5FB0A

Crystal structure of a phd finger bound to histone h3 t3ph peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
183
structure length
172
Chain Sequence
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERSGHQESEVLMRQMQPEEQLKCEFLLLKVYCDSKSSFFASEPYYGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/structural protein
molecule keywords Nuclear autoantigen Sp-100
total genus 59
structure length 172
sequence length 183
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb0A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb0A01
4NYXA 2ECWA 3ZYUA 3Q2FA 5AMFA 3UV5A 5AMEA 4UYFA 5D0CA 5G4RA 3ZVYA 4AYCB 4A4CA 2N9GA 5FFWA 1K2FA 5E9VA 5TB6A 4AUQB 2OUOA 5BT4A 2LGLA 2VPGA 5D3JA 5CQ8A 1WIMA 2G4AA 3L1XA 3P1EA 4MR3A 5ENCA 2MNZA 4UYFB 2VPDA 5TABA 1HYIA 5F25A 3T7LA 4TYLA 1WEMA 2M6MA 5CQ5A 2F42A 3L1ZB 5B79A 3SHBA 2C2VS 1V87A 2YU4A 4YK0A 4CUTA 2K4DA 3UVYA 5FB1A 5D3HA 4CA1A 5EWVA 4YH4A 1WEOA 2M3HA 3ZPV1 4QSTA 2EA6A 2HDPA 4BJXA 5ENEA 4N4FA 4QSQA 3D7CA 4A9LA 3DAIA 4WZ3B 5LKUA 5I89A 3ZNIA 2RFJA 3G0JA 1WEQA 4N4HA 2YSMA 2NAAA 2ZETC 3M62A 2YT5A 4CUPA 4FIPA 5FE7A 2CSYA 5II1A 5EP7A 3UV4A 5DKHA 3P1FA 4QYDA 4PCIA 5J3XA 1G25A 4Y03A 3P5OA 2YHOA 4O64A 3IU5A 4S3OB 3HTKC 5EGUA 5L99A 5DKAA 4A9OA 2G6QA 4P5OB 5LKTA 3QZTA 4HXNA 5KH7A 2YQMA 3C5KA 5E9LA 3RPGC 5CQ4A 4QSWA 2LSPB 2H60A 5DYXA 4LR6A 2JMJA 2WP2A 5FE9A 5FH7A 4NUCA 2FUIA 4I7BA 1N72A 4NR9A 4TU6A 4QSRA 3O35A 5FH8A 5FG5A 2CSZA 4NQMA 3GL6A 1BORA 2YDWA 2UZGA 4MEPA 4XY8A 4HBWA 4UITA 3HMHA 2KU3A 4IR3A 4NRCA 2H0DA 4NS5A 1E4UA 5TRBA 2KWKA 4NUDA 2LGKA 4KCXA 4KV1A 5FE3A 5LJ2A 4MVTA 3O34A 4E96A 4YYIA 2ECVA 2PUYA 5C7NA 3PHDA 4UYHA 4V3LC 5EWWA 2HYED 4PPEA 4QZSA 4NXJA 4I7CA 5F5ZA 2YW5A 5EVAA 4ZW1A 1JSPB 5EISA 4UP5A 4YBMA 1X4UA 5H85A 2CT2A 5I83A 3SVFA 5J0DA 5JWMA 4WA6A 4O77A 5DLZA 2RS9B 5CFWA 5KTXA 3ZTGA 5L96A 1FBVA 4QEUA 1E6IA 4L7XA 4F3IA 4OUFA 4NR7A 3SVHA 4XUAA 2L85A 4O78A 4MR4A 4CL9A 3NXBA 5DY7A 5EA1A 2YREA 2RNWA 1CHCA 2YURA 5I88A 3SOWA 5CUGA 5FE6A 2DATA 5D3LA 4UIYA 5HQ6A 5FG4A 4IOQA 4FK5A 5CZGA 4UIUA 3MQMA 5B8DA 3U5NA 5HFRA 2K1JA 4PS5A 3M63A 4J3IA 3LRQA 5I7YA 4Z6IA 4XUBA 5C11A 5KH9A 4GNFA 4AVXA 5FERA 2PNXA 5I86A 2XEUA 1WUGA 3PUQA 5TBNA 4BW3A 4ZDTA 4BW4A 5BT3A 1N87A 4HXSA 2LRIC 4A0CD 4FO9A 4WZ0A 5FG6A 2I7KA 2MT5A 3LQJA 4QC1A 4QUUA 5CQTA 3NG2A 2RSDA 2L43A 4FJCA 4CURA 3V43A 5LVQA 5C8GA 2MA6A 4O7CA 3MB4A 1VFYA 5K29A 3U5LA 5HCLA 1LDJB 4FLPA 1IYMA 5LKZA 4J1PA 5FDZA 4LLBA 2DKWA 4WHUA 5A83A 5FE0A 1X4JA 2LXPC 3QZVA 3VK6A 4QC3A 5D7XA 3U5JA 3C6WA 5HFQA 5EM3A 5HRWA 5CUBA 3JVLA 1EQFA 1Z60A 5FFVA 4IR5A 4LZRA 4YYKA 5CUCA 3FKMX 3HMEA 4A9FA 4LADB 5FE2A 2DX8A 5L97A 5EPBA 2DVQA 5I7XA 2YQDA 5A5NA 4UIXA 2KE1A 2QIZA 5CUDA 3Q2EA 5A82A 4Q0OA 5F3AA 2M85A 3JVJA 1WILA 2YEMA 4O74A 2H0DB 2XB1A 2JRJA 4LYSA 1JOCA 5D3RA 4HBVA 5I3LA 4QR4A 1WEVA 5CRZA 4MEOA 4IR6A 5CU8A 5LJ1A 1WE9A 3HCUA 5B76A 4ZUXU 5H1TA 5H1VA 4MENA 4NYVA 4NRAA 3U5PA 3G0LA 4UP0A 4UYDA 3LQHA 4LDFA 5E7DA 4C66A 4A9JA 4IR4A 2KWOA 3N9NA 5LCWB 5E9IA 4ALGA 3ZYQA 2KWJA 4GNGA 4O7AA 4Z93A 5TCMA 5A81A 5A5RA 5CGPA 5EQ1A 4S3OC 4YBTA 5FB0A 5HELA 5B75A 2L0BA 5I40A 3ONIA 5CY9A 5E74A 4IOOA 1WEPA 5E0RA 5F63A 2VPEA 5I80A 4A4BA 5E3DA 2G45A 4YYGA 5LVRA 4N4IA 4O7FA 5A85A 5I29A 4HXPA 5DYCA 5EICA 5IGKA 4QSXA 4QBMA 2VJEA 2ECGA 1XWHA 1LDKC 2YYRA 2MIQA 3LXJA 5IGMA 4YC9A 3O36A 2L80A 4YY4A 3UV2A 4A9IA 5L8UA 5CQ6A 2R10A 2OO1A 2DWWA 2R0YA 4QB3A 5A5SA 5F60A 2RNYA 4RVRA 5IGNA 2C2LA 5FBXA 3UW9A 4NQNA 4ZQLA 4NN2A 4R8PK 4PKLA 4R7EA 5ACYA 2MD7B 3ZVZB 4J0RA 4IC3A 3S91A 2YQLA 4N3WA 2D8SA 5F36A 4QNSA 4AKNA 3QZSA 2FSAA 4X3GA 3MUKA 2VNFA 4CFLA 1WEWA 3U5MA 2R0SA 1DVPA 5G05B 5ETBA 3UVXA 5H9MA 4A9EA 4YYDA 4GPJA 3T6RA 4TS8A 5D24A 5HENA 3MB3A 4O75A 2CKLA 2MNYA 4QR5A 5KHMA 2KTBB 4GB0A 4Z1SA 1WEUA 5A7CA 4LYIA 3IU6A 4UIVA 5ENHA 1WEEA 3LQIA 1WESA 4OGIA 4PCEA 2RNXA 5L8TA 5C13A 3MXFA 3KV6A 2NXBA 5II2A 4C67A 2K16A 3N9MA 5FEYA 4GNDA 4O71A 4O76A 5HEMA 4TQNA 4NR6A 5EPSA 1VD4A 3UVWA 4PTBA 4A9HA 2AN6A 5CUAA 5TDRA 3O70A 5ETDA 5FE5A 3RCWA 2YHNA 4MEQA 2QICA 2LQ6A 1MM3A 2LXHC 5EU1A 2D9EA 4O72A 5DFDA 4LK9A 5E9MA 4A9NA 5EPRA 1ZBDB 2L5UA 3L11A 4TKPB 3GV4A 5L98A 4J0SA 1WGMA 5KTWA 5HRXA 5DLXA 5A5QA 2ECIA 3KV5A 4O70A 2BAYA 5AIUA 5AITA 4YATA 4QY4A 5IBNA 3AQAA 4QF2A 5HQ5A 4QF3A 2L75A 4YYJA 5DKDA 4LKAA 4XY9A 2YUCA 2D82A 5EWDA 4QEVA 5F1HA 4UYEA 3PURA 5KTUA 4HXOA 4LZSA 3U5KA 2I8NA 4QSUA 5EYAF 4BBQA 2IDAA 2MD8C 5TDWA 4ZC9A 2KGIA 2L84A 4X2IA 1WUMA 4CFKA 4HXKA 4YABA 4NRBA 3O33A 4O7EA 5DBMA 1F62A 4TT4A 1F68A 3S92A 5G04B 5C4QA 4YBSA 5KO4A 2VJEB 3HCSA 5LJ0A 2E6SA 3MHHA 4L58A 2KFTA 5DFCA 5KH3A 4B86C 5FFYA 4QUTA 2DVRA 1HYJA 5ENJA 5JI8A 5AD3A 3ZPVE 4NR4A 4TT2A 5LKXA 4F52B 4I7DA 3EB5A 3UVDA 4UYGA 3ASLA 5E73A 3P1CA 5CS8A 2E7NA 3FL2A 4CUUA 2E7OA 5DFBA 3SOUA 1JM4B 4MR6A 5CPEA 3LJWA 3M99A 2F6NA 5E3GA 2LN0A 4NYWA 4QEWA 5D3PA 5F61A 2YYNA 5G4SA 1JM7B 5EI4A 2ECJA 4DONA 1FP0A 2Y43A 4QYLA 5DYUA 5H1UA 4W4UA 5B78A 4YADA 4Q0NA 4YYHA 3P1DA 3N9PA 4GNEA 4WIVA 5IG6A 4WHWA 5CQ3A 5EWCA 4ALHA 4HBYA 2CKLB 4CLBA 2WP1A 1JM7A 4TZ2A 5HQ7A 3GG3A 5HLSA 5IGLA 5CQ7A 2MA5A 5DYAA 4YAXA 5FH6A 3N9QA 4BHWA 3DPLR 4LC2A 4YYNA 1X4IA 4NR5A 3SOXA 2G43A 4Z6HA 2EGPA 2KWNA 5D3TA 4BW2A 5CUEA 5COIA 3MHSA 5EV9A 5FE1A 2MJVB 2FUUA 2Y1MA 1T1HA 2LGVA 3RPGB 4UIWA 5FE4A 3I2DA 4A9KA 5DINA 4UI9B 5JG6A 4HXLA 2LV9A 4TU4A 5C85A 1ZS5A 5AD2A 5D25A 2DVVA 2F6JA 4LYWA 5I1QA 5E9KA 2Y1NA 4AP4A 2KYUA 2YEKA 5F2PA 4C9ZA 4LZ2A 1U6GB 4IORA 4QSVA 5CP5A 3U5OA 4QR3A 5C87A 5IIDA 1WFKA 2KREA 2VPBA 5D1KB 5E9YA 3JVMA 5DW2A 4QSPA 2K17A 2MUMA 4O7BA 2I50A 4CUQA 3DQVR 5DW1A 2YW8A 5G0FA 3O7AA 1RMDA 4R2YA 3RTRB 4HXRA 2L5EA 3SVGA 3HMFA 2JMIA 4A9MA 3N9OA 3TLPA 4UIZA 5ENFA 4B7YC 3EB6A 4BW1A 5ENIA 4WZ2A 4TZ8A 4A49A 4Z1QA 4MSXA 4TTEA 5F1LA 5HRVA 2GRCA 4TT6A 5FE8A 2OXQC 4YYMA 5CRMA 3AADA 5BT5A 3IHPA 2YELA 4N4GA 2ECTA 2KGGA 5KU3A 3N9LA 5D1LB 4YY6A 1WENA 5A5PA 2ECNA 1Z2QA 2VP7A 1X0JA 4OGJA 5C89A 4CUSA 5A5OA 2JMDA 2R0VA 2VJFA 5HJCA 4Q6FA 2E3KA 2KIZA 5B77A 4LRGA 3O37A 2LDRA 2QJ0A 2M1RA 5ENGA 2RO1A 3I3JA 5LUUA 1MM2A 5HM0A 2E6RA 4CCGX 2YSJA 4NUEA 3KNVA 2DVSA 5D3SA 4XI1A 2RI7A 5D3NA 5F62A 1Z6UA 2OSSA 2VJFB 4PY6A 5CTLA 4KV4A 1VYXA 5CQAA 3JVKA 3K2JA 5ENBA 4MR5A 3KQIA 4IC2A 5EWHA 4LJNA 4XYAA 5D1MB 4HXMA 4QSSA 5EK9A 4YH3A 4AYCA 5DKCA 3MULA 4V3KC 5D26A 4HBXA 2EODA 2LGGA 3DWYA 2KR4A 3HCTA 5DX4A 4NR8A
