5FB0A

Crystal structure of a phd finger bound to histone h3 t3ph peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
183
structure length
172
Chain Sequence
b'SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERSGHQESEVLMRQMQPEEQLKCEFLLLKVYCDSKSSFFASEPYYGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear autoantigen Sp-100
publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/structural protein
total genus 59
structure length 172
sequence length 183
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb0A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb0A01
3SOWA 5I1QA 2FUIA 3P1DA 2I8NA 5A7CA 1XWHA 5EWWA 2Y1NA 2F6JA 4UIZA 5HRVA 5EQ1A 3Q2FA 5F5ZA 4UIUA 2LN0A 5BT5A 4E96A 4TZ2A 2MA5A 4QR5A 1JM7A 5C4QA 4ALHA 4HXNA 3MHHA 4LZRA 3N9PA 2RI7A 4HBWA 4NR8A 4QY4A 4PCEA 5CU8A 2K1JA 5AD2A 3N9QA 5FE8A 3C6WA 3UV5A 3ZTGA 4NR9A 2QJ0A 4HXPA 4O7EA 5CRMA 1Z60A 2MIQA 5D25A 5ENIA 3L1ZB 2OSSA 3UVYA 3IU6A 5G4RA 5D3HA 4O64A 4A4CA 3TLPA 5TCMA 5EV9A 3HMEA 2H0DA 5F60A 5A5RA 1WILA 4WHWA 5EPRA 4WZ2A 5E74A 4TU6A 4YYJA 5C8GA 2G45A 5IGLA 2VJEA 4YATA 2YYRA 4YH4A 2LGKA 3KNVA 4X2IA 4YYHA 4YYGA 4QEWA 5H1UA 4MR3A 4Y03A 5DFCA 2KTBB 3ASLA 1X4JA 2RO1A 1WEUA 4XUBA 4CUSA 5ENFA 4DONA 4BW3A 4IOQA 3P1FA 5C89A 5EA1A 3SVHA 3O7AA 4GNEA 2VP7A 2M3HA 5D3LA 2KR4A 2YDWA 4PPEA 4PTBA 5LCWB 5JI8A 3O37A 4UITA 3UV2A 2RS9B 5E9YA 4HXKA 4CFLA 2YURA 4IC2A 5B77A 5DYXA 2MNYA 5TDRA 4UIVA 4NQNA 3LQHA 4A9FA 5AMFA 4PS5A 1WENA 4LYWA 4HBVA 1ZBDB 2QIZA 4GNGA 5ACYA 2L5UA 3GL6A 5G0FA 3AADA 1X4UA 5DKDA 4LC2A 4IR4A 2DATA 3PHDA 5JWMA 3U5MA 3G0LA 5E9IA 4TS8A 4N4IA 4N4GA 4QYDA 5CY9A 3LQJA 1Z6UA 2XB1A 4YBMA 2YHNA 4O70A 4QSTA 2DVRA 1FBVA 5E7DA 2M6MA 5EWHA 2GRCA 5FG4A 4ZDTA 2BAYA 4OUFA 4NR4A 3T7LA 2ECJA 1HYIA 4I7DA 5ENEA 3JVKA 4YYIA 4HBXA 5E9MA 5LJ2A 