5FB0A

Crystal structure of a phd finger bound to histone h3 t3ph peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
183
structure length
172
Chain Sequence
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERSGHQESEVLMRQMQPEEQLKCEFLLLKVYCDSKSSFFASEPYYGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/structural protein
molecule keywords Nuclear autoantigen Sp-100
publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 172
sequence length 183
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb0A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb0A01
4W4UA 3O34A 4BW3A 4N4FA 4YYGA 5I7YA 3T7LA 5E9YA 2MUMA 4A4BA 4MVTA 4YYKA 3U5NA 1JM7B 4QR5A 2FSAA 1VYXA 3G0JA 4O74A 2JMDA 4QNSA 3HMEA 4ALHA 5BT5A 4L7XA 4C9ZA 5J0DA 4HXLA 5ENBA 2L5EA 4QR4A 2KIZA 2I50A 2LN0A 5EPSA 5EWHA 3HMHA 3P1DA 2MIQA 5E9IA 5CQTA 5CUBA 4QY4A 4J0SA 1JM7A 5A5QA 2ZETC 4A49A 5I86A 4AYCB 3U5MA 4PY6A 3P5OA 4Z6IA 5B77A 5C13A 5FH6A 4OGIA 4YBMA 3U5PA 4LJNA 4C67A 3S91A 4QYDA 2KWKA 3V43A 2ECJA 5EPBA 5EGUA 3JVKA 4QUTA 4X2IA 2YEMA 2LV9A 2N9GA 3IHPA 4AYCA 4QEVA 3PHDA 2L0BA 5H1TA 2R0SA 2HDPA 2KR4A 5JG6A 4V3LC 4A4CA 4MEQA 5J3XA 2EA6A 2KREA 5A7CA 5L96A 4YYDA 5HCLA 4IR3A 4O7AA 3L11A 2MNZA 3EB5A 1WEWA 4A9OA 4BJXA 4CL9A 5FERA 5G4RA 4HXPA 4GPJA 5E0RA 1HYJA 4TT6A 2L5UA 4N4HA 3SHBA 1U6GB 5CPEA 2YURA 5FE0A 4A9JA 5A5RA 2YDWA 3O7AA 5H1VA 4NUEA 5F62A 5FB0A 2JRJA 5IIDA 3GV4A 4QC3A 2QICA 5EWCA 5FE5A 5EP7A 3HTKC 2DVRA 5TCMA 5TB6A 1N87A 5A5PA 1WEPA 2IDAA 4YBSA 3SVGA 1WE9A 4YYJA 2VPBA 2OO1A 5D3LA 4XUAA 5ENFA 4LRGA 2QIZA 2K1JA 5DINA 4O77A 4FIPA 1RMDA 4IR5A 3UVDA 5C89A 4NYVA 4A9IA 5FE7A 5LJ0A 1FBVA 3O36A 3ZVZB 5L99A 1FP0A 4UIXA 4LZRA 3FKMX 4NXJA 5HENA 5EWDA 4NR6A 4NRCA 5LJ1A 3U5KA 5ETDA 3SVFA 4NQNA 4ZUXU 4A9MA 5H9MA 2MD8C 3ZPV1 2RS9B 3ZNIA 2FUIA 5DYCA 5ENGA 2KGIA 5EU1A 4QF2A 5C8GA 4MSXA 4J1PA 4N4IA 4O7BA 2VPDA 4B7YC 5D24A 5COIA 5CQ4A 5EYAF 4NR4A 2YREA 5D26A 4S3OC 2DVVA 5F25A 5LKZA 1T1HA 4UYGA 5FE2A 4AVXA 5HEMA 4FJCA 5LVQA 1WEOA 2DATA 4UYDA 1X0JA 2E7OA 5E9MA 5ENJA 2ECGA 2YQDA 2H0DB 5CP5A 5F61A 5F63A 4ZDTA 4QSUA 5I88A 4WHUA 5I7XA 4BBQA 4UITA 5CUEA 5D3PA 5HFQA 3HCTA 3LRQA 1E4UA 3KV5A 4QB3A 4Q0NA 5D3HA 4KCXA 5HRWA 3MULA 4WZ0A 4QSVA 3N9OA 1Z60A 5KH3A 2MNYA 3P1CA 5II1A 5C85A 5JI8A 1X4IA 2H0DA 4YY4A 1WGMA 5E3GA 3UVWA 2K4DA 2RFJA 5FE6A 3N9NA 5LVRA 4YC9A 4GB0A 1MM3A 4O7EA 4R2YA 1LDKC 4X3GA 3UV4A 4QC1A 5A83A 3U5OA 3N9QA 1G25A 5LKTA 1WILA 3VK6A 4F52B 4RVRA 3AADA 5FDZA 5E3DA 5AMEA 1DVPA 5CRMA 5FE1A 3RPGB 4YYMA 2L43A 5DKDA 2E7NA 2YHNA 3M62A 5L97A 4Y03A 4NN2A 4TZ2A 2RI7A 2LGLA 5CQ6A 2LGVA 4OGJA 4O72A 4LZSA 5DKHA 4FLPA 5LCWB 4FO9A 4NYXA 4QBMA 2LQ6A 5FG5A 5E73A 5ACYA 5B75A 1JSPB 5C7NA 3JVJA 2D82A 4O7CA 4O75A 5DFCA 5EWWA 5FFYA 4NUDA 5FG4A 3MHSA 3PURA 3HMFA 5TDRA 3Q2FA 4O76A 4UYHA 5EK9A 5I1QA 5K29A 4CA1A 4R7EA 3UVYA 4HXNA 4LK9A 4IC2A 5H85A 4O64A 5HRVA 4Z6HA 2YYNA 4Q6FA 5AIUA 2KWJA 1EQFA 5CU8A 4A9LA 3QZTA 2I8NA 4LZ2A 5CUDA 1CHCA 5I3LA 2DVQA 2MJVB 3SVHA 2I7KA 5FE4A 3DAIA 4WHWA 5D3NA 2YYRA 3DPLR 4GNFA 4TTEA 2M1RA 2H60A 5EV9A 4AUQB 2CSYA 4GNEA 4CUUA 4OUFA 5F2PA 2LSPB 4TYLA 1JM4B 3U5JA 5ENCA 5E7DA 2C2LA 4NR7A 2AN6A 2KGGA 3PUQA 5EM3A 2R0VA 4YH4A 5DLXA 5EA1A 4ZW1A 3EB6A 3C5KA 4V3KC 5G04B 5CUGA 4CUTA 5B8DA 5FH8A 4A9FA 4DONA 1WUGA 2KE1A 4CFLA 2RSDA 2LXPC 5I29A 4HXSA 4YYHA 5F3AA 5CY9A 5D1MB 4YATA 4E96A 5KH7A 4HBYA 5FE8A 3FL2A 1BORA 3O70A 2LRIC 2R10A 3T6RA 2R0YA 3K2JA 4LDFA 5ENEA 5FG6A 4L58A 5L98A 2DX8A 2VJEB 5EICA 4LC2A 5LJ2A 5FH7A 2ECTA 3NG2A 5DKAA 5CUCA 5A81A 3G0LA 4CCGX 3D7CA 4QZSA 5G0FA 4PTBA 2UZGA 4N4GA 5I89A 5L8TA 4O7FA 2G6QA 5D7XA 5F1HA 3TLPA 4Z1QA 2KU3A 4A9EA 2MT5A 5CQ5A 4UYEA 5HJCA 4PPEA 2VJEA 2WP1A 4UIUA 4BW1A 4LLBA 3L1XA 4HBXA 5CFWA 1WFKA 1WEVA 4ZQLA 2BAYA 4YYIA 1V87A 4MR3A 4GNGA 2E6SA 4QEUA 4QSQA 5A5NA 2HYED 2L84A 4NR9A 5I83A 1WEUA 1IYMA 1WEQA 3JVMA 1WENA 2CT2A 2G4AA 4HXRA 5D1KB 4CURA 3M63A 2YELA 5CRZA 5DYXA 4QEWA 4IOOA 5ENIA 2E6RA 4NQMA 3LQIA 2JMJA 5C11A 4HXKA 2EODA 3QZSA 4MR4A 1N72A 5FFVA 1WEMA 2KWOA 5ETBA 4NYWA 5E9LA 4PCEA 4Z93A 1E6IA 1VFYA 3Q2EA 4QYLA 4I7DA 5EPRA 3U5LA 4FK5A 3I2DA 5KH9A 5KU3A 5TBNA 2KFTA 3C6WA 4O78A 4XY8A 4R8PK 2G43A 4KV1A 4YY6A 3RPGC 4P5OB 2Y1NA 3ZTGA 1HYIA 4O71A 5HM0A 2YQMA 1LDJB 5F36A 4GNDA 3HCUA 4MEPA 4HBVA 1WESA 3ZYQA 2NXBA 2K16A 4J3IA 2RO1A 5KTXA 5D3TA 3LJWA 5AMFA 5DYUA 5FFWA 5A5OA 2MD7B 4LADB 4UP0A 5B78A 4MEOA 4PKLA 4J0RA 2F6NA 5DW1A 2C2VS 2KWNA 2DWWA 2OXQC 3UVXA 4IR6A 4QSSA 5EWVA 5TABA 5HQ7A 5E9KA 3MB4A 4Q0OA 5CZGA 1WEEA 4YADA 5C87A 4AKNA 4TU6A 4NR8A 3DWYA 1JOCA 2WP2A 5KTUA 4IC3A 4AP4A 2YHOA 5DLZA 4CUPA 4IOQA 4F3IA 5FE9A 4C66A 2DVSA 4UIZA 2L75A 4WZ2A 4I7CA 4QR3A 5IG6A 4CLBA 1F68A 2L80A 2M6MA 5CQ3A 4NR5A 4ZC9A 2K17A 2Y1MA 3IU6A 2OSSA 3O37A 4UP5A 4QUUA 3KNVA 2DKWA 2ECVA 4XI1A 3MXFA 4TT4A 2VP7A 5F60A 5B79A 2M85A 2YW8A 4WZ3B 4O70A 4A9HA 2QJ0A 5IGLA 3MB3A 5G05B 3NXBA 2OUOA 4UI9B 4BW4A 4LYSA 5AITA 4IR4A 3P1FA 4MENA 4A9KA 3LQHA 5D0CA 5I80A 2FUUA 5D3SA 4MR6A 2YW5A 1X4UA 1XWHA 2ECIA 3L1ZB 4NUCA 3N9PA 4QF3A 3MUKA 5E74A 2RNYA 4BW2A 4XY9A 2LGGA 5D1LB 2PUYA 5FEYA 5HRXA 2F42A 5EI4A 5CUAA 5IBNA 5IGMA 5CGPA 4YH3A 4QSTA 4N3WA 5DBMA 4B86C 5AD3A 5DX4A 4CUSA 2RNXA 3HCSA 3UW9A 5CS8A 2VPEA 4UIYA 5FBXA 4ALGA 3O33A 4HBWA 3P1EA 5CTLA 2YQLA 2VJFB 3MQMA 4PCIA 4TZ8A 2YSMA 2D9EA 4HXMA 4TS8A 4WIVA 4NS5A 1ZBDB 5HFRA 5KHMA 5KTWA 5FB1A 5CQAA 5F1LA 4NRBA 2EGPA 5II2A 4YYNA 3GG3A 5FE3A 5H1UA 2M3HA 2VJFA 5A5SA 4UYFB 4A0CD 4XUBA 5DYAA 2Y43A 3MHHA 3ZPVE 3N9MA 5HELA 5D25A 4TKPB 4XYAA 5LUUA 3RTRB 3JVLA 3LXJA 4CUQA 2GRCA 4KV4A 1WIMA 1Z6UA 2ECNA 4QSXA 2KYUA 2LDRA 4YK0A 3O35A 4A9NA 2YEKA 5HQ6A 3GL6A 4LKAA 5I40A 4UYFA 2VNFA 4HXOA 2YT5A 5TDWA 2YSJA 5TRBA 5LKUA 5G4SA 5ENHA 1Z2QA 2XB1A 3KQIA 1MM2A 2YU4A 4YBTA 5CQ7A 2L85A 3LQJA 3ZVYA 5DW2A 3RCWA 5EISA 1VD4A 2XEUA 5HLSA 3IU5A 4QSRA 5KO4A 5F5ZA 5JWMA 4TT2A 3ONIA 4QSWA 3UV5A 2LGKA 4Z1SA 2RNWA 4YAXA 2MA6A 3ZYUA 4TQNA 5L8UA 5AD2A 3SOUA 5D3JA 4QSPA 4I7BA 4CFKA 5D3RA 4TU4A 5IGKA 5EQ1A 5A85A 5HQ5A 4UIVA 5C4QA 3SOWA 3S92A 2F6JA 3I3JA 4PS5A 5A82A 2PNXA 2CSZA 4LYWA 4IORA 5DFBA 2D8SA 4MR5A 1WUMA 4YABA 5BT4A 3SOXA 5B76A 1K2FA 2CKLB 5EVAA 3KV6A 5E9VA 5LKXA 5DY7A 2VPGA 3DQVR 4BHWA 4S3OB 5DFDA 4LR6A 5BT3A 2E3KA 2G45A 3QZVA 4NRAA 1F62A 2ECWA 1ZS5A 3ASLA 3AQAA 2JMIA 2CKLA 2MA5A 4LYIA 2LXHC 3M99A 2KTBB 4WA6A 3N9LA 2YUCA 2NAAA 5IGNA 5DKCA 4UIWA 3UV2A 1X4JA 5CQ8A