chains in the Genus database with same CATH superfamily
4NYXA 2ECWA 3ZYUA 3Q2FA 5AMFA 3UV5A 2KKYA 5AMEA 4UYFA 5D0CA 5G4RA 3ZVYA 4AYCB 4A4CA 2N9GA 5FFWA 1K2FA 5E9VA 5TB6A 4AUQB 2OUOA 5BT4A 2LGLA 2VPGA 5D3JA 4AKIA 1MBMA 5CQ8A 1WIMA 2G4AA 3L1XA 3P1EA 4MR3A 5ENCA 2MNZA 4UYFB 2VPDA 5TABA 1HYIA 5F25A 3T7LA 4TYLA 1WEMA 2M6MA 5CQ5A 2F42A 3L1ZB 5B79A 3SHBA 2C2VS 1V87A 2YU4A 4YK0A 5SVIA 4CUTA 2K4DA 3UVYA 5FB1A 5D3HA 4CA1A 5EWVA 4YH4A 2CRRA 1WEOA 2M3HA 3ZPV1 4QSTA 2EA6A 2HDPA 4BJXA 5ENEA 4N4FA 4QSQA 2MKEA 3D7CA 4OGCA 4A9LA 3DAIA 3DWDA 5SVIB 4WZ3B 2JUNA 5LKUA 5I89A 3ZNIA 2RFJA 3G0JA 1WEQA 4N4HA 2YSMA 2NAAA 2ZETC 3M62A 2YT5A 2B0OE 2M13A 4CUPA 4FIPA 5FE7A 2CSYA 5II1A 5EP7A 3UV4A 5DKHA 3P1FA 4QYDA 4PCIA 5J3XA 1G25A 5SVXA 4Y03A 3P5OA 2YHOA 4O64A 3IU5A 4S3OB 3HTKC 5EGUA 5L99A 5DKAA 4A9OA 2G6QA 4P5OB 5LKTA 3QZTA 4HXNA 5KH7A 2YQMA 3C5KA 5E9LA 3RPGC 5CQ4A 4QSWA 3FAOA 2LSPB 2H60A 5DYXA 4LR6A 2JMJA 2WP2A 5FE9A 5FH7A 4NUCA 2FUIA 4I7BA 1N72A 3Q1DA 4NR9A 4TU6A 4QSRA 3O35A 5FH8A 5FG5A 2CSZA 4NQMA 3GL6A 1BORA 2YDWA 4OGEA 2UZGA 4MEPA 4XY8A 1ZKRA 4HBWA 4UITA 3HMHA 2KU3A 4IR3A 4NRCA 2H0DA 4NS5A 1E4UA 5TRBA 2KWKA 4NUDA 2LGKA 4KCXA 4KV1A 5FE3A 5LJ2A 4MVTA 3O34A 4E96A 4YYIA 2ECVA 2PUYA 5C7NA 3PHDA 4UYHA 4V3LC 5EWWA 2HYED 4PPEA 3DDTA 4QZSA 4NXJA 4I7CA 5F5ZA 2YW5A 5EVAA 4ZW1A 1JSPB 5EISA 4UP5A 4YBMA 1X4UA 5H85A 2CT2A 5I83A 3SVFA 5J0DA 5JWMA 4WA6A 4O77A 5DLZA 2RS9B 5CFWA 5KTXA 3D1DA 5L96A 1FBVA 3ZTGA 2KKXA 4QEUA 1E6IA 4L7XA 4F3IA 4OUFA 4NR7A 3SVHA 2FD4A 4XUAA 2L85A 4O78A 4MR4A 4CL9A 3NXBA 5DY7A 5EA1A 2YREA 2RNWA 1CHCA 2YURA 5I88A 3SOWA 5CUGA 5FE6A 2DATA 5D3LA 4UIYA 5HQ6A 3LVQE 5FG4A 4IOQA 4FK5A 5CZGA 4UIUA 3MQMA 5B8DA 3U5NA 5HFRA 2K1JA 4PS5A 2EJNA 3M63A 4J3IA 3LRQA 2IQJA 5I7YA 4Z6IA 3FEHA 4XUBA 5C11A 5KH9A 4GNFA 4AVXA 5FERA 2PNXA 5K3QA 5I86A 4AKHA 2XEUA 1WUGA 3PUQA 5TBNA 4BW3A 4ZDTA 4BW4A 5BT3A 1N87A 4HXSA 2LRIC 4A0CD 4FO9A 4WZ0A 5FG6A 2I7KA 2MT5A 3LQJA 4QC1A 4QUUA 5CQTA 2XOYA 2RSDA 2L43A 3NG2A 4CURA 3V43A 5LVQA 5C8GA 2MA6A 4O7CA 3MB4A 1VFYA 5K29A 3U5LA 5HCLA 1LDJB 4FLPA 1IYMA 5LKZA 4J1PA 5FDZA 4LLBA 2DKWA 4WHUA 5A83A 5FE0A 1X4JA 2LXPC 3QZVA 3VK6A 4QC3A 5D7XA 3U5JA 3C6WA 5HFQA 5EM3A 4Z0RA 5HRWA 5CUBA 3JVLA 1EQFA 1Z60A 5FFVA 5SVYA 4IR5A 4LZRA 4YYKA 5CUCA 3FKMX 3HMEA 4A9FA 4LADB 5FE2A 2DX8A 5L97A 5EPBA 2DVQA 5I7XA 2YQDA 5A5NA 4UIXA 2KE1A 2QIZA 5CUDA 3Q2EA 5A82A 4Q0OA 5F3AA 2M85A 3JVJA 1WILA 2YEMA 3VKHA 4O74A 2H0DB 2XB1A 2JRJA 4LYSA 1JOCA 5D3RA 4HBVA 5I3LA 4QR4A 1WEVA 5CRZA 4MEOA 4IR6A 5CU8A 5LJ1A 1WE9A 2CSVA 3HCUA 5B76A 4ZUXU 5H1TA 5H1VA 4MENA 4NYVA 4NRAA 3U5PA 3G0LA 2JM3A 4UYDA 3LQHA 4LDFA 5E7DA 4UP0A 4C66A 4AI6A 4A9JA 4IR4A 2KWOA 3N9NA 5LCWB 5E9IA 4ALGA 3ZYQA 2KWJA 4GNGA 4O7AA 4Z93A 5TCMA 5A81A 5A5RA 5CGPA 5EQ1A 4S3OC 4YBTA 5FB0A 5HELA 5B75A 2L0BA 5I40A 3ONIA 5CY9A 5E74A 4IOOA 1WEPA 5E0RA 5F63A 2VPEA 5I80A 4A4BA 5E3DA 2G45A 4YYGA 5LVRA 4H9DA 4Z0OA 4N4IA 4O7FA 5A85A 5I29A 4QQ4A 4HXPA 5DYCA 5EICA 5IGKA 4QSXA 4QBMA 2VJEA 2E61A 2ECGA 1XWHA 1LDKC 2YYRA 2MIQA 3LXJA 5IGMA 4YC9A 3O36A 2L80A 4YY4A 3UV2A 4A9IA 5L8UA 5CQ6A 2R10A 2OO1A 2DWWA 2R0YA 4QB3A 4AKGA 5A5SA 5F60A 2RNYA 4RVRA 5IGNA 3VKGA 2C2LA 5FBXA 3UW9A 4NQNA 4ZQLA 3PLWA 2LAUA 4NN2A 4R8PK 4PKLA 4R7EA 5ACYA 2MD7B 3ZVZB 3D1BA 4J0RA 4IC3A 3S91A 2FFWA 4N3WA 2D8SA 5F36A 2YQLA 4QNSA 4AKNA 3QZSA 2FSAA 3FJUB 4X3GA 3MUKA 3T9KA 2VNFA 4CFLA 1WEWA 3U5MA 2R0SA 1DVPA 5G05B 2DSMA 5ETBA 3UVXA 5H9MA 4A9EA 4YYDA 4GPJA 3T6RA 3MDBC 4TS8A 5D24A 5HENA 3MB3A 4O75A 2CKLA 2MNYA 4QR5A 2CRWA 5KHMA 2KTBB 4GB0A 4Z1SA 1WEUA 5A7CA 4LYIA 3IU6A 4UIVA 5ENHA 1WEEA 3LQIA 1WESA 4OGIA 4PCEA 2RNXA 5L8TA 4O62A 5C13A 3MXFA 3KV6A 2NXBA 5II2A 4C67A 2K16A 3N9MA 5FEYA 4GNDA 4O71A 4O76A 5HEMA 4TQNA 4NR6A 5EPSA 1VD4A 3UVWA 4PTBA 4A9HA 2AN6A 5CUAA 3LJUX 5TDRA 3O70A 5ETDA 5FE5A 3RCWA 2YHNA 4MEQA 2QICA 2LQ6A 1MM3A 2CONA 5EU1A 2LXHC 2D9EA 4O72A 5DFDA 3JUEA 4LK9A 5E9MA 4A9NA 5EPRA 1ZBDB 2L5UA 3L11A 4TKPB 2L7PA 3GV4A 5L98A 4J0SA 1WGMA 5KTWA 5HRXA 5DLXA 5A5QA 2ECIA 2YVRA 4O70A 2BAYA 3KV5A 5AIUA 5AITA 4YATA 4QY4A 5IBNA 3AQAA 4QF2A 5HQ5A 4QF3A 2L75A 4YYJA 5DKDA 4LKAA 4XY9A 2YUCA 2D82A 5EWDA 4QEVA 5F1HA 4UYEA 1DCQA 5KTUA 4HXOA 4LZSA 3U5KA 1PUOA 2I8NA 4QSUA 3PURA 2IDAA 5EYAF 2MD8C 4BBQA 5TDWA 4ZC9A 2KGIA 2L84A 4X2IA 1WUMA 4CFKA 4HXKA 4YABA 4NRBA 3O33A 4O7EA 5DBMA 1F62A 4TT4A 1F68A 3LVRE 3S92A 5G04B 5C4QA 4YBSA 5KO4A 2VJEB 3HCSA 5LJ0A 2E6SA 3MHHA 4L58A 2KFTA 5DFCA 5KH3A 4B86C 5FFYA 4QUTA 2DVRA 1HYJA 5ENJA 5JI8A 5AD3A 3ZPVE 4NR4A 4TT2A 5LKXA 4F52B 4I7DA 3EB5A 3UVDA 4UYGA 3ASLA 5E73A 3P1CA 5CS8A 2EXUA 2E7NA 2DJAA 3FL2A 4CUUA 2E7OA 5DFBA 3SOUA 1JM4B 4MR6A 5CPEA 3LJWA 3M99A 2F6NA 5E3GA 2LN0A 4NYWA 4QEWA 5D3PA 5F61A 2YYNA 5G4SA 3KDEC 1JM7B 5EI4A 2ECJA 4DONA 1FP0A 2Y43A 4QYLA 5DYUA 5H1UA 4W4UA 2P57A 5B78A 4YADA 4Q0NA 4YYHA 3P1DA 3N9PA 4GNEA 4WIVA 2XP0A 5IG6A 4WHWA 5CQ3A 5EWCA 4ALHA 4HBYA 2CKLB 4CLBA 2WP1A 1JM7A 4TZ2A 5HQ7A 3GG3A 5HLSA 3FANA 5IGLA 5CQ7A 3O47A 2MA5A 5DYAA 4YAXA 5FH6A 3N9QA 