1WUGA 5E3GA 5EWCA 4AP4A 4I7CA 5C87A 4GNDA 4NYVA 4C66A 3UVDA 2VPEA 5KTXA 2DWWA 3HMFA 3N9MA 5A82A 4WZ0A 2LXHC 5FG6A 4UYEA 4OGIA 2E7NA 5J0DA 5LKZA 2F42A 2KWOA 3L11A 4BW4A 4C9ZA 5D7XA 4LDFA 5I7YA 5LVQA 1WEPA 2YELA 4S3OB 5C7NA 4Z93A 4ALGA 2L0BA 4A0CD 4NXJA 5HRXA 3MXFA 3MB3A 3UVXA 5A5OA 4AYCB 5E9LA 1WESA 3P5OA 5D3NA 1JSPB 2I7KA 2MA6A 3JVJA 5B8DA 5E73A 4QC1A 3U5JA 1F68A 5DYUA 5C13A 4A9NA 3U5NA 5D1LB 5CUCA 2LSPB 2YW8A 1EQFA 2YT5A 4HXRA 2L84A 4CL9A 3HTKC 4MEOA 1BORA 4P5OB 3VK6A 4QSWA 4TT2A 5FE1A 2I50A 5F2PA 2C2VS 4LZSA 3N9NA 2WP2A 2MT5A 4UYHA 4HXOA 4A9OA 5A5QA 5HFRA 3DAIA 4IORA 4N3WA 2LGGA 2E6SA 3SOXA 5I89A 5JG6A 2QICA 3V43A 2K16A 5EM3A 4O75A 5D3RA 4QYLA 4KCXA 5FH6A 3P1EA 4QZSA 4BHWA 4FJCA 3C5KA 4CURA 4MR4A 4OGJA 4GPJA 1G25A 2M85A 5H1VA 4Q0NA 2NAAA 5FE6A 5EP7A 5DKHA 4YADA 1VD4A 5CUDA 4CFKA 4A9KA 1E4UA 2UZGA 5EVAA 4N4FA 1WGMA 2YEMA 4QBMA 3AQAA 5D1MB 4UYDA 2MNZA 2RNWA 2F6NA 4Z6IA 2KGIA 5LJ1A 2KWJA 2KU3A 4CA1A 2HDPA 5EISA 5B75A 5FE9A 4O76A 5F63A 2M1RA 2VNFA 3LRQA 4CUTA 5TB6A 4QNSA 2KGGA 4R7EA 4MEQA 5EU1A 5HQ7A 1Z2QA 5II1A 1WEMA 5FBXA 5A5PA 5KHMA 1WEEA 2ECNA 5IIDA 1F62A 4QSPA 3S92A 4UIWA 4XUAA 4YYDA 1WEQA 2L75A 5C11A 2RNYA 2VPGA 4ZC9A 4TZ8A 5F62A 2KE1A 3T6RA 4YC9A 3U5OA 2PUYA 5IGMA 2YU4A 1HYJA 1IYMA 3FL2A 2OXQC 4O7CA 5I40A 5LKTA 5F1HA 2D8SA 5LVRA 2YW5A 3P1CA 2L80A 5CP5A 5FDZA 5FH8A 4NR6A 4ZQLA 2VJFB 5EWVA 5H9MA 2C2LA 3HCTA 1WE9A 3DWYA 3MHSA 5D0CA 4TTEA 5HQ6A 4QSQA 4MVTA 4PCIA 3ZVZB 3HCSA 4BBQA 2N9GA 2CKLB 3G0JA 5EICA 1N87A 5CUBA 5COIA 5CS8A 3ZYUA 5FEYA 3LXJA 4LYIA 4Q6FA 2JMIA 4YYKA 5IGNA 4FIPA 5G4SA 3ONIA 5ENJA 2YQMA 3ZPV1 3LQIA 4O78A 5TABA 5FB1A 4MR6A 4YY6A 5L99A 4YY4A 4TYLA 5D3SA 1LDJB 2LRIC 2RSDA 5KO4A 4HBYA 5F61A 5KH3A 4UYGA 5KTUA 2CT2A 5DFDA 5D1KB 1ZS5A 4NN2A 3S91A 3NG2A 4KV1A 4UP5A 2KWNA 2OUOA 4X3GA 