4R7E A; 
#chains in the Genus database with same CATH homology
 5KH3 A;  3U5M A;  2L80 A;  2KE1 A;  2VPB A;  3O36 A;  3ASL A;  2KWK A;  4L58 A;  3QZV A;  5B76 A;  2EGP A;  2L43 A;  2HYE D;  5H1U A;  2YHO A;  2H0D A;  5H1T A;  2LXP C;  4A4B A;  3HCT A;  5D1L B;  4GB0 A;  3PHD A;  3ZVY A;  2YHN A;  2ECV A;  1WEQ A;  3HCS A;  3O33 A;  4WZ3 B;  2LRI C;  2MA6 A;  2YQL A;  3ZPV E;  5JG6 A;  3LRQ A;  2JMJ A;  4R2Y A;  2KGI A;  4L7X A;  1VFY A;  5C13 A;  3C6W A;  5B75 A;  2K16 A;  5EYA F;  4LLB A;  4AYC B;  3O35 A;  2Y1N A;  3IHP A;  4LKA A;  4AVX A;  5TBN A;  1FBV A;  4FO9 A;  1LDJ B;  2VJE B;  1VD4 A;  2MD8 C;  2RI7 A;  5H1V A;  3ZNI A;  4AP4 A;  5B78 A;  1WIM A;  5B79 A;  2RSD A;  1ZBD B;  3KV5 A;  5H9M A;  5AIU A;  4P5O B;  2E6R A;  2F42 A;  2YQM A;  2YW8 A;  4B7Y C;  1WEU A;  5TDR A;  2M85 A;  2F6J A;  2MA5 A;  2KRE A;  3KV6 A;  2FUU A;  2CT2 A;  2VPE A;  2KR4 A;  3RTR B;  4GNF A;  2MIQ A;  5FB0 A;  1HYI A;  1WGM A;  4A0C D;  4UP0 A;  1K2F A;  2VJE A;  1Z6U A;  3HCU A;  3MHS A;  3NG2 A;  4CA1 A;  3HTK C;  2JMI A;  1WEM A;  1CHC A;  2EA6 A;  4YBM A;  4WA6 A;  2K1J A;  4GNE A;  5D1M B;  4O64 A;  2E6S A;  3O34 A;  4LK9 A;  5AIT A;  4ZQL A;  4PPE A;  3DQV R;  3ZTG A;  1JOC A;  2OXQ C;  2KWN A;  5LKT A;  2F6N A;  4ZDT A;  2QJ0 A;  1WFK A;  4S3O B;  2LV9 A;  5J3X A;  4WZ0 A;  5D1K B;  3O37 A;  1WE9 A;  4LJN A;  4IC3 A;  2C2V S;  1VYX A;  2JMD A;  2M3H A;  4ZUX U;  2LGV A;  2KWO A;  4LAD B;  4FIP A;  2ECW A;  3LQI A;  2KYU A;  3ZVZ B;  1WIL A;  4MSX A;  1WEV A;  4CCG X;  2HDP A;  2KFT A;  5G04 B;  3SOU A;  4UP5 A;  4FJC A;  3L1X A;  3T7L A;  5LKX A;  2CKL B;  4A49 A;  4YAX A;  2YU4 A;  5TRB A;  5KH7 A;  2MD7 B;  2QIC A;  2KIZ A;  3SOX A;  2G45 A;  3PUQ A;  4R8P K;  3I2D A;  2ECG A;  1HYJ A;  2ECJ A;  3VK6 A;  1E4U A;  3V43 A;  2JRJ A;  2ECT A;  2L5U A;  2IDA A;  3C5K A;  3T6R A;  1FP0 A;  5DIN A;  2LGK A;  2AN6 A;  3EB6 A;  3L11 A;  4YAB A;  4GND A;  2MNZ A;  1Z60 A;  3GV4 A;  2D8S A;  5LKU A;  5I3L A;  3SHB A;  4MVT A;  2LGG A;  4W4U A;  1LDK C;  2L75 A;  2LQ6 A;  2CKL A;  5LCW B;  5FB1 A;  4TKP B;  2YSM A;  3M62 A;  2H0D B;  4YAT A;  2M1R A;  1WEW A;  2LN0 A;  1IYM A;  1BOR A;  1MM2 A;  5LKZ A;  2M6M A;  2K17 A;  1N87 A;  1WES A;  2XEU A;  3M99 A;  4Q6F A;  3RPG C;  2Y1M A;  2EOD A;  3L1Z B;  4B86 C;  2G43 A;  2ECN A;  2KU3 A;  5B8D A;  4FK5 A;  4BHW A;  1WEP A;  2KWJ A;  2ZET C;  4XI1 A;  2K4D A;  3MHH A;  5TAB A;  4WZ2 A;  3KQI A;  4YBS A;  2YT5 A;  2LGL A;  2PUY A;  4PTB A;  5G0F A;  2CSZ A;  3PUR A;  2C2L A;  5DKA A;  4QF2 A;  4BBQ A;  1JM7 A;  1G25 A;  2XB1 A;  4AYC A;  4N4F A;  3LQH A;  4I7B A;  3N9N A;  3N9Q A;  1RMD A;  2YYR A;  1F62 A;  2ECI A;  4YAD A;  5TDW A;  2FSA A;  2FUI A;  2YSJ A;  2NAA A;  3RPG B;  2VJF B;  3FL2 A;  1U6G B;  3SOW A;  4V3K C;  1X4I A;  4I7C A;  2CSY A;  2G6Q A;  3ZPV 1;  2KGG A;  2VPG A;  3N9P A;  4N3W A;  2PNX A;  4GNG A;  4AUQ B;  4QF3 A;  2VJF A;  3U5O A;  3U5N A;  1WEO A;  2UZG A;  2QIZ A;  1X4U A;  2BAY A;  2MUM A;  2VNF A;  2YUR A;  3N9L A;  2VP7 A;  4YC9 A;  4A4C A;  4YBT A;  4S3O C;  3ZYQ A;  3EB5 A;  3O70 A;  2DX8 A;  2YRE A;  2I50 A;  2MT5 A;  3N9O A;  2VPD A;  1T1H A;  4C9Z A;  5FER A;  2LXH C;  3N9M A;  1WEN A;  2L0B A;  1XWH A;  1Z2Q A;  3U5P A;  1WEE A;  3DPL R;  3KNV A;  3GL6 A;  3O7A A;  1JM7 B;  4I7D A;  2LDR A;  2YUC A;  4V3L C;  1DVP A;  5G05 B;  1MM3 A;  4X3G A;  4IC2 A;  1X4J A;  1V87 A;  5KH9 A;  4UI9 B;  5FEY A;  4NN2 A;  3LQJ A;  4F52 B;  2MNY A;  2Y43 A;  3M63 A;  5B77 A;  5C11 A;  4R7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...