chains in the Genus database with same CATH superfamily
4W4UA 3O34A 4BW3A 4N4FA 4YYGA 5I7YA 3T7LA 5E9YA 2MUMA 2EXUA 4MVTA 5SVIB 4A4BA 4YYKA 3U5NA 1JM7B 4QR5A 2FSAA 1VYXA 3G0JA 4O74A 2JMDA 4QNSA 3HMEA 4ALHA 5BT5A 4L7XA 4C9ZA 5J0DA 4HXLA 5ENBA 2L5EA 3FJUB 4QR4A 2KIZA 2I50A 2LN0A 5EPSA 5EWHA 5SVIA 3HMHA 3P1DA 2MIQA 5E9IA 5CQTA 5CUBA 4QY4A 4J0SA 1JM7A 5A5QA 2ZETC 4A49A 5I86A 4AYCB 3U5MA 4PY6A 3P5OA 4Z6IA 5B77A 5C13A 5FH6A 4OGIA 4YBMA 3U5PA 3JUEA 4C67A 3S91A 4LJNA 3DDTA 4QYDA 2KWKA 3V43A 2ECJA 5EPBA 3Q1DA 5EGUA 3JVKA 4QUTA 4X2IA 2YEMA 2LV9A 2N9GA 3IHPA 4AYCA 3KDEC 4QEVA 3PHDA 2L0BA 5H1TA 2R0SA 2HDPA 2KR4A 5JG6A 2MKEA 4V3LC 4A4CA 4MEQA 5J3XA 2EA6A 2KREA 5A7CA 5L96A 4YYDA 5HCLA 4IR3A 4O7AA 3L11A 3SUBA 2MNZA 2M13A 3EB5A 3H7HA 1WEWA 4A9OA 4BJXA 4CL9A 5FERA 5G4RA 4HXPA 4GPJA 4OGEA 5E0RA 1HYJA 4TT6A 2L5UA 4N4HA 3SHBA 2E61A 1U6GB 5CPEA 2YURA 5FE0A 4A9JA 5A5RA 2YDWA 3O7AA 5H1VA 4NUEA 5F62A 5FB0A 2JRJA 5IIDA 3GV4A 4QC3A 2QICA 5EWCA 5FE5A 5EP7A 3HTKC 2DVRA 5TCMA 5TB6A 1N87A 5A5PA 1WEPA 2IDAA 4YBSA 2CSVA 3SVGA 1WE9A 4YYJA 2VPBA 2OO1A 5D3LA 4XUAA 5ENFA 4LRGA 2QIZA 2CRWA 2K1JA 5DINA 4O77A 4FIPA 1RMDA 4IR5A 3UVDA 5C89A 4NYVA 4A9IA 5FE7A 5LJ0A 1FBVA 3O36A 3ZVZB 1MBMA 5L99A 1FP0A 4UIXA 3DWDA 4LZRA 3FKMX 4NXJA 5HENA 5EWDA 4NR6A 4NRCA 5LJ1A 3U5KA 5ETDA 3SVFA 4NQNA 4ZUXU 4A9MA 5H9MA 2MD8C 3ZPV1 2RS9B 4Z0OA 3ZNIA 2FUIA 5DYCA 5ENGA 2KGIA 5EU1A 4QF2A 5C8GA 2LAUA 4J1PA 4MSXA 4N4IA 4O7BA 2VPDA 4B7YC 5D24A 5COIA 5CQ4A 5EYAF 4NR4A 2YREA 5D26A 4S3OC 2DVVA 5F25A 5LKZA 1T1HA 3LVQE 4UYGA 5FE2A 4AVXA 5HEMA 4FJCA 5LVQA 1WEOA 2DATA 4UYDA 1X0JA 2E7OA 5E9MA 5ENJA 2ECGA 2YQDA 2H0DB 3PLWA 5CP5A 5F61A 5F63A 4ZDTA 4QSUA 5I88A 4WHUA 5I7XA 4BBQA 4UITA 5CUEA 5D3PA 5HFQA 3HCTA 3LRQA 1E4UA 3KV5A 4QB3A 4Q0NA 5D3HA 4KCXA 5HRWA 3MULA 2JUNA 4WZ0A 4QQ4A 4QSVA 3N9OA 1Z60A 5KH3A 2MNYA 3P1CA 5II1A 5C85A 5JI8A 1X4IA 2H0DA 4YY4A 1WGMA 3D1BA 3E2DA 5E3GA 3UVWA 2K4DA 2RFJA 5FE6A 3N9NA 5LVRA 4YC9A 2OWAA 1MM3A 4GB0A 4O7EA 4R2YA 1LDKC 4X3GA 3UV4A 4QC1A 5A83A 1PUOA 3U5OA 3N9QA 1G25A 5LKTA 1WILA 3VK6A 4F52B 4RVRA 3AADA 5FDZA 5E3DA 5AMEA 5K3QA 1DVPA 5CRMA 5FE1A 3RPGB 4YYMA 2L43A 5DKDA 2E7NA 2YHNA 3M62A 5L97A 4Y03A 2EGMA 4NN2A 4TZ2A 2RI7A 2LGLA 5CQ6A 2LGVA 4OGJA 2FD4A 4O72A 4LZSA 5DKHA 5SVYA 4FLPA 5LCWB 4FO9A 4NYXA 4QBMA 2LQ6A 5FG5A 5E73A 5ACYA 5B75A 1JSPB 5C7NA 3JVJA 2D82A 4O7CA 4O75A 5DFCA 5EWWA 5FFYA 3LVRE 4NUDA 5FG4A 3MHSA 3PURA 3HMFA 2FFWA 5TDRA 3Q2FA 4O76A 4UYHA 5EK9A 5I1QA 5K29A 4CA1A 4R7EA 3UVYA 4HXNA 4LK9A 4IC2A 5H85A 4O64A 5HRVA 4Z6HA 2YYNA 4AKIA 4Q6FA 5AIUA 2KWJA 1EQFA 5CU8A 4A9LA 3QZTA 2I8NA 4LZ2A 5CUDA 1CHCA 5I3LA 2DVQA 2MJVB 3SVHA 2I7KA 2L7PA 5FE4A 3DAIA 4WHWA 5D3NA 2YYRA 3DPLR 4GNFA 4TTEA 2M1RA 2H60A 5EV9A 4AUQB 2CSYA 2DSMA 4GNEA 4CUUA 2XOCA 4OUFA 5F2PA 2CRRA 2LSPB 4TYLA 1JM4B 3U5JA 5ENCA 5E7DA 2C2LA 4NR7A 2AN6A 2KGGA 3PUQA 5EM3A 2R0VA 3D1DA 4YH4A 5DLXA 5EA1A 4ZW1A 3C5KA 3EB6A 4V3KC 5CUGA 4CUTA 5B8DA 5FH8A 4A9FA 4DONA 1WUGA 2KE1A 4CFLA 2RSDA 3MDBC 2LXPC 5I29A 4HXSA 4YYHA 3FANA 5F3AA 5CY9A 5D1MB 4YATA 4E96A 5KH7A 4HBYA 5FE8A 2IQJA 3FL2A 1BORA 3O70A 2LRIC 2R10A 3T6RA 2R0YA 3K2JA 4LDFA 5ENEA 5FG6A 4L58A 5L98A 2DX8A 2VJEB 5EICA 4LC2A 5LJ2A 5FH7A 2ECTA 3NG2A 5DKAA 5CUCA 5A81A 3G0LA 4CCGX 3D7CA 4QZSA 5G0FA 4PTBA 2UZGA 4N4GA 5I89A 5L8TA 4O7FA 2G6QA 5D7XA 5F1HA 3TLPA 4Z1QA 2KU3A 4A9EA 3VKGA 5CQ5A 4UYEA 5HJCA 4OGCA 4PPEA 2VJEA 2WP1A 4UIUA 4BW1A 4LLBA 3L1XA 4HBXA 5CFWA 1WFKA 1WEVA 4ZQLA 4H9DA 2BAYA 4YYIA 1V87A 4MR3A 4GNGA 2E6SA 4QEUA 4QSQA 5A5NA 2HYED 2L84A 4NR9A 5I83A 1WEUA 1IYMA 1WEQA 3JVMA 1WENA 2CT2A 2G4AA 4HXRA 5D1KB 4CURA 3M63A 2YELA 5CRZA 5DYXA 4QEWA 3M7KA 4IOOA 5ENIA 2E6RA 4NQMA 3LQIA 2JMJA 5C11A 4HXKA 2EODA 2KKYA 3LDYA 3QZSA 4MR4A 1N72A 5FFVA 1WEMA 2KWOA 5ETBA 4NYWA 5E9LA 4PCEA 4Z93A 1E6IA 1VFYA 3Q2EA 4QYLA 4I7DA 5EPRA 3U5LA 2YVRA 4FK5A 3I2DA 5KH9A 5KU3A 5TBNA 2KFTA 2CONA 3C6WA 4O78A 4XY8A 4R8PK 2G43A 4KV1A 4YY6A 3RPGC 4P5OB 2Y1NA 3ZTGA 3VKHA 1HYIA 4O71A 5HM0A 2YQMA 1LDJB 5F36A 4GNDA 3HCUA 4MEPA 4HBVA 1WESA 3ZYQA 2NXBA 2K16A 4J3IA 2RO1A 5KTXA 2JM3A 5D3TA 2XP0A 3LJWA 5AMFA 5DYUA 5FFWA 5A5OA 2MD7B 4LADB 4UP0A 5B78A 4MEOA 4PKLA 4J0RA 2F6NA 5DW1A 2C2VS 2KWNA 2DWWA 2OXQC 3UVXA 4IR6A 4QSSA 5EWVA 3ERRA 5TABA 5HQ7A 5E9KA 3MB4A 4Q0OA 5CZGA 1WEEA 4YADA 5C87A 4AKNA 4TU6A 4NR8A 4AKHA 3DWYA 1JOCA 2WP2A 5KTUA 4IC3A 4AP4A 2YHOA 5DLZA 4CUPA 4IOQA 4F3IA 5FE9A 4C66A 2DVSA 4UIZA 2L75A 4WZ2A 4I7CA 4QR3A 5IG6A 4CLBA 1F68A 2L80A 2D8UA 2M6MA 5CQ3A 4NR5A 4ZC9A 2K17A 2Y1MA 3IU6A 2OSSA 3O37A 4UP5A 4QUUA 3KNVA 5SVXA 2DKWA 4AI6A 2ECVA 4XI1A 3MXFA 4TT4A 2VP7A 5F60A 5B79A 2M85A 2YW8A 4WZ3B 4O70A 4A9HA 2B0OE 2QJ0A 5IGLA 3MB3A 5G05B 3NXBA 2OUOA 1ZKRA 4UI9B 4BW4A 4LYSA 5AITA 4IR4A 3P1FA 4MENA 4A9KA 3LQHA 5D0CA 5I80A 2FUUA 5D3SA 4MR6A 2YW5A 1X4UA 1XWHA 2ECIA 3L1ZB 4NUCA 3N9PA 4QF3A 3MUKA 5E74A 2RNYA 4BW2A 4XY9A 2LGGA 5D1LB 2EJNA 2PUYA 5FEYA 5HRXA 2F42A 5EI4A 5CUAA 5IBNA 5IGMA 5CGPA 4YH3A 4QSTA 4N3WA 5DBMA 