4HXLA 2YHOA 1WFKA 2R10A 3O34A 5FE3A 5I29A 3RPGC 4XI1A 2YYNA 4TQNA 5I7XA 4YBSA 4QSSA 4A9JA 3O35A 4BW2A 4Z1QA 4QSUA 5EPSA 2EGPA 2MD7B 4QSRA 4YYMA 3PUQA 4HXSA 5L8TA 1N72A 4QSVA 4QSXA 4QEUA 4YH3A 3I3JA 3U5LA 4XYAA 1VYXA 4FLPA 4XY9A 4QUUA 5B76A 4A9IA 4NUDA 2VPDA 2LV9A 4KV4A 4TT4A 5K29A 5C85A 4XY8A 2DKWA 5ETBA 2VPBA 5EYAF 4PKLA 5CUGA 5L96A 4AUQB 4J0RA 5D3JA 5DLZA 4UIXA 5CQTA 5ENGA 4A4BA 4O7FA 2DX8A 4J0SA 4O7AA 3M99A 4F52B 2L43A 5CQAA 4MENA 2YSMA 5DINA 2D9EA 5ENBA 3UV4A 4MSXA 3O33A 5IBNA 4GB0A 5CUAA 5EWDA 5LJ0A 4NR5A 4F3IA 4W4UA 5I83A 5KH7A 4O7BA 4R8PK 4NS5A 2H60A 2CKLA 3SHBA 1WUMA 4N4HA 5DW2A 5HFQA 2ECTA 2K17A 5A85A 5FE7A 4WA6A 3HCUA 4WIVA 4FO9A 2CSYA 4IR5A 5B78A 2FSAA 5A5NA 5EK9A 3SVFA 4CUPA 2ECGA 2KFTA 2XEUA 5CRZA 5E0RA 4NUEA 3M62A 3IHPA 1WEOA 5E9KA 1JOCA 5IGKA 5LKXA 5AITA 4V3LC 3KV5A 3L1XA 1E6IA 2YSJA 3GV4A 4LJNA 5F36A 5LKUA 2K4DA 5ETDA 5HLSA 3K2JA 5D24A 4LR6A 4MEPA 2PNXA 2E6RA 5F3AA 3RCWA 4NRAA 5DYAA 5AD3A 3N9LA 5E9VA 3UW9A 4O74A 2ZETC 5DX4A 4Z6HA 4QB3A 3ZVYA 3UVWA 4QR4A 4A49A 4NRBA 4YYNA 1V87A 5AIUA 5II2A 4O71A 4CUUA 4QR3A 2DVVA 5A5SA 1FP0A 4QF3A 4YAXA 3KV6A 2L5EA 5I3LA 5EPBA 5G04B 3QZSA 5AMEA 5F25A 1DVPA 1VFYA 3N9OA 4UIYA 4L7XA 2MD8C 4J1PA 4NYWA 4LADB 5FFVA 3I2DA 5A83A 5B79A 5DLXA 2R0YA 2KREA 3SOUA 2DVQA 2LQ6A 3ZPVE 1WEWA 4AYCA 5CZGA 3O36A 1LDKC 2KYUA 4O72A 4PY6A 4UYFB 3O70A 1WIMA 5EGUA 1T1HA 2YEKA 2CSZA 4LLBA 3GG3A 4NQMA 5DFBA 5CQ8A 4NRCA 2JRJA 4A9LA 4NYXA 3ZNIA 2YQDA 4AKNA 5HELA 4YABA 4TKPB 5BT3A 5TDWA 2HYED 3NXBA 3QZTA 4QUTA 5CQ3A 1WEVA 4A9EA 5L97A 1CHCA 5CFWA 5KU3A 2RFJA 5BT4A 2YUCA 2ECWA 5FE5A 5CPEA 3KQIA 4CUQA 5D3PA 2KWKA 4BJXA 4QEVA 4BW1A 2KIZA 4QF2A 5L8UA 2R0SA 4YK0A 3M63A 2LGLA 4WZ3B 3HMHA 5FG5A 2YREA 2EODA 1X0JA 3FKMX 1RMDA 5CGPA 5KH9A 2R0VA 2LGVA 5CTLA 2G6QA 5IG6A 4R2YA 5DKCA 4C67A 