4BHWA 3DPLR 4LC2A 4YYNA 1X4IA 4NR5A 3SOXA 2G43A 4Z6HA 2EGPA 2KWNA 5D3TA 4BW2A 5CUEA 5COIA 3MHSA 5EV9A 5FE1A 2MJVB 2FUUA 2Y1MA 1T1HA 2LGVA 3RPGB 4UIWA 5FE4A 3I2DA 2RR4A 4A9KA 5DINA 4UI9B 5JG6A 4HXLA 2LV9A 4TU4A 5C85A 1ZS5A 5AD2A 5D25A 2DVVA 2F6JA 4LYWA 5I1QA 5E9KA 2Y1NA 4AP4A 2KYUA 2YEKA 5F2PA 4C9ZA 4LZ2A 1U6GB 4IORA 4QSVA 5CP5A 3U5OA 4QR3A 5C87A 5IIDA 1WFKA 2KREA 2VPBA 5D1KB 5E9YA 3JVMA 5DW2A 4QSPA 2K17A 2MUMA 4O7BA 2I50A 4CUQA 2D8UA 5DW1A 2YW8A 3DQVR 5G0FA 3O7AA 1RMDA 4R2YA 3RTRB 4HXRA 2L5EA 3SVGA 3HMFA 2JMIA 4F1PA 4A9MA 3N9OA 2EGMA 3TLPA 4UIZA 5ENFA 4B7YC 3EB6A 4BW1A 5ENIA 4WZ2A 4TZ8A 4A49A 4Z1QA 4MSXA 4TTEA 5F1LA 4FJCA 5HRVA 2GRCA 4TT6A 5FE8A 2OXQC 3SUBA 4YYMA 5CRMA 3AADA 5BT5A 3IHPA 2YELA 4N4GA 2ECTA 2KGGA 5KU3A 3N9LA 5D1LB 4YY6A 1WENA 5A5PA 2ECNA 1Z2QA 2VP7A 1X0JA 4OGJA 5C89A 3FM8C 4CUSA 5A5OA 2JMDA 2R0VA 2VJFA 5HJCA 4Q6FA 2E3KA 3LDYA 2KIZA 2XOZA 5B77A 4LRGA 3O37A 2LDRA 2QJ0A 3H7HA 3ERRA 2M1RA 3E2DA 5ENGA 2RO1A 3I3JA 5LUUA 1MM2A 5HM0A 2E6RA 4CCGX 2YSJA 4NUEA 3KNVA 2DVSA 5D3SA 4XI1A 2RI7A 5D3NA 5F62A 1Z6UA 2OSSA 2VJFB 4PY6A 5CTLA 2OWAA 3M7KA 4KV4A 1VYXA 5CQAA 3JVKA 3K2JA 5ENBA 4MR5A 3KQIA 4IC2A 5EWHA 4LJNA 4XYAA 5D1MB 4HXMA 4QSSA 5EK9A 4YH3A 4AYCA 5DKCA 3MULA 4V3KC 5D26A 4HBXA 2EODA 2LGGA 3DWYA 2XOCA 2KR4A 3HCTA 5DX4A 4NR8A
chains in the Genus database with same CATH topology
4NYXA 2ECWA 3ZYUA 3Q2FA 5AMFA 3UV5A 5AMEA 4UYFA 5D0CA 5G4RA 3ZVYA 4AYCB 4A4CA 2N9GA 5FFWA 1K2FA 5E9VA 5TB6A 4AUQB 2OUOA 5BT4A 2LGLA 2VPGA 5D3JA 5CQ8A 1WIMA 2G4AA 3L1XA 3P1EA 4MR3A 5ENCA 2MNZA 4UYFB 2VPDA 5TABA 1HYIA 5F25A 3T7LA 4TYLA 1WEMA 2M6MA 5CQ5A 2F42A 3L1ZB 5B79A 3SHBA 2C2VS 1V87A 2YU4A 4YK0A 4CUTA 2K4DA 3UVYA 5FB1A 5D3HA 4CA1A 5EWVA 4YH4A 1WEOA 2M3HA 3ZPV1 4QSTA 2EA6A 2HDPA 4BJXA 5ENEA 4N4FA 4QSQA 3D7CA 4A9LA 3DAIA 4WZ3B 5LKUA 5I89A 3ZNIA 2RFJA 3G0JA 1WEQA 4N4HA 2YSMA 2NAAA 2ZETC 3M62A 2YT5A 4CUPA 4FIPA 5FE7A 2CSYA 5II1A 5EP7A 3UV4A 5DKHA 3P1FA 4QYDA 4PCIA 5J3XA 1G25A 4Y03A 3P5OA 2YHOA 4O64A 3IU5A 4S3OB 3HTKC 5EGUA 5L99A 5DKAA 4A9OA 2G6QA 4P5OB 5LKTA 3QZTA 4HXNA 5KH7A 2YQMA 3C5KA 5E9LA 3RPGC 5CQ4A 4QSWA 2LSPB 2H60A 5DYXA 4LR6A 2JMJA 2WP2A 5FE9A 5FH7A 4NUCA 2FUIA 4I7BA 1N72A 4NR9A 4TU6A 4QSRA 3O35A 5FH8A 5FG5A 2CSZA 4NQMA 3GL6A 1BORA 2YDWA 2UZGA 4MEPA 4XY8A 4HBWA 4UITA 3HMHA 2KU3A 4IR3A 4NRCA 2H0DA 4NS5A 1E4UA 5TRBA 2KWKA 4NUDA 2LGKA 4KCXA 4KV1A 5FE3A 5LJ2A 4MVTA 3O34A 4E96A 4YYIA 2ECVA 2PUYA 5C7NA 3PHDA 4UYHA 4V3LC 5EWWA 2HYED 4PPEA 4QZSA 4NXJA 4I7CA 5F5ZA 2YW5A 5EVAA 4ZW1A 1JSPB 5EISA 4UP5A 4YBMA 1X4UA 5H85A 2CT2A 5I83A 3SVFA 5J0DA 5JWMA 4WA6A 4O77A 5DLZA 2RS9B 5CFWA 5KTXA 3ZTGA 5L96A 1FBVA 4QEUA 1E6IA 4L7XA 4F3IA 4OUFA 4NR7A 3SVHA 4XUAA 2L85A 4O78A 4MR4A 4CL9A 3NXBA 5DY7A 5EA1A 2YREA 2RNWA 1CHCA 2YURA 5I88A 3SOWA 5CUGA 5FE6A 2DATA 5D3LA 4UIYA 5HQ6A 5FG4A 4IOQA 4FK5A 5CZGA 4UIUA 3MQMA 5B8DA 3U5NA 5HFRA 2K1JA 4PS5A 3M63A 4J3IA 3LRQA 5I7YA 4Z6IA 4XUBA 5C11A 5KH9A 4GNFA 4AVXA 5FERA 2PNXA 5I86A 2XEUA 1WUGA 3PUQA 5TBNA 4BW3A 4ZDTA 4BW4A 5BT3A 1N87A 4HXSA 2LRIC 4A0CD 4FO9A 4WZ0A 5FG6A 2I7KA 2MT5A 3LQJA 4QC1A 4QUUA 5CQTA 3NG2A 2RSDA 2L43A 4FJCA 4CURA 3V43A 5LVQA 5C8GA 2MA6A 4O7CA 3MB4A 1VFYA 5K29A 3U5LA 5HCLA 1LDJB 4FLPA 1IYMA 5LKZA 4J1PA 5FDZA 4LLBA 2DKWA 4WHUA 5A83A 5FE0A 1X4JA 2LXPC 3QZVA 3VK6A 4QC3A 5D7XA 3U5JA 3C6WA 5HFQA 5EM3A 5HRWA 5CUBA 3JVLA 1EQFA 1Z60A 5FFVA 4IR5A 4LZRA 4YYKA 5CUCA 3FKMX 3HMEA 4A9FA 4LADB 5FE2A 2DX8A 5L97A 5EPBA 2DVQA 5I7XA 2YQDA 5A5NA 4UIXA 2KE1A 2QIZA 5CUDA 3Q2EA 5A82A 4Q0OA 5F3AA 2M85A 3JVJA 1WILA 2YEMA 4O74A 2H0DB 2XB1A 2JRJA 4LYSA 1JOCA 5D3RA 4HBVA 5I3LA 4QR4A 1WEVA 5CRZA 4MEOA 4IR6A 5CU8A 5LJ1A 1WE9A 3HCUA 5B76A 4ZUXU 5H1TA 5H1VA 4MENA 4NYVA 4NRAA 3U5PA 3G0LA 4UP0A 4UYDA 3LQHA 4LDFA 5E7DA 4C66A 4A9JA 4IR4A 2KWOA 3N9NA 5LCWB 5E9IA 4ALGA 3ZYQA 2KWJA 4GNGA 4O7AA 4Z93A 5TCMA 5A81A 5A5RA 5CGPA 5EQ1A 4S3OC 4YBTA 5FB0A 5HELA 5B75A 2L0BA 5I40A 3ONIA 5CY9A 5E74A 4IOOA 1WEPA 5E0RA 5F63A 2VPEA 5I80A 4A4BA 5E3DA 2G45A 4YYGA 5LVRA 4N4IA 4O7FA 5A85A 5I29A 4HXPA 5DYCA 5EICA 5IGKA 4QSXA 4QBMA 2VJEA 2ECGA 1XWHA 1LDKC 2YYRA 2MIQA 3LXJA 5IGMA 4YC9A 3O36A 2L80A 4YY4A 3UV2A 4A9IA 5L8UA 5CQ6A 2R10A 2OO1A 2DWWA 2R0YA 4QB3A 5A5SA 5F60A 2RNYA 4RVRA 5IGNA 2C2LA 5FBXA 3UW9A 4NQNA 4ZQLA 4NN2A 4R8PK 4PKLA 4R7EA 5ACYA 2MD7B 3ZVZB 4J0RA 4IC3A 3S91A 2YQLA 4N3WA 2D8SA 5F36A 4QNSA 4AKNA 3QZSA 2FSAA 4X3GA 3MUKA 2VNFA 4CFLA 1WEWA 3U5MA 2R0SA 1DVPA 5G05B 5ETBA 3UVXA 5H9MA 4A9EA 4YYDA 4GPJA 3T6RA 4TS8A 5D24A 5HENA 3MB3A 4O75A 2CKLA 2MNYA 4QR5A 5KHMA 2KTBB 4GB0A 4Z1SA 1WEUA 5A7CA 4LYIA 3IU6A 4UIVA 5ENHA 1WEEA 3LQIA 1WESA 4OGIA 4PCEA 2RNXA 5L8TA 5C13A 3MXFA 3KV6A 2NXBA 5II2A 4C67A 2K16A 3N9MA 5FEYA 4GNDA 4O71A 4O76A 5HEMA 4TQNA 4NR6A 5EPSA 1VD4A 3UVWA 4PTBA 4A9HA 2AN6A 5CUAA 5TDRA 3O70A 5ETDA 5FE5A 3RCWA 2YHNA 4MEQA 2QICA 2LQ6A 1MM3A 2LXHC 5EU1A 2D9EA 4O72A 5DFDA 4LK9A 5E9MA 4A9NA 5EPRA 1ZBDB 2L5UA 3L11A 4TKPB 3GV4A 5L98A 4J0SA 1WGMA 5KTWA 5HRXA 5DLXA 5A5QA 2ECIA 3KV5A 4O70A 2BAYA 5AIUA 5AITA 4YATA 4QY4A 5IBNA 3AQAA 4QF2A 5HQ5A 4QF3A 2L75A 4YYJA 5DKDA 4LKAA 4XY9A 2YUCA 2D82A 5EWDA 4QEVA 5F1HA 4UYEA 3PURA 5KTUA 4HXOA 4LZSA 3U5KA 2I8NA 4QSUA 5EYAF 4BBQA 2IDAA 2MD8C 5TDWA 4ZC9A 2KGIA 2L84A 4X2IA 1WUMA 4CFKA 4HXKA 4YABA 4NRBA 3O33A 4O7EA 5DBMA 1F62A 4TT4A 1F68A 3S92A 5G04B 5C4QA 4YBSA 5KO4A 2VJEB 3HCSA 5LJ0A 2E6SA 3MHHA 4L58A 2KFTA 5DFCA 5KH3A 4B86C 5FFYA 4QUTA 2DVRA 1HYJA 5ENJA 5JI8A 5AD3A 3ZPVE 4NR4A 4TT2A 5LKXA 4F52B 4I7DA 3EB5A 3UVDA 4UYGA 3ASLA 5E73A 3P1CA 5CS8A 2E7NA 3FL2A 4CUUA 2E7OA 5DFBA 3SOUA 1JM4B 4MR6A 5CPEA 3LJWA 3M99A 2F6NA 5E3GA 2LN0A 4NYWA 4QEWA 5D3PA 5F61A 2YYNA 5G4SA 1JM7B 