4B86C 5AD3A 5DX4A 4CUSA 2RNXA 3HCSA 3UW9A 4Z0RA 5CS8A 2VPEA 4UIYA 5FBXA 4ALGA 3O33A 4HBWA 3P1EA 5CTLA 2YQLA 2KKXA 4F1PA 2VJFB 3T9KA 3MQMA 4PCIA 4TZ8A 2YSMA 2D9EA 4HXMA 4TS8A 4WIVA 4NS5A 1ZBDB 5HFRA 5KHMA 3O47A 5KTWA 5FB1A 5CQAA 5F1LA 4NRBA 2XOYA 2EGPA 5II2A 2DJAA 4YYNA 3GG3A 5FE3A 5H1UA 2M3HA 2VJFA 5A5SA 4UYFB 4A0CD 4XUBA 5DYAA 2Y43A 3MHHA 3ZPVE 3N9MA 5HELA 2RR4A 5D25A 4TKPB 4XYAA 5LUUA 3RTRB 3JVLA 3LXJA 4CUQA 2GRCA 4KV4A 1WIMA 1Z6UA 2ECNA 4QSXA 2KYUA 2LDRA 4YK0A 3O35A 4A9NA 2YEKA 5HQ6A 3GL6A 4LKAA 5I40A 4UYFA 2VNFA 4HXOA 2YT5A 5TDWA 2YSJA 5TRBA 5LKUA 5G4SA 5ENHA 1Z2QA 2XB1A 3KQIA 1MM2A 2YU4A 4YBTA 5CQ7A 2L85A 3LQJA 1DCQA 3ZVYA 5DW2A 3RCWA 5EISA 1VD4A 2XEUA 5HLSA 3FAOA 3FEHA 3IU5A 4QSRA 5KO4A 5F5ZA 5JWMA 2MT5A 4TT2A 2XOZA 4O62A 3ONIA 4QSWA 3UV5A 2LGKA 4Z1SA 2RNWA 4YAXA 2MA6A 3ZYUA 4TQNA 5L8UA 5AD2A 3SOUA 5D3JA 4QSPA 4I7BA 4CFKA 5D3RA 4TU4A 5IGKA 5EQ1A 5A85A 5HQ5A 4UIVA 5C4QA 5G04B 3SOWA 3S92A 2F6JA 3I3JA 4PS5A 5A82A 4AKGA 2PNXA 2CSZA 4LYWA 4IORA 5DFBA 2D8SA 4MR5A 3FM8C 1WUMA 4YABA 5BT4A 3SOXA 5B76A 1K2FA 2CKLB 5EVAA 3KV6A 5E9VA 2P57A 5LKXA 5DY7A 2VPGA 3DQVR 4BHWA 4S3OB 5DFDA 4LR6A 5BT3A 2E3KA 2G45A 3QZVA 4NRAA 1F62A 2ECWA 1ZS5A 3ASLA 3AQAA 2JMIA 3LJUX 2CKLA 2MA5A 4LYIA 2LXHC 3M99A 2KTBB 4WA6A 3N9LA 2YUCA 2NAAA 5IGNA 5DKCA 4UIWA 3UV2A 1X4JA 5CQ8A
chains in the Genus database with same CATH topology
4W4UA 3O34A 4BW3A 4N4FA 4YYGA 5I7YA 3T7LA 5E9YA 2MUMA 4A4BA 4MVTA 4YYKA 3U5NA 1JM7B 4QR5A 2FSAA 1VYXA 3G0JA 4O74A 2JMDA 4QNSA 3HMEA 4ALHA 5BT5A 4L7XA 4C9ZA 5J0DA 4HXLA 5ENBA 2L5EA 4QR4A 2KIZA 2I50A 2LN0A 5EPSA 5EWHA 3HMHA 3P1DA 2MIQA 5E9IA 5CQTA 5CUBA 4QY4A 4J0SA 1JM7A 5A5QA 2ZETC 4A49A 5I86A 4AYCB 3U5MA 4PY6A 3P5OA 4Z6IA 5B77A 5C13A 5FH6A 4OGIA 4YBMA 3U5PA 4LJNA 4C67A 3S91A 4QYDA 2KWKA 3V43A 2ECJA 5EPBA 5EGUA 3JVKA 4QUTA 4X2IA 2YEMA 2LV9A 2N9GA 3IHPA 4AYCA 4QEVA 3PHDA 2L0BA 5H1TA 2R0SA 2HDPA 2KR4A 5JG6A 4V3LC 4A4CA 4MEQA 5J3XA 2EA6A 2KREA 5A7CA 5L96A 4YYDA 5HCLA 4IR3A 4O7AA 3L11A 2MNZA 3EB5A 1WEWA 4A9OA 4BJXA 4CL9A 5FERA 5G4RA 4HXPA 4GPJA 5E0RA 1HYJA 4TT6A 2L5UA 4N4HA 3SHBA 1U6GB 5CPEA 2YURA 5FE0A 4A9JA 5A5RA 2YDWA 3O7AA 5H1VA 4NUEA 5F62A 5FB0A 2JRJA 5IIDA 3GV4A 4QC3A 2QICA 5EWCA 5FE5A 5EP7A 3HTKC 2DVRA 5TCMA 5TB6A 1N87A 5A5PA 1WEPA 2IDAA 4YBSA 3SVGA 1WE9A 4YYJA 2VPBA 2OO1A 5D3LA 4XUAA 5ENFA 4LRGA 2QIZA 2K1JA 5DINA 4O77A 4FIPA 1RMDA 4IR5A 3UVDA 5C89A 4NYVA 4A9IA 5FE7A 5LJ0A 1FBVA 3O36A 3ZVZB 5L99A 1FP0A 4UIXA 4LZRA 3FKMX 4NXJA 5HENA 5EWDA 4NR6A 4NRCA 5LJ1A 3U5KA 5ETDA 3SVFA 4NQNA 4ZUXU 4A9MA 5H9MA 2MD8C 3ZPV1 2RS9B 3ZNIA 2FUIA 5DYCA 5ENGA 2KGIA 5EU1A 4QF2A 5C8GA 4MSXA 4J1PA 4N4IA 4O7BA 2VPDA 4B7YC 5D24A 5COIA 5CQ4A 5EYAF 4NR4A 2YREA 5D26A 4S3OC 2DVVA 5F25A 5LKZA 1T1HA 4UYGA 5FE2A 4AVXA 5HEMA 4FJCA 5LVQA 1WEOA 2DATA 4UYDA 1X0JA 2E7OA 5E9MA 5ENJA 2ECGA 2YQDA 2H0DB 5CP5A 5F61A 5F63A 4ZDTA 4QSUA 5I88A 4WHUA 5I7XA 4BBQA 4UITA 5CUEA 5D3PA 5HFQA 3HCTA 3LRQA 1E4UA 3KV5A 4QB3A 4Q0NA 5D3HA 4KCXA 5HRWA 3MULA 4WZ0A 4QSVA 3N9OA 1Z60A 5KH3A 2MNYA 3P1CA 5II1A 5C85A 5JI8A 1X4IA 2H0DA 4YY4A 1WGMA 5E3GA 3UVWA 2K4DA 2RFJA 5FE6A 3N9NA 5LVRA 4YC9A 4GB0A 1MM3A 4O7EA 4R2YA 1LDKC 4X3GA 3UV4A 4QC1A 5A83A 3U5OA 3N9QA 1G25A 5LKTA 1WILA 3VK6A 4F52B 4RVRA 3AADA 5FDZA 5E3DA 5AMEA 1DVPA 5CRMA 5FE1A 3RPGB 4YYMA 2L43A 5DKDA 2E7NA 2YHNA 3M62A 5L97A 4Y03A 4NN2A 4TZ2A 2RI7A 2LGLA 5CQ6A 2LGVA 4OGJA 4O72A 4LZSA 5DKHA 4FLPA 5LCWB 4FO9A 4NYXA 4QBMA 2LQ6A 5FG5A 5E73A 5ACYA 5B75A 1JSPB 5C7NA 3JVJA 2D82A 4O7CA 4O75A 5DFCA 5EWWA 5FFYA 4NUDA 5FG4A 3MHSA 3PURA 3HMFA 5TDRA 3Q2FA 4O76A 4UYHA 5EK9A 5I1QA 5K29A 4CA1A 4R7EA 3UVYA 4HXNA 4LK9A 4IC2A 5H85A 4O64A 5HRVA 4Z6HA 2YYNA 4Q6FA 5AIUA 2KWJA 1EQFA 5CU8A 4A9LA 3QZTA 2I8NA 4LZ2A 5CUDA 1CHCA 5I3LA 2DVQA 2MJVB 3SVHA 2I7KA 5FE4A 3DAIA 4WHWA 5D3NA 2YYRA 3DPLR 4GNFA 4TTEA 2M1RA 2H60A 5EV9A 4AUQB 2CSYA 4GNEA 4CUUA 4OUFA 5F2PA 2LSPB 4TYLA 1JM4B 3U5JA 5ENCA 5E7DA 2C2LA 4NR7A 2AN6A 2KGGA 3PUQA 5EM3A 2R0VA 4YH4A 5DLXA 5EA1A 4ZW1A 3EB6A 3C5KA 4V3KC 5G04B 5CUGA 4CUTA 5B8DA 5FH8A 4A9FA 4DONA 1WUGA 2KE1A 4CFLA 2RSDA 2LXPC 5I29A 4HXSA 4YYHA 5F3AA 5CY9A 5D1MB 4YATA 4E96A 5KH7A 4HBYA 5FE8A 3FL2A 1BORA 3O70A 2LRIC 2R10A 3T6RA 2R0YA 3K2JA 4LDFA 5ENEA 5FG6A 4L58A 5L98A 2DX8A 2VJEB 5EICA 4LC2A 5LJ2A 5FH7A 2ECTA 3NG2A 5DKAA 5CUCA 5A81A 3G0LA 4CCGX 3D7CA 4QZSA 5G0FA 4PTBA 2UZGA 4N4GA 5I89A 5L8TA 4O7FA 2G6QA 5D7XA 5F1HA 3TLPA 4Z1QA 2KU3A 4A9EA 2MT5A 5CQ5A 4UYEA 5HJCA 4PPEA 2VJEA 2WP1A 4UIUA 4BW1A 4LLBA 3L1XA 4HBXA 5CFWA 1WFKA 1WEVA 4ZQLA 2BAYA 4YYIA 1V87A 4MR3A 4GNGA 2E6SA 4QEUA 4QSQA 5A5NA 2HYED 2L84A 4NR9A 5I83A 1WEUA 1IYMA 1WEQA 3JVMA 1WENA 2CT2A 2G4AA 4HXRA 5D1KB 4CURA 3M63A 2YELA 5CRZA 5DYXA 4QEWA 4IOOA 5ENIA 2E6RA 4NQMA 3LQIA 2JMJA 5C11A 4HXKA 2EODA 3QZSA 4MR4A 1N72A 5FFVA 1WEMA 2KWOA 5ETBA 4NYWA 5E9LA 4PCEA 4Z93A 1E6IA 1VFYA 3Q2EA 4QYLA 4I7DA 5EPRA 3U5LA 4FK5A 3I2DA 5KH9A 5KU3A 5TBNA 2KFTA 3C6WA 4O78A 4XY8A 4R8PK 2G43A 4KV1A 4YY6A 3RPGC 4P5OB 2Y1NA 3ZTGA 1HYIA 4O71A 5HM0A 2YQMA 1LDJB 5F36A 4GNDA 3HCUA 4MEPA 4HBVA 1WESA 3ZYQA 2NXBA 2K16A 4J3IA 2RO1A 5KTXA 5D3TA 3LJWA 5AMFA 5DYUA 5FFWA 5A5OA 2MD7B 4LADB 4UP0A 5B78A 4MEOA 4PKLA 4J0RA 2F6NA 5DW1A 2C2VS 2KWNA 2DWWA 2OXQC 3UVXA 4IR6A 4QSSA 5EWVA 5TABA 5HQ7A 5E9KA 3MB4A 4Q0OA 5CZGA 1WEEA 4YADA 5C87A 4AKNA 4TU6A 4NR8A 3DWYA 1JOCA 2WP2A 5KTUA 4IC3A 4AP4A 2YHOA 5DLZA 4CUPA 4IOQA 4F3IA 5FE9A 4C66A 2DVSA 4UIZA 2L75A 4WZ2A 4I7CA 4QR3A 5IG6A 4CLBA 1F68A 2L80A 2M6MA 5CQ3A 4NR5A 4ZC9A 2K17A 2Y1MA 3IU6A 2OSSA 3O37A 4UP5A 4QUUA 3KNVA 2DKWA 2ECVA 4XI1A 3MXFA 4TT4A 2VP7A 5F60A 5B79A 2M85A 2YW8A 4WZ3B 4O70A 4A9HA 2QJ0A 5IGLA 3MB3A 5G05B 3NXBA 2OUOA 4UI9B 