4CLBA 4A9MA 5HJCA 2LDRA 5H1TA 5H85A 4ZW1A 3U5PA 3LJWA 4QC3A 4CCGX 4IC3A 1MM2A 5FFYA 5I88A 4MR5A 5KTWA 5CQ4A 1K2FA 4LRGA 4O77A 5ENCA 5FE0A 4NUCA 4UP0A 3RTRB 2LXPC 5TRBA 1JM7B 4LYSA 2G43A 4FK5A 5I86A 5FERA 5FFWA 2MUMA 1JM4B 2E7OA 5D26A 4IR6A 4S3OC 4Z1SA 2ECIA 4YBTA 5HENA 5DYCA 5E3DA 5FE2A 3MB4A 4L58A 5DW1A 5G05B 4TT6A 3RPGB 5DKAA 4AVXA 4A9HA 3Q2EA 5I80A 4B7YC 2E3KA 4J3IA 1X4IA 2Y43A 2IDAA 5HRWA 3U5KA 4GNFA 5DY7A 2H0DB 5DBMA 5CQ5A 3JVMA 5EI4A 2FUUA 2L85A 3EB6A 4LK9A 5HM0A 4UYFA 1MM3A 3DQVR 2MJVB 2JMJA 2VJEB 5HQ5A 3EB5A 5FE4A 4NR7A 4WHUA 2DVSA 2VJFA 5TBNA 4B86C 2ECVA 5L98A 2YQLA 5J3XA 2NXBA 4TU4A 5HEMA 1U6GB 5ENHA 3PURA 3DPLR 2WP1A 5HCLA 4ZUXU 5D3TA 5CUEA 3SVGA 4V3KC 2RNXA 3IU5A 2EA6A 2G4AA 4LZ2A 4LKAA 5A81A 5CQ7A 3ZYQA 2JMDA 3QZVA 3D7CA 4UI9B 3JVLA 3MQMA 5FB0A 5F1LA 4I7BA 5CQ6A 2AN6A 2Y1MA 4RVRA 4IOOA 4Q0OA 5FH7A 2D82A 3MUKA 3MULA 2OO1A 5LUUA 4HXMA 4IR3A
chains in the Genus database with same CATH superfamily
3SOWA 5I1QA 2FUIA 3P1DA 2I8NA 5A7CA 1XWHA 5EWWA 2Y1NA 2F6JA 4UIZA 5HRVA 5EQ1A 3Q2FA 5F5ZA 4UIUA 2LN0A 5BT5A 4E96A 4TZ2A 2MA5A 4QR5A 1JM7A 5C4QA 4ALHA 4HXNA 2FD4A 3MHHA 4LZRA 3N9PA 2RI7A 4HBWA 4NR8A 4QY4A 4PCEA 5CU8A 4F1PA 2K1JA 5AD2A 3N9QA 5FE8A 3C6WA 3UV5A 3ZTGA 4NR9A 2IQJA 2QJ0A 4HXPA 4O7EA 5CRMA 1Z60A 2MIQA 5D25A 5ENIA 3L1ZB 2OSSA 3UVYA 3IU6A 5G4RA 5D3HA 4O64A 4A4CA 3TLPA 5TCMA 5EV9A 3HMEA 1MBMA 2H0DA 5F60A 5A5RA 1WILA 4WHWA 5EPRA 4WZ2A 5E74A 4TU6A 4YYJA 5C8GA 2G45A 5IGLA 2VJEA 4YATA 2YYRA 4YH4A 2LGKA 3KNVA 4X2IA 4YYHA 4YYGA 4QEWA 2JUNA 5H1UA 4MR3A 4Y03A 5DFCA 2KTBB 3ASLA 1X4JA 2RO1A 1WEUA 4XUBA 4CUSA 5ENFA 4DONA 4BW3A 4IOQA 3FANA 3P1FA 5C89A 5EA1A 3SVHA 3O7AA 4GNEA 2VP7A 2M3HA 5D3LA 2KR4A 2YDWA 4PPEA 4PTBA 5LCWB 5JI8A 3O37A 4UITA 3UV2A 2RS9B 5E9YA 4HXKA 4CFLA 2YURA 4IC2A 5B77A 5DYXA 2MNYA 