5EI4A 2ECJA 4DONA 1FP0A 2Y43A 4QYLA 5DYUA 5H1UA 4W4UA 5B78A 4YADA 4Q0NA 4YYHA 3P1DA 3N9PA 4GNEA 4WIVA 5IG6A 4WHWA 5CQ3A 5EWCA 4ALHA 4HBYA 2CKLB 4CLBA 2WP1A 1JM7A 4TZ2A 5HQ7A 3GG3A 5HLSA 5IGLA 5CQ7A 2MA5A 5DYAA 4YAXA 5FH6A 3N9QA 4BHWA 3DPLR 4LC2A 4YYNA 1X4IA 4NR5A 3SOXA 2G43A 4Z6HA 2EGPA 2KWNA 5D3TA 4BW2A 5CUEA 5COIA 3MHSA 5EV9A 5FE1A 2MJVB 2FUUA 2Y1MA 1T1HA 2LGVA 3RPGB 4UIWA 5FE4A 3I2DA 4A9KA 5DINA 4UI9B 5JG6A 4HXLA 2LV9A 4TU4A 5C85A 1ZS5A 5AD2A 5D25A 2DVVA 2F6JA 4LYWA 5I1QA 5E9KA 2Y1NA 4AP4A 2KYUA 2YEKA 5F2PA 4C9ZA 4LZ2A 1U6GB 4IORA 4QSVA 5CP5A 3U5OA 4QR3A 5C87A 5IIDA 1WFKA 2KREA 2VPBA 5D1KB 5E9YA 3JVMA 5DW2A 4QSPA 2K17A 2MUMA 4O7BA 2I50A 4CUQA 3DQVR 5DW1A 2YW8A 5G0FA 3O7AA 1RMDA 4R2YA 3RTRB 4HXRA 2L5EA 3SVGA 3HMFA 2JMIA 4A9MA 3N9OA 3TLPA 4UIZA 5ENFA 4B7YC 3EB6A 4BW1A 5ENIA 4WZ2A 4TZ8A 4A49A 4Z1QA 4MSXA 4TTEA 5F1LA 5HRVA 2GRCA 4TT6A 5FE8A 2OXQC 4YYMA 5CRMA 3AADA 5BT5A 3IHPA 2YELA 4N4GA 2ECTA 2KGGA 5KU3A 3N9LA 5D1LB 4YY6A 1WENA 5A5PA 2ECNA 1Z2QA 2VP7A 1X0JA 4OGJA 5C89A 4CUSA 5A5OA 2JMDA 2R0VA 2VJFA 5HJCA 4Q6FA 2E3KA 2KIZA 5B77A 4LRGA 3O37A 2LDRA 2QJ0A 2M1RA 5ENGA 2RO1A 3I3JA 5LUUA 1MM2A 5HM0A 2E6RA 4CCGX 2YSJA 4NUEA 3KNVA 2DVSA 5D3SA 4XI1A 2RI7A 5D3NA 5F62A 1Z6UA 2OSSA 2VJFB 4PY6A 5CTLA 4KV4A 1VYXA 5CQAA 3JVKA 3K2JA 5ENBA 4MR5A 3KQIA 4IC2A 5EWHA 4LJNA 4XYAA 5D1MB 4HXMA 4QSSA 5EK9A 4YH3A 4AYCA 5DKCA 3MULA 4V3KC 5D26A 4HBXA 2EODA 2LGGA 3DWYA 2KR4A 3HCTA 5DX4A 4NR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYX A;  2ECW A;  3ZYU A;  3Q2F A;  5AMF A;  3UV5 A;  5AME A;  4UYF A;  5D0C A;  5G4R A;  3ZVY A;  4AYC B;  4A4C A;  2N9G A;  5FFW A;  1K2F A;  5E9V A;  5TB6 A;  4AUQ B;  2OUO A;  5BT4 A;  2LGL A;  2VPG A;  5D3J A;  5CQ8 A;  1WIM A;  2G4A A;  3L1X A;  3P1E A;  4MR3 A;  5ENC A;  2MNZ A;  4UYF B;  2VPD A;  5TAB A;  1HYI A;  5F25 A;  3T7L A;  4TYL A;  1WEM A;  2M6M A;  5CQ5 A;  2F42 A;  3L1Z B;  5B79 A;  3SHB A;  2C2V S;  1V87 A;  2YU4 A;  4YK0 A;  4CUT A;  2K4D A;  3UVY A;  5FB1 A;  5D3H A;  4CA1 A;  5EWV A;  4YH4 A;  1WEO A;  2M3H A;  3ZPV 1;  4QST A;  2EA6 A;  2HDP A;  4BJX A;  5ENE A;  4N4F A;  4QSQ A;  3D7C A;  4A9L A;  3DAI A;  4WZ3 B;  5LKU A;  5I89 A;  3ZNI A;  2RFJ A;  3G0J A;  1WEQ A;  4N4H A;  2YSM A;  2NAA A;  2ZET C;  3M62 A;  2YT5 A;  4CUP A;  4FIP A;  5FE7 A;  2CSY A;  5II1 A;  5EP7 A;  3UV4 A;  5DKH A;  3P1F A;  4QYD A;  4PCI A;  5J3X A;  1G25 A;  4Y03 A;  3P5O A;  2YHO A;  4O64 A;  3IU5 A;  4S3O B;  3HTK C;  5EGU A;  5L99 A;  5DKA A;  4A9O A;  2G6Q A;  4P5O B;  5LKT A;  3QZT A;  4HXN A;  5KH7 A;  2YQM A;  3C5K A;  5E9L A;  3RPG C;  5CQ4 A;  4QSW A;  2LSP B;  2H60 A;  5DYX A;  4LR6 A;  2JMJ A;  2WP2 A;  5FE9 A;  5FH7 A;  4NUC A;  2FUI A;  4I7B A;  1N72 A;  4NR9 A;  4TU6 A;  4QSR A;  3O35 A;  5FH8 A;  5FG5 A;  2CSZ A;  4NQM A;  3GL6 A;  1BOR A;  2YDW A;  2UZG A;  4MEP A;  4XY8 A;  4HBW A;  4UIT A;  3HMH A;  2KU3 A;  4IR3 A;  4NRC A;  2H0D A;  4NS5 A;  1E4U A;  5TRB A;  2KWK A;  4NUD A;  2LGK A;  4KCX A;  4KV1 A;  5FE3 A;  5LJ2 A;  4MVT A;  3O34 A;  4E96 A;  4YYI A;  2ECV A;  2PUY A;  5C7N A;  3PHD A;  4UYH A;  4V3L C;  5EWW A;  2HYE D;  4PPE A;  4QZS A;  4NXJ A;  4I7C A;  5F5Z A;  2YW5 A;  5EVA A;  4ZW1 A;  1JSP B;  5EIS A;  4UP5 A;  4YBM A;  1X4U A;  5H85 A;  2CT2 A;  5I83 A;  3SVF A;  5J0D A;  5JWM A;  4WA6 A;  4O77 A;  5DLZ A;  2RS9 B;  5CFW A;  5KTX A;  3ZTG A;  5L96 A;  1FBV A;  4QEU A;  1E6I A;  4L7X A;  4F3I A;  4OUF A;  4NR7 A;  3SVH A;  4XUA A;  2L85 A;  4O78 A;  4MR4 A;  4CL9 A;  3NXB A;  5DY7 A;  5EA1 A;  2YRE A;  2RNW A;  1CHC A;  2YUR A;  5I88 A;  3SOW A;  5CUG A;  5FE6 A;  2DAT A;  5D3L A;  4UIY A;  5HQ6 A;  5FG4 A;  4IOQ A;  4FK5 A;  5CZG A;  4UIU A;  3MQM A;  5B8D A;  3U5N A;  5HFR A;  2K1J A;  4PS5 A;  3M63 A;  4J3I A;  3LRQ A;  5I7Y A;  4Z6I A;  4XUB A;  5C11 A;  5KH9 A;  4GNF A;  4AVX A;  5FER A;  2PNX A;  5I86 A;  2XEU A;  1WUG A;  3PUQ A;  5TBN A;  4BW3 A;  4ZDT A;  4BW4 A;  5BT3 A;  1N87 A;  4HXS A;  2LRI C;  4A0C D;  4FO9 A;  4WZ0 A;  5FG6 A;  2I7K A;  2MT5 A;  3LQJ A;  4QC1 A;  4QUU A;  5CQT A;  3NG2 A;  2RSD A;  2L43 A;  4FJC A;  4CUR A;  3V43 A;  5LVQ A;  5C8G A;  2MA6 A;  4O7C A;  3MB4 A;  1VFY A;  5K29 A;  3U5L A;  5HCL A;  1LDJ B;  4FLP A;  1IYM A;  5LKZ A;  4J1P A;  5FDZ A;  4LLB A;  2DKW A;  4WHU A;  5A83 A;  5FE0 A;  1X4J A;  2LXP C;  3QZV A;  3VK6 A;  4QC3 A;  5D7X A;  3U5J A;  3C6W A;  5HFQ A;  5EM3 A;  5HRW A;  5CUB A;  3JVL A;  1EQF A;  1Z60 A;  5FFV A;  4IR5 A;  4LZR A;  4YYK A;  5CUC A;  3FKM X;  3HME A;  4A9F A;  4LAD B;  5FE2 A;  2DX8 A;  5L97 A;  5EPB A;  2DVQ A;  5I7X A;  2YQD A;  5A5N A;  4UIX A;  2KE1 A;  2QIZ A;  5CUD A;  3Q2E A;  5A82 A;  4Q0O A;  5F3A A;  2M85 A;  3JVJ A;  1WIL A;  2YEM A;  4O74 A;  2H0D B;  2XB1 A;  2JRJ A;  4LYS A;  1JOC A;  5D3R A;  4HBV A;  5I3L A;  4QR4 A;  1WEV A;  5CRZ A;  4MEO A;  4IR6 A;  5CU8 A;  5LJ1 A;  1WE9 A;  3HCU A;  5B76 A;  4ZUX U;  5H1T A;  5H1V A;  4MEN A;  4NYV A;  4NRA A;  3U5P A;  3G0L A;  4UP0 A;  4UYD A;  3LQH A;  4LDF A;  5E7D A;  4C66 A;  4A9J A;  4IR4 A;  2KWO A;  3N9N A;  5LCW B;  5E9I A;  4ALG A;  3ZYQ A;  2KWJ A;  4GNG A;  4O7A A;  4Z93 A;  5TCM A;  5A81 A;  5A5R A;  5CGP A;  5EQ1 A;  4S3O C;  4YBT A;  5FB0 A;  5HEL A;  5B75 A;  2L0B A;  5I40 A;  3ONI A;  5CY9 A;  5E74 A;  4IOO A;  1WEP A;  5E0R A;  5F63 A;  2VPE A;  5I80 A;  4A4B A;  5E3D A;  2G45 A;  4YYG A;  5LVR A;  4N4I A;  4O7F A;  5A85 A;  5I29 A;  4HXP A;  5DYC A;  5EIC A;  5IGK A;  4QSX A;  4QBM A;  2VJE A;  2ECG A;  1XWH A;  1LDK C;  2YYR A;  2MIQ A;  3LXJ A;  5IGM A;  4YC9 A;  3O36 A;  