4BW4A 4LYSA 5AITA 4IR4A 3P1FA 4MENA 4A9KA 3LQHA 5D0CA 5I80A 2FUUA 5D3SA 4MR6A 2YW5A 1X4UA 1XWHA 2ECIA 3L1ZB 4NUCA 3N9PA 4QF3A 3MUKA 5E74A 2RNYA 4BW2A 4XY9A 2LGGA 5D1LB 2PUYA 5FEYA 5HRXA 2F42A 5EI4A 5CUAA 5IBNA 5IGMA 5CGPA 4YH3A 4QSTA 4N3WA 5DBMA 4B86C 5AD3A 5DX4A 4CUSA 2RNXA 3HCSA 3UW9A 5CS8A 2VPEA 4UIYA 5FBXA 4ALGA 3O33A 4HBWA 3P1EA 5CTLA 2YQLA 2VJFB 3MQMA 4PCIA 4TZ8A 2YSMA 2D9EA 4HXMA 4TS8A 4WIVA 4NS5A 1ZBDB 5HFRA 5KHMA 5KTWA 5FB1A 5CQAA 5F1LA 4NRBA 2EGPA 5II2A 4YYNA 3GG3A 5FE3A 5H1UA 2M3HA 2VJFA 5A5SA 4UYFB 4A0CD 4XUBA 5DYAA 2Y43A 3MHHA 3ZPVE 3N9MA 5HELA 5D25A 4TKPB 4XYAA 5LUUA 3RTRB 3JVLA 3LXJA 4CUQA 2GRCA 4KV4A 1WIMA 1Z6UA 2ECNA 4QSXA 2KYUA 2LDRA 4YK0A 3O35A 4A9NA 2YEKA 5HQ6A 3GL6A 4LKAA 5I40A 4UYFA 2VNFA 4HXOA 2YT5A 5TDWA 2YSJA 5TRBA 5LKUA 5G4SA 5ENHA 1Z2QA 2XB1A 3KQIA 1MM2A 2YU4A 4YBTA 5CQ7A 2L85A 3LQJA 3ZVYA 5DW2A 3RCWA 5EISA 1VD4A 2XEUA 5HLSA 3IU5A 4QSRA 5KO4A 5F5ZA 5JWMA 4TT2A 3ONIA 4QSWA 3UV5A 2LGKA 4Z1SA 2RNWA 4YAXA 2MA6A 3ZYUA 4TQNA 5L8UA 5AD2A 3SOUA 5D3JA 4QSPA 4I7BA 4CFKA 5D3RA 4TU4A 5IGKA 5EQ1A 5A85A 5HQ5A 4UIVA 5C4QA 3SOWA 3S92A 2F6JA 3I3JA 4PS5A 5A82A 2PNXA 2CSZA 4LYWA 4IORA 5DFBA 2D8SA 4MR5A 1WUMA 4YABA 5BT4A 3SOXA 5B76A 1K2FA 2CKLB 5EVAA 3KV6A 5E9VA 5LKXA 5DY7A 2VPGA 3DQVR 4BHWA 4S3OB 5DFDA 4LR6A 5BT3A 2E3KA 2G45A 3QZVA 4NRAA 1F62A 2ECWA 1ZS5A 3ASLA 3AQAA 2JMIA 2CKLA 2MA5A 4LYIA 2LXHC 3M99A 2KTBB 4WA6A 3N9LA 2YUCA 2NAAA 5IGNA 5DKCA 4UIWA 3UV2A 1X4JA 5CQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4U A;  3O34 A;  4BW3 A;  4N4F A;  4YYG A;  5I7Y A;  3T7L A;  5E9Y A;  2MUM A;  4A4B A;  4MVT A;  4YYK A;  3U5N A;  1JM7 B;  4QR5 A;  2FSA A;  1VYX A;  3G0J A;  4O74 A;  2JMD A;  4QNS A;  3HME A;  4ALH A;  5BT5 A;  4L7X A;  4C9Z A;  5J0D A;  4HXL A;  5ENB A;  2L5E A;  4QR4 A;  2KIZ A;  2I50 A;  2LN0 A;  5EPS A;  5EWH A;  3HMH A;  3P1D A;  2MIQ A;  5E9I A;  5CQT A;  5CUB A;  4QY4 A;  4J0S A;  1JM7 A;  5A5Q A;  2ZET C;  4A49 A;  5I86 A;  4AYC B;  3U5M A;  4PY6 A;  3P5O A;  4Z6I A;  5B77 A;  5C13 A;  5FH6 A;  4OGI A;  4YBM A;  3U5P A;  4LJN A;  4C67 A;  3S91 A;  4QYD A;  2KWK A;  3V43 A;  2ECJ A;  5EPB A;  5EGU A;  3JVK A;  4QUT A;  4X2I A;  2YEM A;  2LV9 A;  2N9G A;  3IHP A;  4AYC A;  4QEV A;  3PHD A;  2L0B A;  5H1T A;  2R0S A;  2HDP A;  2KR4 A;  5JG6 A;  4V3L C;  4A4C A;  4MEQ A;  5J3X A;  2EA6 A;  2KRE A;  5A7C A;  5L96 A;  4YYD A;  5HCL A;  4IR3 A;  4O7A A;  3L11 A;  2MNZ A;  3EB5 A;  1WEW A;  4A9O A;  4BJX A;  4CL9 A;  5FER A;  5G4R A;  4HXP A;  4GPJ A;  5E0R A;  1HYJ A;  4TT6 A;  2L5U A;  4N4H A;  3SHB A;  1U6G B;  5CPE A;  2YUR A;  5FE0 A;  4A9J A;  5A5R A;  2YDW A;  3O7A A;  5H1V A;  4NUE A;  5F62 A;  5FB0 A;  2JRJ A;  5IID A;  3GV4 A;  4QC3 A;  2QIC A;  5EWC A;  5FE5 A;  5EP7 A;  3HTK C;  2DVR A;  5TCM A;  5TB6 A;  1N87 A;  5A5P A;  1WEP A;  2IDA A;  4YBS A;  3SVG A;  1WE9 A;  4YYJ A;  2VPB A;  2OO1 A;  5D3L A;  4XUA A;  5ENF A;  4LRG A;  2QIZ A;  2K1J A;  5DIN A;  4O77 A;  4FIP A;  1RMD A;  4IR5 A;  3UVD A;  5C89 A;  4NYV A;  4A9I A;  5FE7 A;  5LJ0 A;  1FBV A;  3O36 A;  3ZVZ B;  5L99 A;  1FP0 A;  4UIX A;  4LZR A;  3FKM X;  4NXJ A;  5HEN A;  5EWD A;  4NR6 A;  4NRC A;  5LJ1 A;  3U5K A;  5ETD A;  3SVF A;  4NQN A;  4ZUX U;  4A9M A;  5H9M A;  2MD8 C;  3ZPV 1;  2RS9 B;  3ZNI A;  2FUI A;  5DYC A;  5ENG A;  2KGI A;  5EU1 A;  4QF2 A;  5C8G A;  4MSX A;  4J1P A;  4N4I A;  4O7B A;  2VPD A;  4B7Y C;  5D24 A;  5COI A;  5CQ4 A;  5EYA F;  4NR4 A;  2YRE A;  5D26 A;  4S3O C;  2DVV A;  5F25 A;  5LKZ A;  1T1H A;  4UYG A;  5FE2 A;  4AVX A;  5HEM A;  4FJC A;  5LVQ A;  1WEO A;  2DAT A;  4UYD A;  1X0J A;  2E7O A;  5E9M A;  5ENJ A;  2ECG A;  2YQD A;  2H0D B;  5CP5 A;  5F61 A;  5F63 A;  4ZDT A;  4QSU A;  5I88 A;  4WHU A;  5I7X A;  4BBQ A;  4UIT A;  5CUE A;  5D3P A;  5HFQ A;  3HCT A;  3LRQ A;  1E4U A;  3KV5 A;  4QB3 A;  4Q0N A;  5D3H A;  4KCX A;  5HRW A;  3MUL A;  4WZ0 A;  4QSV A;  3N9O A;  1Z60 A;  5KH3 A;  2MNY A;  3P1C A;  5II1 A;  5C85 A;  5JI8 A;  1X4I A;  2H0D A;  4YY4 A;  1WGM A;  5E3G A;  3UVW A;  2K4D A;  2RFJ A;  5FE6 A;  3N9N A;  5LVR A;  4YC9 A;  4GB0 A;  1MM3 A;  4O7E A;  4R2Y A;  1LDK C;  4X3G A;  3UV4 A;  4QC1 A;  5A83 A;  3U5O A;  3N9Q A;  1G25 A;  5LKT A;  1WIL A;  3VK6 A;  4F52 B;  4RVR A;  3AAD A;  5FDZ A;  5E3D A;  5AME A;  1DVP A;  5CRM A;  5FE1 A;  3RPG B;  4YYM A;  2L43 A;  5DKD A;  2E7N A;  2YHN A;  3M62 A;  5L97 A;  4Y03 A;  4NN2 A;  4TZ2 A;  2RI7 A;  2LGL A;  5CQ6 A;  2LGV A;  4OGJ A;  4O72 A;  4LZS A;  5DKH A;  4FLP A;  5LCW B;  4FO9 A;  4NYX A;  4QBM A;  2LQ6 A;  5FG5 A;  5E73 A;  5ACY A;  5B75 A;  1JSP B;  5C7N A;  3JVJ A;  2D82 A;  4O7C A;  4O75 A;  5DFC A;  5EWW A;  5FFY A;  4NUD A;  5FG4 A;  3MHS A;  3PUR A;  3HMF A;  5TDR A;  3Q2F A;  4O76 A;  4UYH A;  5EK9 A;  5I1Q A;  5K29 A;  4CA1 A;  4R7E A;  3UVY A;  4HXN A;  4LK9 A;  4IC2 A;  5H85 A;  4O64 A;  5HRV A;  4Z6H A;  2YYN A;  4Q6F A;  5AIU A;  2KWJ A;  1EQF A;  5CU8 A;  4A9L A;  3QZT A;  2I8N A;  4LZ2 A;  5CUD A;  1CHC A;  5I3L A;  2DVQ A;  2MJV B;  3SVH A;  2I7K A;  5FE4 A;  3DAI A;  4WHW A;  5D3N A;  2YYR A;  3DPL R;  4GNF A;  4TTE A;  2M1R A;  2H60 A;  5EV9 A;  4AUQ B;  2CSY A;  4GNE A;  4CUU A;  4OUF A;  5F2P A;  2LSP B;  4TYL A;  1JM4 B;  3U5J A;  5ENC A;  5E7D A;  2C2L A;  4NR7 A;  2AN6 A;  2KGG A;  3PUQ A;  5EM3 A;  2R0V A;  4YH4 A;  5DLX A;  5EA1 A;  4ZW1 A;  3EB6 A;  3C5K A;  4V3K C;  5G04 B;  5CUG A;  4CUT A;  5B8D A;  5FH8 A;  4A9F A;  4DON A;  1WUG A;  2KE1 A;  4CFL A;  2RSD A;  2LXP C;  5I29 A;  4HXS A;  4YYH A;  5F3A A;  5CY9 A;  5D1M B;  4YAT A;  4E96 A;  5KH7 A;  