5TDRA 4UIVA 4NQNA 3LQHA 4A9FA 5AMFA 4PS5A 1WENA 4LYWA 4HBVA 1ZBDB 2QIZA 4GNGA 5ACYA 2L5UA 3D1BA 3GL6A 5G0FA 3AADA 1X4UA 5DKDA 4LC2A 4IR4A 2DATA 3PHDA 5JWMA 3U5MA 3G0LA 5E9IA 4TS8A 4N4IA 4N4GA 4QYDA 5CY9A 3LQJA 1Z6UA 2XB1A 4YBMA 2YHNA 4O70A 4QSTA 2L7PA 2XOYA 2DVRA 1FBVA 5E7DA 2M6MA 3Q1DA 5EWHA 2OWAA 2GRCA 5FG4A 4ZDTA 2BAYA 4OUFA 4NR4A 3T7LA 2ECJA 1HYIA 4I7DA 5ENEA 3JVKA 4YYIA 4HBXA 5E9MA 5LJ2A 1WUGA 5E3GA 2FFWA 3FM8C 5EWCA 4AP4A 4I7CA 5C87A 4GNDA 4AKHA 4NYVA 4C66A 3UVDA 2VPEA 5KTXA 2DWWA 3HMFA 3N9MA 5A82A 4WZ0A 2CONA 2LXHC 5FG6A 4UYEA 4OGIA 2E7NA 5J0DA 5LKZA 2F42A 2KWOA 3L11A 4BW4A 3MDBC 4C9ZA 5D7XA 4LDFA 5I7YA 5LVQA 1WEPA 1ZKRA 2YELA 4S3OB 5C7NA 4Z93A 4ALGA 2L0BA 4A0CD 4NXJA 2KKXA 5HRXA 3MXFA 2XOCA 2XOZA 3MB3A 3UVXA 5A5OA 4AYCB 5E9LA 1WESA 3P5OA 5D3NA 1JSPB 2I7KA 2MA6A 3JVJA 3SUBA 5B8DA 5E73A 4QC1A 3U5JA 1F68A 5DYUA 5C13A 4A9NA 3U5NA 5D1LB 5CUCA 2LSPB 2YW8A 1EQFA 2YT5A 4HXRA 2L84A 4CL9A 3HTKC 4MEOA 1BORA 4P5OB 3VK6A 4QSWA 2DJAA 4AKIA 4TT2A 5FE1A 2I50A 5F2PA 2C2VS 4LZSA 3N9NA 2WP2A 2MT5A 4UYHA 4HXOA 4A9OA 5A5QA 5HFRA 3DAIA 4IORA 4N3WA 2LGGA 2E6SA 3SOXA 5I89A 5JG6A 2QICA 3V43A 2K16A 5EM3A 4O75A 5D3RA 4QYLA 4KCXA 5FH6A 3P1EA 4QZSA 4BHWA 3FJUB 3C5KA 4FJCA 4CURA 4MR4A 4OGJA 4GPJA 1G25A 2M85A 5H1VA 4Q0NA 3D1DA 2NAAA 5FE6A 5EP7A 5DKHA 4YADA 1VD4A 5CUDA 4CFKA 4A9KA 1E4UA 2UZGA 5EVAA 4N4FA 1WGMA 2YEMA 4QBMA 3AQAA 5D1MB 4UYDA 2MNZA 2RNWA 2F6NA 4Z6IA 2KGIA 3KDEC 5LJ1A 2KWJA 2KU3A 4CA1A 2HDPA 2MKEA 5EISA 5B75A 5FE9A 4O76A 5F63A 2M1RA 2VNFA 3LRQA 4CUTA 4O62A 5TB6A 4QNSA 2D8UA 2KGGA 4R7EA 4MEQA 5EU1A 5HQ7A 1Z2QA 5II1A 1WEMA 5FBXA 5A5PA 5KHMA 1WEEA 2ECNA 5IIDA 1F62A 4QSPA 3S92A 4UIWA 4XUAA 4YYDA 5SVIB 1WEQA 2L75A 5C11A 2RNYA 2VPGA 4ZC9A 4TZ8A 5F62A 2KE1A 3T6RA 4YC9A 4AKGA 3U5OA 2PUYA 5IGMA 2YU4A 1HYJA 1IYMA 