2L80 A;  4YY4 A;  3UV2 A;  4A9I A;  5L8U A;  5CQ6 A;  2R10 A;  2OO1 A;  2DWW A;  2R0Y A;  4QB3 A;  5A5S A;  5F60 A;  2RNY A;  4RVR A;  5IGN A;  2C2L A;  5FBX A;  3UW9 A;  4NQN A;  4ZQL A;  4NN2 A;  4R8P K;  4PKL A;  4R7E A;  5ACY A;  2MD7 B;  3ZVZ B;  4J0R A;  4IC3 A;  3S91 A;  2YQL A;  4N3W A;  2D8S A;  5F36 A;  4QNS A;  4AKN A;  3QZS A;  2FSA A;  4X3G A;  3MUK A;  2VNF A;  4CFL A;  1WEW A;  3U5M A;  2R0S A;  1DVP A;  5G05 B;  5ETB A;  3UVX A;  5H9M A;  4A9E A;  4YYD A;  4GPJ A;  3T6R A;  4TS8 A;  5D24 A;  5HEN A;  3MB3 A;  4O75 A;  2CKL A;  2MNY A;  4QR5 A;  5KHM A;  2KTB B;  4GB0 A;  4Z1S A;  1WEU A;  5A7C A;  4LYI A;  3IU6 A;  4UIV A;  5ENH A;  1WEE A;  3LQI A;  1WES A;  4OGI A;  4PCE A;  2RNX A;  5L8T A;  5C13 A;  3MXF A;  3KV6 A;  2NXB A;  5II2 A;  4C67 A;  2K16 A;  3N9M A;  5FEY A;  4GND A;  4O71 A;  4O76 A;  5HEM A;  4TQN A;  4NR6 A;  5EPS A;  1VD4 A;  3UVW A;  4PTB A;  4A9H A;  2AN6 A;  5CUA A;  5TDR A;  3O70 A;  5ETD A;  5FE5 A;  3RCW A;  2YHN A;  4MEQ A;  2QIC A;  2LQ6 A;  1MM3 A;  2LXH C;  5EU1 A;  2D9E A;  4O72 A;  5DFD A;  4LK9 A;  5E9M A;  4A9N A;  5EPR A;  1ZBD B;  2L5U A;  3L11 A;  4TKP B;  3GV4 A;  5L98 A;  4J0S A;  1WGM A;  5KTW A;  5HRX A;  5DLX A;  5A5Q A;  2ECI A;  3KV5 A;  4O70 A;  2BAY A;  5AIU A;  5AIT A;  4YAT A;  4QY4 A;  5IBN A;  3AQA A;  4QF2 A;  5HQ5 A;  4QF3 A;  2L75 A;  4YYJ A;  5DKD A;  4LKA A;  4XY9 A;  2YUC A;  2D82 A;  5EWD A;  4QEV A;  5F1H A;  4UYE A;  3PUR A;  5KTU A;  4HXO A;  4LZS A;  3U5K A;  2I8N A;  4QSU A;  5EYA F;  4BBQ A;  2IDA A;  2MD8 C;  5TDW A;  4ZC9 A;  2KGI A;  2L84 A;  4X2I A;  1WUM A;  4CFK A;  4HXK A;  4YAB A;  4NRB A;  3O33 A;  4O7E A;  5DBM A;  1F62 A;  4TT4 A;  1F68 A;  3S92 A;  5G04 B;  5C4Q A;  4YBS A;  5KO4 A;  2VJE B;  3HCS A;  5LJ0 A;  2E6S A;  3MHH A;  4L58 A;  2KFT A;  5DFC A;  5KH3 A;  4B86 C;  5FFY A;  4QUT A;  2DVR A;  1HYJ A;  5ENJ A;  5JI8 A;  5AD3 A;  3ZPV E;  4NR4 A;  4TT2 A;  5LKX A;  4F52 B;  4I7D A;  3EB5 A;  3UVD A;  4UYG A;  3ASL A;  5E73 A;  3P1C A;  5CS8 A;  2E7N A;  3FL2 A;  4CUU A;  2E7O A;  5DFB A;  3SOU A;  1JM4 B;  4MR6 A;  5CPE A;  3LJW A;  3M99 A;  2F6N A;  5E3G A;  2LN0 A;  4NYW A;  4QEW A;  5D3P A;  5F61 A;  2YYN A;  5G4S A;  1JM7 B;  5EI4 A;  2ECJ A;  4DON A;  1FP0 A;  2Y43 A;  4QYL A;  5DYU A;  5H1U A;  4W4U A;  5B78 A;  4YAD A;  4Q0N A;  4YYH A;  3P1D A;  3N9P A;  4GNE A;  4WIV A;  5IG6 A;  4WHW A;  5CQ3 A;  5EWC A;  4ALH A;  4HBY A;  2CKL B;  4CLB A;  2WP1 A;  1JM7 A;  4TZ2 A;  5HQ7 A;  3GG3 A;  5HLS A;  5IGL A;  5CQ7 A;  2MA5 A;  5DYA A;  4YAX A;  5FH6 A;  3N9Q A;  4BHW A;  3DPL R;  4LC2 A;  4YYN A;  1X4I A;  4NR5 A;  3SOX A;  2G43 A;  4Z6H A;  2EGP A;  2KWN A;  5D3T A;  4BW2 A;  5CUE A;  5COI A;  3MHS A;  5EV9 A;  5FE1 A;  2MJV B;  2FUU A;  2Y1M A;  1T1H A;  2LGV A;  3RPG B;  4UIW A;  5FE4 A;  3I2D A;  4A9K A;  5DIN A;  4UI9 B;  5JG6 A;  4HXL A;  2LV9 A;  4TU4 A;  5C85 A;  1ZS5 A;  5AD2 A;  5D25 A;  2DVV A;  2F6J A;  4LYW A;  5I1Q A;  5E9K A;  2Y1N A;  4AP4 A;  2KYU A;  2YEK A;  5F2P A;  4C9Z A;  4LZ2 A;  1U6G B;  4IOR A;  4QSV A;  5CP5 A;  3U5O A;  4QR3 A;  5C87 A;  5IID A;  1WFK A;  2KRE A;  2VPB A;  5D1K B;  5E9Y A;  3JVM A;  5DW2 A;  4QSP A;  2K17 A;  2MUM A;  4O7B A;  2I50 A;  4CUQ A;  3DQV R;  5DW1 A;  2YW8 A;  5G0F A;  3O7A A;  1RMD A;  4R2Y A;  3RTR B;  4HXR A;  2L5E A;  3SVG A;  3HMF A;  2JMI A;  4A9M A;  3N9O A;  3TLP A;  4UIZ A;  5ENF A;  4B7Y C;  3EB6 A;  4BW1 A;  5ENI A;  4WZ2 A;  4TZ8 A;  4A49 A;  4Z1Q A;  4MSX A;  4TTE A;  5F1L A;  5HRV A;  2GRC A;  4TT6 A;  5FE8 A;  2OXQ C;  4YYM A;  5CRM A;  3AAD A;  5BT5 A;  3IHP A;  2YEL A;  4N4G A;  2ECT A;  2KGG A;  5KU3 A;  3N9L A;  5D1L B;  4YY6 A;  1WEN A;  5A5P A;  2ECN A;  1Z2Q A;  2VP7 A;  1X0J A;  4OGJ A;  5C89 A;  4CUS A;  5A5O A;  2JMD A;  2R0V A;  2VJF A;  5HJC A;  4Q6F A;  2E3K A;  2KIZ A;  5B77 A;  4LRG A;  3O37 A;  2LDR A;  2QJ0 A;  2M1R A;  5ENG A;  2RO1 A;  3I3J A;  5LUU A;  1MM2 A;  5HM0 A;  2E6R A;  4CCG X;  2YSJ A;  4NUE A;  3KNV A;  2DVS A;  5D3S A;  4XI1 A;  2RI7 A;  5D3N A;  5F62 A;  1Z6U A;  2OSS A;  2VJF B;  4PY6 A;  5CTL A;  4KV4 A;  1VYX A;  5CQA A;  3JVK A;  3K2J A;  5ENB A;  4MR5 A;  3KQI A;  4IC2 A;  5EWH A;  4LJN A;  4XYA A;  5D1M B;  4HXM A;  4QSS A;  5EK9 A;  4YH3 A;  4AYC A;  5DKC A;  3MUL A;  4V3K C;  5D26 A;  4HBX A;  2EOD A;  2LGG A;  3DWY A;  2KR4 A;  3HCT A;  5DX4 A;  4NR8 A; 
#chains in the Genus database with same CATH topology
 4NYX A;  2ECW A;  3ZYU A;  3Q2F A;  5AMF A;  3UV5 A;  2KKY A;  5AME A;  4UYF A;  5D0C A;  5G4R A;  3ZVY A;  4AYC B;  4A4C A;  2N9G A;  5FFW A;  1K2F A;  5E9V A;  5TB6 A;  4AUQ B;  2OUO A;  5BT4 A;  2LGL A;  2VPG A;  5D3J A;  4AKI A;  1MBM A;  5CQ8 A;  1WIM A;  2G4A A;  3L1X A;  3P1E A;  4MR3 A;  5ENC A;  2MNZ A;  4UYF B;  2VPD A;  5TAB A;  1HYI A;  5F25 A;  3T7L A;  4TYL A;  1WEM A;  2M6M A;  5CQ5 A;  2F42 A;  3L1Z B;  5B79 A;  3SHB A;  2C2V S;  1V87 A;  2YU4 A;  4YK0 A;  5SVI A;  4CUT A;  2K4D A;  3UVY A;  5FB1 A;  5D3H A;  4CA1 A;  5EWV A;  4YH4 A;  2CRR A;  1WEO A;  2M3H A;  3ZPV 1;  4QST A;  2EA6 A;  2HDP A;  4BJX A;  5ENE A;  4N4F A;  4QSQ A;  2MKE A;  3D7C A;  4OGC A;  4A9L A;  3DAI A;  3DWD A;  5SVI B;  4WZ3 B;  2JUN A;  5LKU A;  5I89 A;  3ZNI A;  2RFJ A;  3G0J A;  1WEQ A;  4N4H A;  2YSM A;  2NAA A;  2ZET C;  3M62 A;  2YT5 A;  2B0O E;  2M13 A;  4CUP A;  4FIP A;  5FE7 A;  2CSY A;  5II1 A;  5EP7 A;  3UV4 A;  5DKH A;  3P1F A;  4QYD A;  4PCI A;  5J3X A;  1G25 A;  5SVX A;  4Y03 A;  3P5O A;  2YHO A;  4O64 A;  3IU5 A;  4S3O B;  3HTK C;  5EGU A;  5L99 