4HBY A;  5FE8 A;  3FL2 A;  1BOR A;  3O70 A;  2LRI C;  2R10 A;  3T6R A;  2R0Y A;  3K2J A;  4LDF A;  5ENE A;  5FG6 A;  4L58 A;  5L98 A;  2DX8 A;  2VJE B;  5EIC A;  4LC2 A;  5LJ2 A;  5FH7 A;  2ECT A;  3NG2 A;  5DKA A;  5CUC A;  5A81 A;  3G0L A;  4CCG X;  3D7C A;  4QZS A;  5G0F A;  4PTB A;  2UZG A;  4N4G A;  5I89 A;  5L8T A;  4O7F A;  2G6Q A;  5D7X A;  5F1H A;  3TLP A;  4Z1Q A;  2KU3 A;  4A9E A;  2MT5 A;  5CQ5 A;  4UYE A;  5HJC A;  4PPE A;  2VJE A;  2WP1 A;  4UIU A;  4BW1 A;  4LLB A;  3L1X A;  4HBX A;  5CFW A;  1WFK A;  1WEV A;  4ZQL A;  2BAY A;  4YYI A;  1V87 A;  4MR3 A;  4GNG A;  2E6S A;  4QEU A;  4QSQ A;  5A5N A;  2HYE D;  2L84 A;  4NR9 A;  5I83 A;  1WEU A;  1IYM A;  1WEQ A;  3JVM A;  1WEN A;  2CT2 A;  2G4A A;  4HXR A;  5D1K B;  4CUR A;  3M63 A;  2YEL A;  5CRZ A;  5DYX A;  4QEW A;  4IOO A;  5ENI A;  2E6R A;  4NQM A;  3LQI A;  2JMJ A;  5C11 A;  4HXK A;  2EOD A;  3QZS A;  4MR4 A;  1N72 A;  5FFV A;  1WEM A;  2KWO A;  5ETB A;  4NYW A;  5E9L A;  4PCE A;  4Z93 A;  1E6I A;  1VFY A;  3Q2E A;  4QYL A;  4I7D A;  5EPR A;  3U5L A;  4FK5 A;  3I2D A;  5KH9 A;  5KU3 A;  5TBN A;  2KFT A;  3C6W A;  4O78 A;  4XY8 A;  4R8P K;  2G43 A;  4KV1 A;  4YY6 A;  3RPG C;  4P5O B;  2Y1N A;  3ZTG A;  1HYI A;  4O71 A;  5HM0 A;  2YQM A;  1LDJ B;  5F36 A;  4GND A;  3HCU A;  4MEP A;  4HBV A;  1WES A;  3ZYQ A;  2NXB A;  2K16 A;  4J3I A;  2RO1 A;  5KTX A;  5D3T A;  3LJW A;  5AMF A;  5DYU A;  5FFW A;  5A5O A;  2MD7 B;  4LAD B;  4UP0 A;  5B78 A;  4MEO A;  4PKL A;  4J0R A;  2F6N A;  5DW1 A;  2C2V S;  2KWN A;  2DWW A;  2OXQ C;  3UVX A;  4IR6 A;  4QSS A;  5EWV A;  5TAB A;  5HQ7 A;  5E9K A;  3MB4 A;  4Q0O A;  5CZG A;  1WEE A;  4YAD A;  5C87 A;  4AKN A;  4TU6 A;  4NR8 A;  3DWY A;  1JOC A;  2WP2 A;  5KTU A;  4IC3 A;  4AP4 A;  2YHO A;  5DLZ A;  4CUP A;  4IOQ A;  4F3I A;  5FE9 A;  4C66 A;  2DVS A;  4UIZ A;  2L75 A;  4WZ2 A;  4I7C A;  4QR3 A;  5IG6 A;  4CLB A;  1F68 A;  2L80 A;  2M6M A;  5CQ3 A;  4NR5 A;  4ZC9 A;  2K17 A;  2Y1M A;  3IU6 A;  2OSS A;  3O37 A;  4UP5 A;  4QUU A;  3KNV A;  2DKW A;  2ECV A;  4XI1 A;  3MXF A;  4TT4 A;  2VP7 A;  5F60 A;  5B79 A;  2M85 A;  2YW8 A;  4WZ3 B;  4O70 A;  4A9H A;  2QJ0 A;  5IGL A;  3MB3 A;  5G05 B;  3NXB A;  2OUO A;  4UI9 B;  4BW4 A;  4LYS A;  5AIT A;  4IR4 A;  3P1F A;  4MEN A;  4A9K A;  3LQH A;  5D0C A;  5I80 A;  2FUU A;  5D3S A;  4MR6 A;  2YW5 A;  1X4U A;  1XWH A;  2ECI A;  3L1Z B;  4NUC A;  3N9P A;  4QF3 A;  3MUK A;  5E74 A;  2RNY A;  4BW2 A;  4XY9 A;  2LGG A;  5D1L B;  2PUY A;  5FEY A;  5HRX A;  2F42 A;  5EI4 A;  5CUA A;  5IBN A;  5IGM A;  5CGP A;  4YH3 A;  4QST A;  4N3W A;  5DBM A;  4B86 C;  5AD3 A;  5DX4 A;  4CUS A;  2RNX A;  3HCS A;  3UW9 A;  5CS8 A;  2VPE A;  4UIY A;  5FBX A;  4ALG A;  3O33 A;  4HBW A;  3P1E A;  5CTL A;  2YQL A;  2VJF B;  3MQM A;  4PCI A;  4TZ8 A;  2YSM A;  2D9E A;  4HXM A;  4TS8 A;  4WIV A;  4NS5 A;  1ZBD B;  5HFR A;  5KHM A;  5KTW A;  5FB1 A;  5CQA A;  5F1L A;  4NRB A;  2EGP A;  5II2 A;  4YYN A;  3GG3 A;  5FE3 A;  5H1U A;  2M3H A;  2VJF A;  5A5S A;  4UYF B;  4A0C D;  4XUB A;  5DYA A;  2Y43 A;  3MHH A;  3ZPV E;  3N9M A;  5HEL A;  5D25 A;  4TKP B;  4XYA A;  5LUU A;  3RTR B;  3JVL A;  3LXJ A;  4CUQ A;  2GRC A;  4KV4 A;  1WIM A;  1Z6U A;  2ECN A;  4QSX A;  2KYU A;  2LDR A;  4YK0 A;  3O35 A;  4A9N A;  2YEK A;  5HQ6 A;  3GL6 A;  4LKA A;  5I40 A;  4UYF A;  2VNF A;  4HXO A;  2YT5 A;  5TDW A;  2YSJ A;  5TRB A;  5LKU A;  5G4S A;  5ENH A;  1Z2Q A;  2XB1 A;  3KQI A;  1MM2 A;  2YU4 A;  4YBT A;  5CQ7 A;  2L85 A;  3LQJ A;  3ZVY A;  5DW2 A;  3RCW A;  5EIS A;  1VD4 A;  2XEU A;  5HLS A;  3IU5 A;  4QSR A;  5KO4 A;  5F5Z A;  5JWM A;  4TT2 A;  3ONI A;  4QSW A;  3UV5 A;  2LGK A;  4Z1S A;  2RNW A;  4YAX A;  2MA6 A;  3ZYU A;  4TQN A;  5L8U A;  5AD2 A;  3SOU A;  5D3J A;  4QSP A;  4I7B A;  4CFK A;  5D3R A;  4TU4 A;  5IGK A;  5EQ1 A;  5A85 A;  5HQ5 A;  4UIV A;  5C4Q A;  3SOW A;  3S92 A;  2F6J A;  3I3J A;  4PS5 A;  5A82 A;  2PNX A;  2CSZ A;  4LYW A;  4IOR A;  5DFB A;  2D8S A;  4MR5 A;  1WUM A;  4YAB A;  5BT4 A;  3SOX A;  5B76 A;  1K2F A;  2CKL B;  5EVA A;  3KV6 A;  5E9V A;  5LKX A;  5DY7 A;  2VPG A;  3DQV R;  4BHW A;  4S3O B;  5DFD A;  4LR6 A;  5BT3 A;  2E3K A;  2G45 A;  3QZV A;  4NRA A;  1F62 A;  2ECW A;  1ZS5 A;  3ASL A;  3AQA A;  2JMI A;  2CKL A;  2MA5 A;  4LYI A;  2LXH C;  3M99 A;  2KTB B;  4WA6 A;  3N9L A;  2YUC A;  2NAA A;  5IGN A;  5DKC A;  4UIW A;  3UV2 A;  1X4J A;  5CQ8 A; 
#chains in the Genus database with same CATH topology
 4W4U A;  3O34 A;  4BW3 A;  4N4F A;  4YYG A;  5I7Y A;  3T7L A;  5E9Y A;  2MUM A;  2EXU A;  4MVT A;  5SVI B;  4A4B A;  4YYK A;  3U5N A;  1JM7 B;  4QR5 A;  2FSA A;  1VYX A;  3G0J A;  4O74 A;  2JMD A;  4QNS A;  3HME A;  4ALH A;  5BT5 A;  4L7X A;  4C9Z A;  5J0D A;  4HXL A;  5ENB A;  2L5E A;  3FJU B;  4QR4 A;  2KIZ A;  2I50 A;  2LN0 A;  5EPS A;  5EWH A;  5SVI A;  3HMH A;  3P1D A;  2MIQ A;  5E9I A;  5CQT A;  5CUB A;  4QY4 A;  4J0S A;  1JM7 A;  5A5Q A;  2ZET C;  4A49 A;  5I86 A;  4AYC B;  3U5M A;  4PY6 A;  3P5O A;  4Z6I A;  5B77 A;  5C13 A;  5FH6 A;  4OGI A;  4YBM A;  3U5P A;  3JUE A;  4C67 A;  3S91 A;  4LJN A;  3DDT A;  4QYD A;  2KWK A;  3V43 A;  2ECJ A;  5EPB A;  3Q1D A;  5EGU A;  3JVK A;  4QUT A;  4X2I A;  2YEM A;  2LV9 A;  2N9G A;  3IHP A;  4AYC A;  3KDE C;  4QEV A;  3PHD A;  2L0B A;  5H1T A;  2R0S A;  2HDP A;  2KR4 A;  5JG6 A;  2MKE A;  4V3L C;  4A4C A;  4MEQ A;  5J3X A;  2EA6 A;  2KRE A;  5A7C A;  5L96 A;  4YYD A;  5HCL A;  4IR3 A;  4O7A A;  3L11 A;  3SUB A;  2MNZ A;  2M13 A;  3EB5 A;  3H7H A;  1WEW A;  4A9O A;  4BJX A;  4CL9 A;  5FER A;  5G4R