3FL2A 2OXQC 4O7CA 5I40A 5LKTA 5F1HA 2CSVA 2D8SA 5LVRA 2YW5A 3P1CA 2L80A 3H7HA 5CP5A 5FDZA 5FH8A 4NR6A 4ZQLA 2VJFB 5EWVA 5H9MA 2C2LA 3HCTA 1WE9A 3DWYA 3MHSA 5D0CA 4TTEA 5HQ6A 4QSQA 2XP0A 4MVTA 4PCIA 3ZVZB 3HCSA 4BBQA 2N9GA 2CKLB 3G0JA 5EICA 1N87A 5CUBA 5COIA 5CS8A 3ZYUA 5FEYA 3LXJA 4LYIA 4Q6FA 2JMIA 4YYKA 5IGNA 4FIPA 4Z0RA 5G4SA 3ONIA 5ENJA 2YQMA 3ZPV1 3LQIA 4O78A 5TABA 5FB1A 4MR6A 4YY6A 5L99A 2B0OE 4YY4A 4TYLA 4AI6A 3LJUX 5D3SA 1LDJB 2LRIC 2RSDA 5KO4A 4HBYA 5F61A 5KH3A 3LDYA 4UYGA 5KTUA 2CT2A 5DFDA 5D1KB 1ZS5A 4NN2A 3S91A 3NG2A 4KV1A 4UP5A 2KWNA 2OUOA 4X3GA 4HXLA 2YHOA 1WFKA 2R10A 3O34A 5FE3A 5I29A 3RPGC 4XI1A 2YYNA 4TQNA 5I7XA 4YBSA 4QSSA 4A9JA 3O35A 4BW2A 4Z1QA 4QSUA 5EPSA 2EGPA 2MD7B 4QSRA 4YYMA 3PUQA 4HXSA 3O47A 5L8TA 1N72A 4QSVA 4QSXA 4QEUA 4YH3A 3I3JA 3U5LA 4XYAA 1VYXA 4FLPA 4XY9A 4QUUA 4OGEA 5B76A 4A9IA 4NUDA 2VPDA 2LV9A 4KV4A 4TT4A 5K29A 2YVRA 5C85A 4XY8A 2DKWA 5ETBA 2VPBA 2DSMA 5EYAF 5SVIA 4PKLA 5CUGA 5L96A 4AUQB 4J0RA 5D3JA 5DLZA 4UIXA 5CQTA 5ENGA 4A4BA 4O7FA 2DX8A 4J0SA 4O7AA 3DWDA 3M99A 4F52B 2L43A 5CQAA 4MENA 2YSMA 5DINA 2D9EA 5ENBA 3UV4A 4MSXA 3O33A 5IBNA 4GB0A 5CUAA 5EWDA 5LJ0A 4NR5A 4F3IA 4W4UA 5I83A 5KH7A 4O7BA 4R8PK 4QQ4A 4NS5A 2H60A 2CKLA 3SHBA 1WUMA 4N4HA 3VKHA 5DW2A 5HFQA 2ECTA 2K17A 5A85A 5FE7A 4WA6A 3HCUA 4WIVA 4FO9A 2CSYA 4IR5A 5B78A 2FSAA 5A5NA 5EK9A 3SVFA 4CUPA 2ECGA 2KFTA 2RR4A 2XEUA 5CRZA 5E0RA 4NUEA 3M62A 3IHPA 2EGMA 1WEOA 5E9KA 1JOCA 5IGKA 5LKXA 5AITA 4V3LC 3KV5A 3L1XA 1E6IA 2YSJA 3GV4A 5SVYA 4LJNA 5F36A 5LKUA 2K4DA 5ETDA 5HLSA 3K2JA 5D24A 4LR6A 4MEPA 2PNXA 5SVXA 2E6RA 5F3AA 2EJNA 3RCWA 4NRAA 5DYAA 5AD3A 3N9LA 5E9VA 3UW9A 3ERRA 4O74A 2ZETC 5DX4A 4Z6HA 4QB3A 3ZVYA 3UVWA 4QR4A 4A49A 4NRBA 3JUEA 4YYNA 1V87A 5AIUA 5II2A 4O71A 4CUUA 2E61A 4QR3A 2DVVA 5A5SA 1FP0A 3LVQE 