A;  5DKA A;  4A9O A;  2G6Q A;  4P5O B;  5LKT A;  3QZT A;  4HXN A;  5KH7 A;  2YQM A;  3C5K A;  5E9L A;  3RPG C;  5CQ4 A;  4QSW A;  3FAO A;  2LSP B;  2H60 A;  5DYX A;  4LR6 A;  2JMJ A;  2WP2 A;  5FE9 A;  5FH7 A;  4NUC A;  2FUI A;  4I7B A;  1N72 A;  3Q1D A;  4NR9 A;  4TU6 A;  4QSR A;  3O35 A;  5FH8 A;  5FG5 A;  2CSZ A;  4NQM A;  3GL6 A;  1BOR A;  2YDW A;  4OGE A;  2UZG A;  4MEP A;  4XY8 A;  1ZKR A;  4HBW A;  4UIT A;  3HMH A;  2KU3 A;  4IR3 A;  4NRC A;  2H0D A;  4NS5 A;  1E4U A;  5TRB A;  2KWK A;  4NUD A;  2LGK A;  4KCX A;  4KV1 A;  5FE3 A;  5LJ2 A;  4MVT A;  3O34 A;  4E96 A;  4YYI A;  2ECV A;  2PUY A;  5C7N A;  3PHD A;  4UYH A;  4V3L C;  5EWW A;  2HYE D;  4PPE A;  3DDT A;  4QZS A;  4NXJ A;  4I7C A;  5F5Z A;  2YW5 A;  5EVA A;  4ZW1 A;  1JSP B;  5EIS A;  4UP5 A;  4YBM A;  1X4U A;  5H85 A;  2CT2 A;  5I83 A;  3SVF A;  5J0D A;  5JWM A;  4WA6 A;  4O77 A;  5DLZ A;  2RS9 B;  5CFW A;  5KTX A;  3D1D A;  5L96 A;  1FBV A;  3ZTG A;  2KKX A;  4QEU A;  1E6I A;  4L7X A;  4F3I A;  4OUF A;  4NR7 A;  3SVH A;  2FD4 A;  4XUA A;  2L85 A;  4O78 A;  4MR4 A;  4CL9 A;  3NXB A;  5DY7 A;  5EA1 A;  2YRE A;  2RNW A;  1CHC A;  2YUR A;  5I88 A;  3SOW A;  5CUG A;  5FE6 A;  2DAT A;  5D3L A;  4UIY A;  5HQ6 A;  3LVQ E;  5FG4 A;  4IOQ A;  4FK5 A;  5CZG A;  4UIU A;  3MQM A;  5B8D A;  3U5N A;  5HFR A;  2K1J A;  4PS5 A;  2EJN A;  3M63 A;  4J3I A;  3LRQ A;  2IQJ A;  5I7Y A;  4Z6I A;  3FEH A;  4XUB A;  5C11 A;  5KH9 A;  4GNF A;  4AVX A;  5FER A;  2PNX A;  5K3Q A;  5I86 A;  4AKH A;  2XEU A;  1WUG A;  3PUQ A;  5TBN A;  4BW3 A;  4ZDT A;  4BW4 A;  5BT3 A;  1N87 A;  4HXS A;  2LRI C;  4A0C D;  4FO9 A;  4WZ0 A;  5FG6 A;  2I7K A;  2MT5 A;  3LQJ A;  4QC1 A;  4QUU A;  5CQT A;  2XOY A;  2RSD A;  2L43 A;  3NG2 A;  4CUR A;  3V43 A;  5LVQ A;  5C8G A;  2MA6 A;  4O7C A;  3MB4 A;  1VFY A;  5K29 A;  3U5L A;  5HCL A;  1LDJ B;  4FLP A;  1IYM A;  5LKZ A;  4J1P A;  5FDZ A;  4LLB A;  2DKW A;  4WHU A;  5A83 A;  5FE0 A;  1X4J A;  2LXP C;  3QZV A;  3VK6 A;  4QC3 A;  5D7X A;  3U5J A;  3C6W A;  5HFQ A;  5EM3 A;  4Z0R A;  5HRW A;  5CUB A;  3JVL A;  1EQF A;  1Z60 A;  5FFV A;  5SVY A;  4IR5 A;  4LZR A;  4YYK A;  5CUC A;  3FKM X;  3HME A;  4A9F A;  4LAD B;  5FE2 A;  2DX8 A;  5L97 A;  5EPB A;  2DVQ A;  5I7X A;  2YQD A;  5A5N A;  4UIX A;  2KE1 A;  2QIZ A;  5CUD A;  3Q2E A;  5A82 A;  4Q0O A;  5F3A A;  2M85 A;  3JVJ A;  1WIL A;  2YEM A;  3VKH A;  4O74 A;  2H0D B;  2XB1 A;  2JRJ A;  4LYS A;  1JOC A;  5D3R A;  4HBV A;  5I3L A;  4QR4 A;  1WEV A;  5CRZ A;  4MEO A;  4IR6 A;  5CU8 A;  5LJ1 A;  1WE9 A;  2CSV A;  3HCU A;  5B76 A;  4ZUX U;  5H1T A;  5H1V A;  4MEN A;  4NYV A;  4NRA A;  3U5P A;  3G0L A;  2JM3 A;  4UYD A;  3LQH A;  4LDF A;  5E7D A;  4UP0 A;  4C66 A;  4AI6 A;  4A9J A;  4IR4 A;  2KWO A;  3N9N A;  5LCW B;  5E9I A;  4ALG A;  3ZYQ A;  2KWJ A;  4GNG A;  4O7A A;  4Z93 A;  5TCM A;  5A81 A;  5A5R A;  5CGP A;  5EQ1 A;  4S3O C;  4YBT A;  5FB0 A;  5HEL A;  5B75 A;  2L0B A;  5I40 A;  3ONI A;  5CY9 A;  5E74 A;  4IOO A;  1WEP A;  5E0R A;  5F63 A;  2VPE A;  5I80 A;  4A4B A;  5E3D A;  2G45 A;  4YYG A;  5LVR A;  4H9D A;  4Z0O A;  4N4I A;  4O7F A;  5A85 A;  5I29 A;  4QQ4 A;  4HXP A;  5DYC A;  5EIC A;  5IGK A;  4QSX A;  4QBM A;  2VJE A;  2E61 A;  2ECG A;  1XWH A;  1LDK C;  2YYR A;  2MIQ A;  3LXJ A;  5IGM A;  4YC9 A;  3O36 A;  2L80 A;  4YY4 A;  3UV2 A;  4A9I A;  5L8U A;  5CQ6 A;  2R10 A;  2OO1 A;  2DWW A;  2R0Y A;  4QB3 A;  4AKG A;  5A5S A;  5F60 A;  2RNY A;  4RVR A;  5IGN A;  3VKG A;  2C2L A;  5FBX A;  3UW9 A;  4NQN A;  4ZQL A;  3PLW A;  2LAU A;  4NN2 A;  4R8P K;  4PKL A;  4R7E A;  5ACY A;  2MD7 B;  3ZVZ B;  3D1B A;  4J0R A;  4IC3 A;  3S91 A;  2FFW A;  4N3W A;  2D8S A;  5F36 A;  2YQL A;  4QNS A;  4AKN A;  3QZS A;  2FSA A;  3FJU B;  4X3G A;  3MUK A;  3T9K A;  2VNF A;  4CFL A;  1WEW A;  3U5M A;  2R0S A;  1DVP A;  5G05 B;  2DSM A;  5ETB A;  3UVX A;  5H9M A;  4A9E A;  4YYD A;  4GPJ A;  3T6R A;  3MDB C;  4TS8 A;  5D24 A;  5HEN A;  3MB3 A;  4O75 A;  2CKL A;  2MNY A;  4QR5 A;  2CRW A;  5KHM A;  2KTB B;  4GB0 A;  4Z1S A;  1WEU A;  5A7C A;  4LYI A;  3IU6 A;  4UIV A;  5ENH A;  1WEE A;  3LQI A;  1WES A;  4OGI A;  4PCE A;  2RNX A;  5L8T A;  4O62 A;  5C13 A;  3MXF A;  3KV6 A;  2NXB A;  5II2 A;  4C67 A;  2K16 A;  3N9M A;  5FEY A;  4GND A;  4O71 A;  4O76 A;  5HEM A;  4TQN A;  4NR6 A;  5EPS A;  1VD4 A;  3UVW A;  4PTB A;  4A9H A;  2AN6 A;  5CUA A;  3LJU X;  5TDR A;  3O70 A;  5ETD A;  5FE5 A;  3RCW A;  2YHN A;  4MEQ A;  2QIC A;  2LQ6 A;  1MM3 A;  2CON A;  5EU1 A;  2LXH C;  2D9E A;  4O72 A;  5DFD A;  3JUE A;  4LK9 A;  5E9M A;  4A9N A;  5EPR A;  1ZBD B;  2L5U A;  3L11 A;  4TKP B;  2L7P A;  3GV4 A;  5L98 A;  4J0S A;  1WGM A;  5KTW A;  5HRX A;  5DLX A;  5A5Q A;  2ECI A;  2YVR A;  4O70 A;  2BAY A;  3KV5 A;  5AIU A;  5AIT A;  4YAT A;  4QY4 A;  5IBN A;  3AQA A;  4QF2 A;  5HQ5 A;  4QF3 A;  2L75 A;  4YYJ A;  5DKD A;  4LKA A;  4XY9 A;  2YUC A;  2D82 A;  5EWD A;  4QEV A;  5F1H A;  4UYE A;  1DCQ A;  5KTU A;  4HXO A;  4LZS A;  3U5K A;  1PUO A;  2I8N A;  4QSU A;  3PUR A;  2IDA A;  5EYA F;  2MD8 C;  4BBQ A;  5TDW A;  4ZC9 A;  2KGI A;  2L84 A;  4X2I A;  1WUM A;  4CFK A;  4HXK A;  4YAB A;  4NRB A;  3O33 A;  4O7E A;  5DBM A;  1F62 A;  4TT4 A;  1F68 A;  3LVR E;  3S92 A;  5G04 B;  5C4Q A;  4YBS A;  5KO4 A;  2VJE B;  3HCS A;  5LJ0 A;  2E6S A;  3MHH A;  4L58 A;  2KFT A;  5DFC A;  5KH3 A;  4B86 C;  5FFY A;  4QUT A;  2DVR A;  1HYJ A;  5ENJ A;  5JI8 A;  5AD3 A;  3ZPV E;  4NR4 A;  4TT2 A;  5LKX A;  4F52 B;  4I7D A;  3EB5 A;  3UVD A;  4UYG A;  3ASL A;  5E73 A;  3P1C A;  5CS8 A;  2EXU A;  2E7N A;  