A;  4HXP A;  4GPJ A;  4OGE A;  5E0R A;  1HYJ A;  4TT6 A;  2L5U A;  4N4H A;  3SHB A;  2E61 A;  1U6G B;  5CPE A;  2YUR A;  5FE0 A;  4A9J A;  5A5R A;  2YDW A;  3O7A A;  5H1V A;  4NUE A;  5F62 A;  5FB0 A;  2JRJ A;  5IID A;  3GV4 A;  4QC3 A;  2QIC A;  5EWC A;  5FE5 A;  5EP7 A;  3HTK C;  2DVR A;  5TCM A;  5TB6 A;  1N87 A;  5A5P A;  1WEP A;  2IDA A;  4YBS A;  2CSV A;  3SVG A;  1WE9 A;  4YYJ A;  2VPB A;  2OO1 A;  5D3L A;  4XUA A;  5ENF A;  4LRG A;  2QIZ A;  2CRW A;  2K1J A;  5DIN A;  4O77 A;  4FIP A;  1RMD A;  4IR5 A;  3UVD A;  5C89 A;  4NYV A;  4A9I A;  5FE7 A;  5LJ0 A;  1FBV A;  3O36 A;  3ZVZ B;  1MBM A;  5L99 A;  1FP0 A;  4UIX A;  3DWD A;  4LZR A;  3FKM X;  4NXJ A;  5HEN A;  5EWD A;  4NR6 A;  4NRC A;  5LJ1 A;  3U5K A;  5ETD A;  3SVF A;  4NQN A;  4ZUX U;  4A9M A;  5H9M A;  2MD8 C;  3ZPV 1;  2RS9 B;  4Z0O A;  3ZNI A;  2FUI A;  5DYC A;  5ENG A;  2KGI A;  5EU1 A;  4QF2 A;  5C8G A;  2LAU A;  4J1P A;  4MSX A;  4N4I A;  4O7B A;  2VPD A;  4B7Y C;  5D24 A;  5COI A;  5CQ4 A;  5EYA F;  4NR4 A;  2YRE A;  5D26 A;  4S3O C;  2DVV A;  5F25 A;  5LKZ A;  1T1H A;  3LVQ E;  4UYG A;  5FE2 A;  4AVX A;  5HEM A;  4FJC A;  5LVQ A;  1WEO A;  2DAT A;  4UYD A;  1X0J A;  2E7O A;  5E9M A;  5ENJ A;  2ECG A;  2YQD A;  2H0D B;  3PLW A;  5CP5 A;  5F61 A;  5F63 A;  4ZDT A;  4QSU A;  5I88 A;  4WHU A;  5I7X A;  4BBQ A;  4UIT A;  5CUE A;  5D3P A;  5HFQ A;  3HCT A;  3LRQ A;  1E4U A;  3KV5 A;  4QB3 A;  4Q0N A;  5D3H A;  4KCX A;  5HRW A;  3MUL A;  2JUN A;  4WZ0 A;  4QQ4 A;  4QSV A;  3N9O A;  1Z60 A;  5KH3 A;  2MNY A;  3P1C A;  5II1 A;  5C85 A;  5JI8 A;  1X4I A;  2H0D A;  4YY4 A;  1WGM A;  3D1B A;  3E2D A;  5E3G A;  3UVW A;  2K4D A;  2RFJ A;  5FE6 A;  3N9N A;  5LVR A;  4YC9 A;  2OWA A;  1MM3 A;  4GB0 A;  4O7E A;  4R2Y A;  1LDK C;  4X3G A;  3UV4 A;  4QC1 A;  5A83 A;  1PUO A;  3U5O A;  3N9Q A;  1G25 A;  5LKT A;  1WIL A;  3VK6 A;  4F52 B;  4RVR A;  3AAD A;  5FDZ A;  5E3D A;  5AME A;  5K3Q A;  1DVP A;  5CRM A;  5FE1 A;  3RPG B;  4YYM A;  2L43 A;  5DKD A;  2E7N A;  2YHN A;  3M62 A;  5L97 A;  4Y03 A;  2EGM A;  4NN2 A;  4TZ2 A;  2RI7 A;  2LGL A;  5CQ6 A;  2LGV A;  4OGJ A;  2FD4 A;  4O72 A;  4LZS A;  5DKH A;  5SVY A;  4FLP A;  5LCW B;  4FO9 A;  4NYX A;  4QBM A;  2LQ6 A;  5FG5 A;  5E73 A;  5ACY A;  5B75 A;  1JSP B;  5C7N A;  3JVJ A;  2D82 A;  4O7C A;  4O75 A;  5DFC A;  5EWW A;  5FFY A;  3LVR E;  4NUD A;  5FG4 A;  3MHS A;  3PUR A;  3HMF A;  2FFW A;  5TDR A;  3Q2F A;  4O76 A;  4UYH A;  5EK9 A;  5I1Q A;  5K29 A;  4CA1 A;  4R7E A;  3UVY A;  4HXN A;  4LK9 A;  4IC2 A;  5H85 A;  4O64 A;  5HRV A;  4Z6H A;  2YYN A;  4AKI A;  4Q6F A;  5AIU A;  2KWJ A;  1EQF A;  5CU8 A;  4A9L A;  3QZT A;  2I8N A;  4LZ2 A;  5CUD A;  1CHC A;  5I3L A;  2DVQ A;  2MJV B;  3SVH A;  2I7K A;  2L7P A;  5FE4 A;  3DAI A;  4WHW A;  5D3N A;  2YYR A;  3DPL R;  4GNF A;  4TTE A;  2M1R A;  2H60 A;  5EV9 A;  4AUQ B;  2CSY A;  2DSM A;  4GNE A;  4CUU A;  2XOC A;  4OUF A;  5F2P A;  2CRR A;  2LSP B;  4TYL A;  1JM4 B;  3U5J A;  5ENC A;  5E7D A;  2C2L A;  4NR7 A;  2AN6 A;  2KGG A;  3PUQ A;  5EM3 A;  2R0V A;  3D1D A;  4YH4 A;  5DLX A;  5EA1 A;  4ZW1 A;  3C5K A;  3EB6 A;  4V3K C;  5CUG A;  4CUT A;  5B8D A;  5FH8 A;  4A9F A;  4DON A;  1WUG A;  2KE1 A;  4CFL A;  2RSD A;  3MDB C;  2LXP C;  5I29 A;  4HXS A;  4YYH A;  3FAN A;  5F3A A;  5CY9 A;  5D1M B;  4YAT A;  4E96 A;  5KH7 A;  4HBY A;  5FE8 A;  2IQJ A;  3FL2 A;  1BOR A;  3O70 A;  2LRI C;  2R10 A;  3T6R A;  2R0Y A;  3K2J A;  4LDF A;  5ENE A;  5FG6 A;  4L58 A;  5L98 A;  2DX8 A;  2VJE B;  5EIC A;  4LC2 A;  5LJ2 A;  5FH7 A;  2ECT A;  3NG2 A;  5DKA A;  5CUC A;  5A81 A;  3G0L A;  4CCG X;  3D7C A;  4QZS A;  5G0F A;  4PTB A;  2UZG A;  4N4G A;  5I89 A;  5L8T A;  4O7F A;  2G6Q A;  5D7X A;  5F1H A;  3TLP A;  4Z1Q A;  2KU3 A;  4A9E A;  3VKG A;  5CQ5 A;  4UYE A;  5HJC A;  4OGC A;  4PPE A;  2VJE A;  2WP1 A;  4UIU A;  4BW1 A;  4LLB A;  3L1X A;  4HBX A;  5CFW A;  1WFK A;  1WEV A;  4ZQL A;  4H9D A;  2BAY A;  4YYI A;  1V87 A;  4MR3 A;  4GNG A;  2E6S A;  4QEU A;  4QSQ A;  5A5N A;  2HYE D;  2L84 A;  4NR9 A;  5I83 A;  1WEU A;  1IYM A;  1WEQ A;  3JVM A;  1WEN A;  2CT2 A;  2G4A A;  4HXR A;  5D1K B;  4CUR A;  3M63 A;  2YEL A;  5CRZ A;  5DYX A;  4QEW A;  3M7K A;  4IOO A;  5ENI A;  2E6R A;  4NQM A;  3LQI A;  2JMJ A;  5C11 A;  4HXK A;  2EOD A;  2KKY A;  3LDY A;  3QZS A;  4MR4 A;  1N72 A;  5FFV A;  1WEM A;  2KWO A;  5ETB A;  4NYW A;  5E9L A;  4PCE A;  4Z93 A;  1E6I A;  1VFY A;  3Q2E A;  4QYL A;  4I7D A;  5EPR A;  3U5L A;  2YVR A;  4FK5 A;  3I2D A;  5KH9 A;  5KU3 A;  5TBN A;  2KFT A;  2CON A;  3C6W A;  4O78 A;  4XY8 A;  4R8P K;  2G43 A;  4KV1 A;  4YY6 A;  3RPG C;  4P5O B;  2Y1N A;  3ZTG A;  3VKH A;  1HYI A;  4O71 A;  5HM0 A;  2YQM A;  1LDJ B;  5F36 A;  4GND A;  3HCU A;  4MEP A;  4HBV A;  1WES A;  3ZYQ A;  2NXB A;  2K16 A;  4J3I A;  2RO1 A;  5KTX A;  2JM3 A;  5D3T A;  2XP0 A;  3LJW A;  5AMF A;  5DYU A;  5FFW A;  5A5O A;  2MD7 B;  4LAD B;  4UP0 A;  5B78 A;  4MEO A;  4PKL A;  4J0R A;  2F6N A;  5DW1 A;  2C2V S;  2KWN A;  2DWW A;  2OXQ C;  3UVX A;  4IR6 A;  4QSS A;  5EWV A;  3ERR A;  5TAB A;  5HQ7 A;  5E9K A;  3MB4 A;  4Q0O A;  5CZG A;  1WEE A;  4YAD A;  5C87 A;  4AKN A;  4TU6 A;  4NR8 A;  4AKH A;  3DWY A;  1JOC A;  2WP2 A;  5KTU A;  4IC3 A;  4AP4 A;  2YHO A;  5DLZ A;  4CUP A;  4IOQ A;  4F3I A;  5FE9 A;  4C66 A;  2DVS A;  4UIZ A;  2L75 A;  4WZ2 A;  4I7C A;  4QR3 A;  5IG6 A;  4CLB A;  1F68 A;  2L80 A;  2D8U A;  2M6M A;  5CQ3 A;  4NR5 A;  4ZC9 A;  2K17 A;  2Y1M A;  3IU6 A;  2OSS A;  3O37 A;  4UP5 A;  4QUU A;  3KNV A;  5SVX A;  2DKW A;  4AI6 A;  2ECV A;  4XI1 A;  3MXF A;  4TT4 A;  2VP7 A;  5F60 A;  5B79 A;  2M85 A;  2YW8 A;  4WZ3 B;  4O70 A;  4A9H A;  2B0O E;  2QJ0 A;  5IGL A;  3MB3 A;  5G05 B;  3NXB A;  2OUO A;  1ZKR A;  4UI9 B;  4BW4 A;  4LYS A;  5AIT A;  4IR4 A;  3P1F A;  4MEN A;  4A9K A;  3LQH A;  5D0C A;  5I80 A;  2FUU A;  5D3S A;  4MR6 A;  2YW5 A;  1X4U A;  1XWH A;  2ECI A;  3L1Z B;  4NUC A;  3N9P A;  4QF3 A;  3MUK A;  5E74 A;  2RNY A;  4BW2 A;  4XY9 A;  2LGG A;  5D1L B;  2EJN A;  2PUY A;  5FEY A;  5HRX A;  2F42 A;  5EI4 A;  5CUA A;  5IBN A;  5IGM A;  5CGP A;  4YH3 A;  4QST A;  4N3W A;  5DBM A;  4B86 C;  5AD3 A;  5DX4 A;  4CUS A;  2RNX A;  3HCS A;  3UW9 A;  4Z0R A;  5CS8 A;  2VPE A;  4UIY A;  5FBX A;  4ALG A;  3O33 A;  4HBW A;  3P1E A;  5CTL A;  2YQL A;  2KKX A;  4F1P A;  2VJF B;  3T9K A;  3MQM A;  4PCI A;  4TZ8 A;  2YSM A;  2D9E A;  4HXM A;  4TS8 A;  4WIV A;  4NS5 A;  1ZBD B;  5HFR A;  5KHM A;  3O47 A;  5KTW A;  5FB1 A;  5CQA A;  5F1L A;  4NRB A;  2XOY A;  2EGP A;  5II2 A;  2DJA A;  4YYN A;  3GG3 A;  5FE3 A;  5H1U A;  2M3H A;  2VJF A;  5A5S A;  4UYF B;  4A0C D;  4XUB A;  5DYA A;  2Y43 A;  3MHH A;  3ZPV E;  3N9M A;  5HEL A;  2RR4 A;  5D25 A;  4TKP B;  4XYA A;  5LUU A;  3RTR B;  3JVL A;  3LXJ A;  4CUQ A;  2GRC A;  4KV4 A;  1WIM A;  1Z6U A;  2ECN A;  4QSX A;  2KYU A;  2LDR A;  4YK0 A;  3O35 A;  4A9N A;  2YEK A;  5HQ6 A;  3GL6 A;  4LKA A;  5I40 A;  4UYF A;  2VNF A;  4HXO A;  2YT5 A;  5TDW A;  2YSJ A;  5TRB A;  5LKU A;  5G4S A;  5ENH A;  1Z2Q A;  2XB1 A;  3KQI A;  1MM2 A;  2YU4 A;  4YBT A;  5CQ7 A;  2L85 A;  3LQJ A;  1DCQ A;  3ZVY A;  5DW2 A;  3RCW A;  5EIS A;  1VD4 A;  2XEU A;  5HLS A;  3FAO A;  3FEH A;  3IU5 A;  4QSR A;  5KO4 A;  5F5Z A;  5JWM A;  2MT5 A;  4TT2 A;  2XOZ A;  4O62 A;  3ONI A;  4QSW A;  3UV5 A;  2LGK A;  4Z1S A;  2RNW A;  4YAX A;  2MA6 A;  3ZYU A;  4TQN A;  5L8U A;  5AD2 A;  3SOU A;  5D3J A;  4QSP A;  4I7B A;  4CFK A;  5D3R A;  4TU4 A;  5IGK A;  5EQ1 A;  5A85 A;  5HQ5 A;  4UIV A;  5C4Q A;  5G04 B;  3SOW A;  3S92 A;  2F6J A;  3I3J A;  4PS5 A;  5A82 A;  4AKG A;  2PNX A;  2CSZ A;  4LYW A;  4IOR A;  5DFB A;  2D8S A;  4MR5 A;  3FM8 C;  1WUM A;  4YAB A;  5BT4 A;  3SOX A;  5B76 A;  1K2F A;  2CKL B;  5EVA A;  3KV6 A;  5E9V A;  2P57 A;  5LKX A;  5DY7 A;  2VPG A;  3DQV R;  4BHW A;  4S3O B;  5DFD A;  4LR6 A;  5BT3 A;  2E3K A;  2G45 A;  3QZV A;  4NRA A;  1F62 A;  2ECW A;  1ZS5 A;  3ASL A;  3AQA A;  2JMI A;  3LJU X;  2CKL A;  2MA5 A;  4LYI A;  2LXH C;  3M99 A;  2KTB B;  4WA6 A;  3N9L A;  2YUC A;  2NAA A;  5IGN A;  5DKC A;  4UIW A;  3UV2 A;  1X4J A;  5CQ8 A; 
#chains in the Genus database with same CATH homology
 4W4U A;  3O34 A;  4BW3 A;  4N4F A;  4YYG A;  5I7Y A;  3T7L A;  5E9Y A;  2MUM A;  4A4B A;  4MVT A;  4YYK A;  3U5N A;  1JM7 B;  4QR5 A;  2FSA A;  1VYX A;  3G0J A;  4O74 A;  2JMD A;  4QNS A;  3HME A;  4ALH A;  5BT5 A;  4L7X A;  4C9Z A;  5J0D A;  4HXL A;  5ENB A;  2L5E A;  4QR4 A;  2KIZ A;  2I50 A;  2LN0 A;  5EPS A;  5EWH A;  3HMH A;  3P1D A;  2MIQ A;  5E9I A;  5CQT A;  5CUB A;  4QY4 A;  4J0S A;  1JM7 A;  5A5Q A;  2ZET C;  4A49 A;  5I86 A;  4AYC B;  3U5M A;  4PY6 A;  3P5O A;  4Z6I A;  5B77 A;  5C13 A;  5FH6 A;  4OGI A;  4YBM A;  3U5P A;  4LJN A;  4C67 A;  3S91 A;  4QYD A;  2KWK A;  3V43 A;  2ECJ A;  5EPB A;  5EGU A;  3JVK A;  4QUT A;  4X2I A;  2YEM A;  2LV9 A;  2N9G A;  3IHP A;  4AYC A;  4QEV A;  3PHD A;  2L0B A;  5H1T A;  2R0S A;  2HDP A;  2KR4 A;  5JG6 A;  4V3L C;  4A4C A;  4MEQ A;  5J3X A;  2EA6 A;  2KRE A;  5A7C A;  5L96 A;  4YYD A;  5HCL A;  4IR3 A;  4O7A A;  3L11 A;  2MNZ A;  3EB5 A;  1WEW A;  4A9O A;  4BJX A;  4CL9 A;  5FER A;  5G4R A;  4HXP A;  4GPJ A;  5E0R A;  1HYJ A;  4TT6 A;  2L5U A;  4N4H A;  3SHB A;  1U6G B;  5CPE A;  2YUR A;  5FE0 A;  4A9J A;  5A5R A;  2YDW A;  3O7A A;  5H1V A;  4NUE A;  5F62 A;  5FB0 A;  2JRJ A;  5IID A;  3GV4 A;  4QC3 A;  2QIC A;  5EWC A;  5FE5 A;  5EP7 A;  3HTK C;  2DVR A;  5TCM A;  5TB6 A;  1N87 A;  5A5P A;  1WEP A;  2IDA A;  4YBS A;  3SVG A;  1WE9 A;  4YYJ A;  2VPB A;  2OO1 A;  5D3L A;  4XUA A;  5ENF A;  4LRG A;  2QIZ A;  2K1J A;  5DIN A;  4O77 A;  4FIP A;  1RMD A;  4IR5 A;  3UVD A;  5C89 A;  4NYV A;  4A9I A;  5FE7 A;  5LJ0 A;  1FBV A;  3O36 A;  3ZVZ B;  5L99 A;  1FP0 A;  4UIX A;  4LZR A;  3FKM X;  4NXJ A;  5HEN A;  5EWD A;  4NR6 A;  4NRC A;  5LJ1 A;  3U5K A;  5ETD A;  3SVF A;  4NQN A;  4ZUX U;  4A9M A;  5H9M A;  2MD8 C;  3ZPV 1;  2RS9 B;  3ZNI A;  2FUI A;  5DYC A;  5ENG A;  2KGI A;  5EU1 A;  4QF2 A;  5C8G A;  4MSX A;  4J1P A;  4N4I A;  4O7B A;  2VPD A;  4B7Y C;  5D24 A;  5COI A;  5CQ4 A;  5EYA F;  4NR4 A;  2YRE A;  5D26 A;  4S3O C;  2DVV A;  5F25 A;  5LKZ A;  1T1H A;  4UYG A;  5FE2 A;  4AVX A;  5HEM A;  4FJC A;  5LVQ A;  1WEO A;  2DAT A;  4UYD A;  1X0J A;  2E7O A;  5E9M A;  5ENJ A;  2ECG A;  2YQD A;  2H0D B;  5CP5 A;  5F61 A;  5F63 A;  4ZDT A;  4QSU A;  5I88 A;  4WHU A;  5I7X A;  4BBQ A;  4UIT A;  5CUE A;  5D3P A;  5HFQ A;  3HCT A;  3LRQ A;  1E4U A;  3KV5 A;  4QB3 A;  4Q0N A;  5D3H A;  4KCX A;  5HRW A;  3MUL A;  4WZ0 A;  4QSV A;  3N9O A;  1Z60 A;  5KH3 A;  2MNY A;  3P1C A;  5II1 A;  5C85 A;  5JI8 A;  1X4I A;  2H0D A;  4YY4 A;  1WGM A;  5E3G A;  3UVW A;  2K4D A;  2RFJ A;  5FE6 A;  3N9N A;  5LVR A;  4YC9 A;  4GB0 A;  1MM3 A;  4O7E A;  4R2Y A;  1LDK C;  4X3G A;  3UV4 A;  4QC1 A;  5A83 A;  3U5O A;  3N9Q A;  1G25 A;  5LKT A;  1WIL A;  3VK6 A;  4F52 B;  4RVR A;  3AAD A;  5FDZ A;  5E3D A;  5AME A;  1DVP A;  5CRM A;  5FE1 A;  3RPG B;  4YYM A;  2L43 A;  5DKD A;  2E7N A;  2YHN A;  3M62 A;  5L97 A;  4Y03 A;  4NN2 A;  4TZ2 A;  2RI7 A;  2LGL A;  5CQ6 A;  2LGV A;  4OGJ A;  4O72 A;  