2DJA A;  3FL2 A;  4CUU A;  2E7O A;  5DFB A;  3SOU A;  1JM4 B;  4MR6 A;  5CPE A;  3LJW A;  3M99 A;  2F6N A;  5E3G A;  2LN0 A;  4NYW A;  4QEW A;  5D3P A;  5F61 A;  2YYN A;  5G4S A;  3KDE C;  1JM7 B;  5EI4 A;  2ECJ A;  4DON A;  1FP0 A;  2Y43 A;  4QYL A;  5DYU A;  5H1U A;  4W4U A;  2P57 A;  5B78 A;  4YAD A;  4Q0N A;  4YYH A;  3P1D A;  3N9P A;  4GNE A;  4WIV A;  2XP0 A;  5IG6 A;  4WHW A;  5CQ3 A;  5EWC A;  4ALH A;  4HBY A;  2CKL B;  4CLB A;  2WP1 A;  1JM7 A;  4TZ2 A;  5HQ7 A;  3GG3 A;  5HLS A;  3FAN A;  5IGL A;  5CQ7 A;  3O47 A;  2MA5 A;  5DYA A;  4YAX A;  5FH6 A;  3N9Q A;  4BHW A;  3DPL R;  4LC2 A;  4YYN A;  1X4I A;  4NR5 A;  3SOX A;  2G43 A;  4Z6H A;  2EGP A;  2KWN A;  5D3T A;  4BW2 A;  5CUE A;  5COI A;  3MHS A;  5EV9 A;  5FE1 A;  2MJV B;  2FUU A;  2Y1M A;  1T1H A;  2LGV A;  3RPG B;  4UIW A;  5FE4 A;  3I2D A;  2RR4 A;  4A9K A;  5DIN A;  4UI9 B;  5JG6 A;  4HXL A;  2LV9 A;  4TU4 A;  5C85 A;  1ZS5 A;  5AD2 A;  5D25 A;  2DVV A;  2F6J A;  4LYW A;  5I1Q A;  5E9K A;  2Y1N A;  4AP4 A;  2KYU A;  2YEK A;  5F2P A;  4C9Z A;  4LZ2 A;  1U6G B;  4IOR A;  4QSV A;  5CP5 A;  3U5O A;  4QR3 A;  5C87 A;  5IID A;  1WFK A;  2KRE A;  2VPB A;  5D1K B;  5E9Y A;  3JVM A;  5DW2 A;  4QSP A;  2K17 A;  2MUM A;  4O7B A;  2I50 A;  4CUQ A;  2D8U A;  5DW1 A;  2YW8 A;  3DQV R;  5G0F A;  3O7A A;  1RMD A;  4R2Y A;  3RTR B;  4HXR A;  2L5E A;  3SVG A;  3HMF A;  2JMI A;  4F1P A;  4A9M A;  3N9O A;  2EGM A;  3TLP A;  4UIZ A;  5ENF A;  4B7Y C;  3EB6 A;  4BW1 A;  5ENI A;  4WZ2 A;  4TZ8 A;  4A49 A;  4Z1Q A;  4MSX A;  4TTE A;  5F1L A;  4FJC A;  5HRV A;  2GRC A;  4TT6 A;  5FE8 A;  2OXQ C;  3SUB A;  4YYM A;  5CRM A;  3AAD A;  5BT5 A;  3IHP A;  2YEL A;  4N4G A;  2ECT A;  2KGG A;  5KU3 A;  3N9L A;  5D1L B;  4YY6 A;  1WEN A;  5A5P A;  2ECN A;  1Z2Q A;  2VP7 A;  1X0J A;  4OGJ A;  5C89 A;  3FM8 C;  4CUS A;  5A5O A;  2JMD A;  2R0V A;  2VJF A;  5HJC A;  4Q6F A;  2E3K A;  3LDY A;  2KIZ A;  2XOZ A;  5B77 A;  4LRG A;  3O37 A;  2LDR A;  2QJ0 A;  3H7H A;  3ERR A;  2M1R A;  3E2D A;  5ENG A;  2RO1 A;  3I3J A;  5LUU A;  1MM2 A;  5HM0 A;  2E6R A;  4CCG X;  2YSJ A;  4NUE A;  3KNV A;  2DVS A;  5D3S A;  4XI1 A;  2RI7 A;  5D3N A;  5F62 A;  1Z6U A;  2OSS A;  2VJF B;  4PY6 A;  5CTL A;  2OWA A;  3M7K A;  4KV4 A;  1VYX A;  5CQA A;  3JVK A;  3K2J A;  5ENB A;  4MR5 A;  3KQI A;  4IC2 A;  5EWH A;  4LJN A;  4XYA A;  5D1M B;  4HXM A;  4QSS A;  5EK9 A;  4YH3 A;  4AYC A;  5DKC A;  3MUL A;  4V3K C;  5D26 A;  4HBX A;  2EOD A;  2LGG A;  3DWY A;  2XOC A;  2KR4 A;  3HCT A;  5DX4 A;  4NR8 A; 
#chains in the Genus database with same CATH homology
 4NYX A;  2ECW A;  3ZYU A;  3Q2F A;  5AMF A;  3UV5 A;  5AME A;  4UYF A;  5D0C A;  5G4R A;  3ZVY A;  4AYC B;  4A4C A;  2N9G A;  5FFW A;  1K2F A;  5E9V A;  5TB6 A;  4AUQ B;  2OUO A;  5BT4 A;  2LGL A;  2VPG A;  5D3J A;  5CQ8 A;  1WIM A;  2G4A A;  3L1X A;  3P1E A;  4MR3 A;  5ENC A;  2MNZ A;  4UYF B;  2VPD A;  5TAB A;  1HYI A;  5F25 A;  3T7L A;  4TYL A;  1WEM A;  2M6M A;  5CQ5 A;  2F42 A;  3L1Z B;  5B79 A;  3SHB A;  2C2V S;  1V87 A;  2YU4 A;  4YK0 A;  4CUT A;  2K4D A;  3UVY A;  5FB1 A;  5D3H A;  4CA1 A;  5EWV A;  4YH4 A;  1WEO A;  2M3H A;  3ZPV 1;  4QST A;  2EA6 A;  2HDP A;  4BJX A;  5ENE A;  4N4F A;  4QSQ A;  3D7C A;  4A9L A;  3DAI A;  4WZ3 B;  5LKU A;  5I89 A;  3ZNI A;  2RFJ A;  3G0J A;  1WEQ A;  4N4H A;  2YSM A;  2NAA A;  2ZET C;  3M62 A;  2YT5 A;  4CUP A;  4FIP A;  5FE7 A;  2CSY A;  5II1 A;  5EP7 A;  3UV4 A;  5DKH A;  3P1F A;  4QYD A;  4PCI A;  5J3X A;  1G25 A;  4Y03 A;  3P5O A;  2YHO A;  4O64 A;  3IU5 A;  4S3O B;  3HTK C;  5EGU A;  5L99 A;  5DKA A;  4A9O A;  2G6Q A;  4P5O B;  5LKT A;  3QZT A;  4HXN A;  5KH7 A;  2YQM A;  3C5K A;  5E9L A;  3RPG C;  5CQ4 A;  4QSW A;  2LSP B;  2H60 A;  5DYX A;  4LR6 A;  2JMJ A;  2WP2 A;  5FE9 A;  5FH7 A;  4NUC A;  2FUI A;  4I7B A;  1N72 A;  4NR9 A;  4TU6 A;  4QSR A;  3O35 A;  5FH8 A;  5FG5 A;  2CSZ A;  4NQM A;  3GL6 A;  1BOR A;  2YDW A;  2UZG A;  4MEP A;  4XY8 A;  4HBW A;  4UIT A;  3HMH A;  2KU3 A;  4IR3 A;  4NRC A;  2H0D A;  4NS5 A;  1E4U A;  5TRB A;  2KWK A;  4NUD A;  2LGK A;  4KCX A;  4KV1 A;  5FE3 A;  5LJ2 A;  4MVT A;  3O34 A;  4E96 A;  4YYI A;  2ECV A;  2PUY A;  5C7N A;  3PHD A;  4UYH A;  4V3L C;  5EWW A;  2HYE D;  4PPE A;  4QZS A;  4NXJ A;  4I7C A;  5F5Z A;  2YW5 A;  5EVA A;  4ZW1 A;  1JSP B;  5EIS A;  4UP5 A;  4YBM A;  1X4U A;  5H85 A;  2CT2 A;  5I83 A;  3SVF A;  5J0D A;  5JWM A;  4WA6 A;  4O77 A;  5DLZ A;  2RS9 B;  5CFW A;  5KTX A;  3ZTG A;  5L96 A;  1FBV A;  4QEU A;  1E6I A;  4L7X A;  4F3I A;  4OUF A;  4NR7 A;  3SVH A;  4XUA A;  2L85 A;  4O78 A;  4MR4 A;  4CL9 A;  3NXB A;  5DY7 A;  5EA1 A;  2YRE A;  2RNW A;  1CHC A;  2YUR A;  5I88 A;  3SOW A;  5CUG A;  5FE6 A;  2DAT A;  5D3L A;  4UIY A;  5HQ6 A;  5FG4 A;  4IOQ A;  4FK5 A;  5CZG A;  4UIU A;  3MQM A;  5B8D A;  3U5N A;  5HFR A;  2K1J A;  4PS5 A;  3M63 A;  4J3I A;  3LRQ A;  5I7Y A;  4Z6I A;  4XUB A;  5C11 A;  5KH9 A;  4GNF A;  4AVX A;  5FER A;  2PNX A;  5I86 A;  2XEU A;  1WUG A;  3PUQ A;  5TBN A;  4BW3 A;  4ZDT A;  4BW4 A;  5BT3 A;  1N87 A;  4HXS A;  2LRI C;  4A0C D;  4FO9 A;  4WZ0 A;  5FG6 A;  2I7K A;  2MT5 A;  3LQJ A;  4QC1 A;  4QUU A;  5CQT A;  3NG2 A;  2RSD A;  2L43 A;  4FJC A;  4CUR A;  3V43 A;  5LVQ A;  5C8G A;  2MA6 A;  4O7C A;  3MB4 A;  1VFY A;  5K29 A;  3U5L A;  5HCL A;  1LDJ B;  4FLP A;  1IYM A;  5LKZ A;  4J1P A;  5FDZ A;  4LLB A;  2DKW A;  4WHU A;  5A83 A;  5FE0 A;  1X4J A;  2LXP C;  3QZV A;  3VK6 A;  4QC3 A;  5D7X A;  3U5J A;  3C6W A;  5HFQ A;  5EM3 A;  5HRW A;  5CUB A;  3JVL A;  1EQF A;  1Z60 A;  5FFV A;  