4LZS A;  5DKH A;  4FLP A;  5LCW B;  4FO9 A;  4NYX A;  4QBM A;  2LQ6 A;  5FG5 A;  5E73 A;  5ACY A;  5B75 A;  1JSP B;  5C7N A;  3JVJ A;  2D82 A;  4O7C A;  4O75 A;  5DFC A;  5EWW A;  5FFY A;  4NUD A;  5FG4 A;  3MHS A;  3PUR A;  3HMF A;  5TDR A;  3Q2F A;  4O76 A;  4UYH A;  5EK9 A;  5I1Q A;  5K29 A;  4CA1 A;  4R7E A;  3UVY A;  4HXN A;  4LK9 A;  4IC2 A;  5H85 A;  4O64 A;  5HRV A;  4Z6H A;  2YYN A;  4Q6F A;  5AIU A;  2KWJ A;  1EQF A;  5CU8 A;  4A9L A;  3QZT A;  2I8N A;  4LZ2 A;  5CUD A;  1CHC A;  5I3L A;  2DVQ A;  2MJV B;  3SVH A;  2I7K A;  5FE4 A;  3DAI A;  4WHW A;  5D3N A;  2YYR A;  3DPL R;  4GNF A;  4TTE A;  2M1R A;  2H60 A;  5EV9 A;  4AUQ B;  2CSY A;  4GNE A;  4CUU A;  4OUF A;  5F2P A;  2LSP B;  4TYL A;  1JM4 B;  3U5J A;  5ENC A;  5E7D A;  2C2L A;  4NR7 A;  2AN6 A;  2KGG A;  3PUQ A;  5EM3 A;  2R0V A;  4YH4 A;  5DLX A;  5EA1 A;  4ZW1 A;  3EB6 A;  3C5K A;  4V3K C;  5G04 B;  5CUG A;  4CUT A;  5B8D A;  5FH8 A;  4A9F A;  4DON A;  1WUG A;  2KE1 A;  4CFL A;  2RSD A;  2LXP C;  5I29 A;  4HXS A;  4YYH A;  5F3A A;  5CY9 A;  5D1M B;  4YAT A;  4E96 A;  5KH7 A;  4HBY A;  5FE8 A;  3FL2 A;  1BOR A;  3O70 A;  2LRI C;  2R10 A;  3T6R A;  2R0Y A;  3K2J A;  4LDF A;  5ENE A;  5FG6 A;  4L58 A;  5L98 A;  2DX8 A;  2VJE B;  5EIC A;  4LC2 A;  5LJ2 A;  5FH7 A;  2ECT A;  3NG2 A;  5DKA A;  5CUC A;  5A81 A;  3G0L A;  4CCG X;  3D7C A;  4QZS A;  5G0F A;  4PTB A;  2UZG A;  4N4G A;  5I89 A;  5L8T A;  4O7F A;  2G6Q A;  5D7X A;  5F1H A;  3TLP A;  4Z1Q A;  2KU3 A;  4A9E A;  2MT5 A;  5CQ5 A;  4UYE A;  5HJC A;  4PPE A;  2VJE A;  2WP1 A;  4UIU A;  4BW1 A;  4LLB A;  3L1X A;  4HBX A;  5CFW A;  1WFK A;  1WEV A;  4ZQL A;  2BAY A;  4YYI A;  1V87 A;  4MR3 A;  4GNG A;  2E6S A;  4QEU A;  4QSQ A;  5A5N A;  2HYE D;  2L84 A;  4NR9 A;  5I83 A;  1WEU A;  1IYM A;  1WEQ A;  3JVM A;  1WEN A;  2CT2 A;  2G4A A;  4HXR A;  5D1K B;  4CUR A;  3M63 A;  2YEL A;  5CRZ A;  5DYX A;  4QEW A;  4IOO A;  5ENI A;  2E6R A;  4NQM A;  3LQI A;  2JMJ A;  5C11 A;  4HXK A;  2EOD A;  3QZS A;  4MR4 A;  1N72 A;  5FFV A;  1WEM A;  2KWO A;  5ETB A;  4NYW A;  5E9L A;  4PCE A;  4Z93 A;  1E6I A;  1VFY A;  3Q2E A;  4QYL A;  4I7D A;  5EPR A;  3U5L A;  4FK5 A;  3I2D A;  5KH9 A;  5KU3 A;  5TBN A;  2KFT A;  3C6W A;  4O78 A;  4XY8 A;  4R8P K;  2G43 A;  4KV1 A;  4YY6 A;  3RPG C;  4P5O B;  2Y1N A;  3ZTG A;  1HYI A;  4O71 A;  5HM0 A;  2YQM A;  1LDJ B;  5F36 A;  4GND A;  3HCU A;  4MEP A;  4HBV A;  1WES A;  3ZYQ A;  2NXB A;  2K16 A;  4J3I A;  2RO1 A;  5KTX A;  5D3T A;  3LJW A;  5AMF A;  5DYU A;  5FFW A;  5A5O A;  2MD7 B;  4LAD B;  4UP0 A;  5B78 A;  4MEO A;  4PKL A;  4J0R A;  2F6N A;  5DW1 A;  2C2V S;  2KWN A;  2DWW A;  2OXQ C;  3UVX A;  4IR6 A;  4QSS A;  5EWV A;  5TAB A;  5HQ7 A;  5E9K A;  3MB4 A;  4Q0O A;  5CZG A;  1WEE A;  4YAD A;  5C87 A;  4AKN A;  4TU6 A;  4NR8 A;  3DWY A;  1JOC A;  2WP2 A;  5KTU A;  4IC3 A;  4AP4 A;  2YHO A;  5DLZ A;  4CUP A;  4IOQ A;  4F3I A;  5FE9 A;  4C66 A;  2DVS A;  4UIZ A;  2L75 A;  4WZ2 A;  4I7C A;  4QR3 A;  5IG6 A;  4CLB A;  1F68 A;  2L80 A;  2M6M A;  5CQ3 A;  4NR5 A;  4ZC9 A;  2K17 A;  2Y1M A;  3IU6 A;  2OSS A;  3O37 A;  4UP5 A;  4QUU A;  3KNV A;  2DKW A;  2ECV A;  4XI1 A;  3MXF A;  4TT4 A;  2VP7 A;  5F60 A;  5B79 A;  2M85 A;  2YW8 A;  4WZ3 B;  4O70 A;  4A9H A;  2QJ0 A;  5IGL A;  3MB3 A;  5G05 B;  3NXB A;  2OUO A;  4UI9 B;  4BW4 A;  4LYS A;  5AIT A;  4IR4 A;  3P1F A;  4MEN A;  4A9K A;  3LQH A;  5D0C A;  5I80 A;  2FUU A;  5D3S A;  4MR6 A;  2YW5 A;  1X4U A;  1XWH A;  2ECI A;  3L1Z B;  4NUC A;  3N9P A;  4QF3 A;  3MUK A;  5E74 A;  2RNY A;  4BW2 A;  4XY9 A;  2LGG A;  5D1L B;  2PUY A;  5FEY A;  5HRX A;  2F42 A;  5EI4 A;  5CUA A;  5IBN A;  5IGM A;  5CGP A;  4YH3 A;  4QST A;  4N3W A;  5DBM A;  4B86 C;  5AD3 A;  5DX4 A;  4CUS A;  2RNX A;  3HCS A;  3UW9 A;  5CS8 A;  2VPE A;  4UIY A;  5FBX A;  4ALG A;  3O33 A;  4HBW A;  3P1E A;  5CTL A;  2YQL A;  2VJF B;  3MQM A;  4PCI A;  4TZ8 A;  2YSM A;  2D9E A;  4HXM A;  4TS8 A;  4WIV A;  4NS5 A;  1ZBD B;  5HFR A;  5KHM A;  5KTW A;  5FB1 A;  5CQA A;  5F1L A;  4NRB A;  2EGP A;  5II2 A;  4YYN A;  3GG3 A;  5FE3 A;  5H1U A;  2M3H A;  2VJF A;  5A5S A;  4UYF B;  4A0C D;  4XUB A;  5DYA A;  2Y43 A;  3MHH A;  3ZPV E;  3N9M A;  5HEL A;  5D25 A;  4TKP B;  4XYA A;  5LUU A;  3RTR B;  3JVL A;  3LXJ A;  4CUQ A;  2GRC A;  4KV4 A;  1WIM A;  1Z6U A;  2ECN A;  4QSX A;  2KYU A;  2LDR A;  4YK0 A;  3O35 A;  4A9N A;  2YEK A;  5HQ6 A;  3GL6 A;  4LKA A;  5I40 A;  4UYF A;  2VNF A;  4HXO A;  2YT5 A;  5TDW A;  2YSJ A;  5TRB A;  5LKU A;  5G4S A;  5ENH A;  1Z2Q A;  2XB1 A;  3KQI A;  1MM2 A;  2YU4 A;  4YBT A;  5CQ7 A;  2L85 A;  3LQJ A;  3ZVY A;  5DW2 A;  3RCW A;  5EIS A;  1VD4 A;  2XEU A;  5HLS A;  3IU5 A;  4QSR A;  5KO4 A;  5F5Z A;  5JWM A;  4TT2 A;  3ONI A;  4QSW A;  3UV5 A;  2LGK A;  4Z1S A;  2RNW A;  4YAX A;  2MA6 A;  3ZYU A;  4TQN A;  5L8U A;  5AD2 A;  3SOU A;  5D3J A;  4QSP A;  4I7B A;  4CFK A;  5D3R A;  4TU4 A;  5IGK A;  5EQ1 A;  5A85 A;  5HQ5 A;  4UIV A;  5C4Q A;  3SOW A;  3S92 A;  2F6J A;  3I3J A;  4PS5 A;  5A82 A;  2PNX A;  2CSZ A;  4LYW A;  4IOR A;  5DFB A;  2D8S A;  4MR5 A;  1WUM A;  4YAB A;  5BT4 A;  3SOX A;  5B76 A;  1K2F A;  2CKL B;  5EVA A;  3KV6 A;  5E9V A;  5LKX A;  5DY7 A;  2VPG A;  3DQV R;  4BHW A;  4S3O B;  5DFD A;  4LR6 A;  5BT3 A;  2E3K A;  2G45 A;  3QZV A;  4NRA A;  1F62 A;  2ECW A;  1ZS5 A;  3ASL A;  3AQA A;  2JMI A;  2CKL A;  2MA5 A;  4LYI A;  2LXH C;  3M99 A;  2KTB B;  4WA6 A;  3N9L A;  2YUC A;  2NAA A;  5IGN A;  5DKC A;  4UIW A;  3UV2 A;  1X4J A;  5CQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...