4IR5 A;  4LZR A;  4YYK A;  5CUC A;  3FKM X;  3HME A;  4A9F A;  4LAD B;  5FE2 A;  2DX8 A;  5L97 A;  5EPB A;  2DVQ A;  5I7X A;  2YQD A;  5A5N A;  4UIX A;  2KE1 A;  2QIZ A;  5CUD A;  3Q2E A;  5A82 A;  4Q0O A;  5F3A A;  2M85 A;  3JVJ A;  1WIL A;  2YEM A;  4O74 A;  2H0D B;  2XB1 A;  2JRJ A;  4LYS A;  1JOC A;  5D3R A;  4HBV A;  5I3L A;  4QR4 A;  1WEV A;  5CRZ A;  4MEO A;  4IR6 A;  5CU8 A;  5LJ1 A;  1WE9 A;  3HCU A;  5B76 A;  4ZUX U;  5H1T A;  5H1V A;  4MEN A;  4NYV A;  4NRA A;  3U5P A;  3G0L A;  4UP0 A;  4UYD A;  3LQH A;  4LDF A;  5E7D A;  4C66 A;  4A9J A;  4IR4 A;  2KWO A;  3N9N A;  5LCW B;  5E9I A;  4ALG A;  3ZYQ A;  2KWJ A;  4GNG A;  4O7A A;  4Z93 A;  5TCM A;  5A81 A;  5A5R A;  5CGP A;  5EQ1 A;  4S3O C;  4YBT A;  5FB0 A;  5HEL A;  5B75 A;  2L0B A;  5I40 A;  3ONI A;  5CY9 A;  5E74 A;  4IOO A;  1WEP A;  5E0R A;  5F63 A;  2VPE A;  5I80 A;  4A4B A;  5E3D A;  2G45 A;  4YYG A;  5LVR A;  4N4I A;  4O7F A;  5A85 A;  5I29 A;  4HXP A;  5DYC A;  5EIC A;  5IGK A;  4QSX A;  4QBM A;  2VJE A;  2ECG A;  1XWH A;  1LDK C;  2YYR A;  2MIQ A;  3LXJ A;  5IGM A;  4YC9 A;  3O36 A;  2L80 A;  4YY4 A;  3UV2 A;  4A9I A;  5L8U A;  5CQ6 A;  2R10 A;  2OO1 A;  2DWW A;  2R0Y A;  4QB3 A;  5A5S A;  5F60 A;  2RNY A;  4RVR A;  5IGN A;  2C2L A;  5FBX A;  3UW9 A;  4NQN A;  4ZQL A;  4NN2 A;  4R8P K;  4PKL A;  4R7E A;  5ACY A;  2MD7 B;  3ZVZ B;  4J0R A;  4IC3 A;  3S91 A;  2YQL A;  4N3W A;  2D8S A;  5F36 A;  4QNS A;  4AKN A;  3QZS A;  2FSA A;  4X3G A;  3MUK A;  2VNF A;  4CFL A;  1WEW A;  3U5M A;  2R0S A;  1DVP A;  5G05 B;  5ETB A;  3UVX A;  5H9M A;  4A9E A;  4YYD A;  4GPJ A;  3T6R A;  4TS8 A;  5D24 A;  5HEN A;  3MB3 A;  4O75 A;  2CKL A;  2MNY A;  4QR5 A;  5KHM A;  2KTB B;  4GB0 A;  4Z1S A;  1WEU A;  5A7C A;  4LYI A;  3IU6 A;  4UIV A;  5ENH A;  1WEE A;  3LQI A;  1WES A;  4OGI A;  4PCE A;  2RNX A;  5L8T A;  5C13 A;  3MXF A;  3KV6 A;  2NXB A;  5II2 A;  4C67 A;  2K16 A;  3N9M A;  5FEY A;  4GND A;  4O71 A;  4O76 A;  5HEM A;  4TQN A;  4NR6 A;  5EPS A;  1VD4 A;  3UVW A;  4PTB A;  4A9H A;  2AN6 A;  5CUA A;  5TDR A;  3O70 A;  5ETD A;  5FE5 A;  3RCW A;  2YHN A;  4MEQ A;  2QIC A;  2LQ6 A;  1MM3 A;  2LXH C;  5EU1 A;  2D9E A;  4O72 A;  5DFD A;  4LK9 A;  5E9M A;  4A9N A;  5EPR A;  1ZBD B;  2L5U A;  3L11 A;  4TKP B;  3GV4 A;  5L98 A;  4J0S A;  1WGM A;  5KTW A;  5HRX A;  5DLX A;  5A5Q A;  2ECI A;  3KV5 A;  4O70 A;  2BAY A;  5AIU A;  5AIT A;  4YAT A;  4QY4 A;  5IBN A;  3AQA A;  4QF2 A;  5HQ5 A;  4QF3 A;  2L75 A;  4YYJ A;  5DKD A;  4LKA A;  4XY9 A;  2YUC A;  2D82 A;  5EWD A;  4QEV A;  5F1H A;  4UYE A;  3PUR A;  5KTU A;  4HXO A;  4LZS A;  3U5K A;  2I8N A;  4QSU A;  5EYA F;  4BBQ A;  2IDA A;  2MD8 C;  5TDW A;  4ZC9 A;  2KGI A;  2L84 A;  4X2I A;  1WUM A;  4CFK A;  4HXK A;  4YAB A;  4NRB A;  3O33 A;  4O7E A;  5DBM A;  1F62 A;  4TT4 A;  1F68 A;  3S92 A;  5G04 B;  5C4Q A;  4YBS A;  5KO4 A;  2VJE B;  3HCS A;  5LJ0 A;  2E6S A;  3MHH A;  4L58 A;  2KFT A;  5DFC A;  5KH3 A;  4B86 C;  5FFY A;  4QUT A;  2DVR A;  1HYJ A;  5ENJ A;  5JI8 A;  5AD3 A;  3ZPV E;  4NR4 A;  4TT2 A;  5LKX A;  4F52 B;  4I7D A;  3EB5 A;  3UVD A;  4UYG A;  3ASL A;  5E73 A;  3P1C A;  5CS8 A;  2E7N A;  3FL2 A;  4CUU A;  2E7O A;  5DFB A;  3SOU A;  1JM4 B;  4MR6 A;  5CPE A;  3LJW A;  3M99 A;  2F6N A;  5E3G A;  2LN0 A;  4NYW A;  4QEW A;  5D3P A;  5F61 A;  2YYN A;  5G4S A;  1JM7 B;  5EI4 A;  2ECJ A;  4DON A;  1FP0 A;  2Y43 A;  4QYL A;  5DYU A;  5H1U A;  4W4U A;  5B78 A;  4YAD A;  4Q0N A;  4YYH A;  3P1D A;  3N9P A;  4GNE A;  4WIV A;  5IG6 A;  4WHW A;  5CQ3 A;  5EWC A;  4ALH A;  4HBY A;  2CKL B;  4CLB A;  2WP1 A;  1JM7 A;  4TZ2 A;  5HQ7 A;  3GG3 A;  5HLS A;  5IGL A;  5CQ7 A;  2MA5 A;  5DYA A;  4YAX A;  5FH6 A;  3N9Q A;  4BHW A;  3DPL R;  4LC2 A;  4YYN A;  1X4I A;  4NR5 A;  3SOX A;  2G43 A;  4Z6H A;  2EGP A;  2KWN A;  5D3T A;  4BW2 A;  5CUE A;  5COI A;  3MHS A;  5EV9 A;  5FE1 A;  2MJV B;  2FUU A;  2Y1M A;  1T1H A;  2LGV A;  3RPG B;  4UIW A;  5FE4 A;  3I2D A;  4A9K A;  5DIN A;  4UI9 B;  5JG6 A;  4HXL A;  2LV9 A;  4TU4 A;  5C85 A;  1ZS5 A;  5AD2 A;  5D25 A;  2DVV A;  2F6J A;  4LYW A;  5I1Q A;  5E9K A;  2Y1N A;  4AP4 A;  2KYU A;  2YEK A;  5F2P A;  4C9Z A;  4LZ2 A;  1U6G B;  4IOR A;  4QSV A;  5CP5 A;  3U5O A;  4QR3 A;  5C87 A;  5IID A;  1WFK A;  2KRE A;  2VPB A;  5D1K B;  5E9Y A;  3JVM A;  5DW2 A;  4QSP A;  2K17 A;  2MUM A;  4O7B A;  2I50 A;  4CUQ A;  3DQV R;  5DW1 A;  2YW8 A;  5G0F A;  3O7A A;  1RMD A;  4R2Y A;  3RTR B;  4HXR A;  2L5E A;  3SVG A;  3HMF A;  2JMI A;  4A9M A;  3N9O A;  3TLP A;  4UIZ A;  5ENF A;  4B7Y C;  3EB6 A;  4BW1 A;  5ENI A;  4WZ2 A;  4TZ8 A;  4A49 A;  4Z1Q A;  4MSX A;  4TTE A;  5F1L A;  5HRV A;  2GRC A;  4TT6 A;  5FE8 A;  2OXQ C;  4YYM A;  5CRM A;  3AAD A;  5BT5 A;  3IHP A;  2YEL A;  4N4G A;  2ECT A;  2KGG A;  5KU3 A;  3N9L A;  5D1L B;  4YY6 A;  1WEN A;  5A5P A;  2ECN A;  1Z2Q A;  2VP7 A;  1X0J A;  4OGJ A;  5C89 A;  4CUS A;  5A5O A;  2JMD A;  2R0V A;  2VJF A;  5HJC A;  4Q6F A;  2E3K A;  2KIZ A;  5B77 A;  4LRG A;  3O37 A;  2LDR A;  2QJ0 A;  2M1R A;  5ENG A;  2RO1 A;  3I3J A;  5LUU A;  1MM2 A;  5HM0 A;  2E6R A;  4CCG X;  2YSJ A;  4NUE A;  3KNV A;  2DVS A;  5D3S A;  4XI1 A;  2RI7 A;  5D3N A;  5F62 A;  1Z6U A;  2OSS A;  2VJF B;  4PY6 A;  5CTL A;  4KV4 A;  1VYX A;  5CQA A;  3JVK A;  3K2J A;  5ENB A;  4MR5 A;  3KQI A;  4IC2 A;  5EWH A;  4LJN A;  4XYA A;  5D1M B;  4HXM A;  4QSS A;  5EK9 A;  4YH3 A;  4AYC A;  5DKC A;  3MUL A;  4V3K C;  5D26 A;  4HBX A;  2EOD A;  2LGG A;  3DWY A;  2KR4 A;  3HCT A;  5DX4 A;  4NR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...