4QF3A 4YAXA 3KV6A 2L5EA 5I3LA 5EPBA 5G04B 3QZSA 5AMEA 5F25A 1DVPA 1VFYA 3N9OA 4UIYA 4L7XA 2MD8C 4J1PA 4NYWA 4LADB 5FFVA 3I2DA 5A83A 5B79A 5DLXA 2R0YA 1DCQA 2KREA 3SOUA 2DVQA 1PUOA 2LQ6A 3ZPVE 1WEWA 4AYCA 5CZGA 3O36A 1LDKC 2KYUA 4O72A 4PY6A 4UYFB 3O70A 1WIMA 5EGUA 1T1HA 2YEKA 2CSZA 4LLBA 2JM3A 3GG3A 4NQMA 5DFBA 5CQ8A 4NRCA 2JRJA 4A9LA 4NYXA 3ZNIA 2M13A 2YQDA 4AKNA 5HELA 4YABA 4TKPB 5BT3A 5TDWA 2HYED 3NXBA 3QZTA 4QUTA 5CQ3A 1WEVA 4A9EA 5L97A 1CHCA 5CFWA 5KU3A 2RFJA 5BT4A 2YUCA 2ECWA 5FE5A 5CPEA 3KQIA 4CUQA 5D3PA 2KWKA 4BJXA 3PLWA 4QEVA 2LAUA 4BW1A 2KIZA 4QF2A 2P57A 5L8UA 2R0SA 4YK0A 3M63A 2LGLA 4WZ3B 3HMHA 5FG5A 2YREA 2CRWA 2EODA 1X0JA 3FKMX 1RMDA 5CGPA 5KH9A 2R0VA 2LGVA 5CTLA 2G6QA 5IG6A 4R2YA 5DKCA 4C67A 4CLBA 4A9MA 5HJCA 2LDRA 5H1TA 5H85A 4ZW1A 3U5PA 3LJWA 4QC3A 4CCGX 4IC3A 1MM2A 5FFYA 5I88A 4MR5A 4H9DA 5KTWA 5CQ4A 1K2FA 3LVRE 4LRGA 4O77A 5ENCA 5FE0A 4NUCA 4UP0A 5K3QA 2LXPC 5TRBA 3RTRB 1JM7B 3DDTA 3M7KA 4LYSA 2G43A 4FK5A 5I86A 5FERA 2EXUA 5FFWA 2MUMA 1JM4B 2E7OA 5D26A 4IR6A 4S3OC 4Z1SA 2ECIA 4YBTA 2KKYA 3T9KA 5HENA 5DYCA 5E3DA 5FE2A 3MB4A 3VKGA 4L58A 5DW1A 5G05B 4TT6A 3E2DA 3RPGB 5DKAA 4AVXA 4A9HA 3Q2EA 5I80A 4B7YC 2E3KA 4J3IA 1X4IA 2CRRA 2Y43A 2IDAA 5HRWA 3U5KA 4GNFA 5DY7A 2H0DB 5DBMA 5CQ5A 3JVMA 5EI4A 2FUUA 2L85A 3EB6A 4LK9A 5HM0A 4UYFA 1MM3A 3DQVR 2MJVB 2JMJA 2VJEB 5HQ5A 3EB5A 5FE4A 4NR7A 4WHUA 2DVSA 2VJFA 5TBNA 3FAOA 4B86C 2ECVA 5L98A 2YQLA 5J3XA 2NXBA 4TU4A 5HEMA 1U6GB 5ENHA 3PURA 3DPLR 2WP1A 5HCLA 4ZUXU 5D3TA 5CUEA 3SVGA 4V3KC 2RNXA 3IU5A 2EA6A 2G4AA 4LZ2A 4LKAA 5A81A 5CQ7A 3ZYQA 4OGCA 2JMDA 3QZVA 3D7CA 4UI9B 3JVLA 3MQMA 5FB0A 5F1LA 4I7BA 5CQ6A 2AN6A 2Y1MA 4Z0OA 3FEHA 4RVRA 4IOOA 4Q0OA 5FH7A 2D82A 3MUKA 3MULA 2OO1A 5LUUA 4HXMA 4IR3A
chains in the Genus database with same CATH topology
3SOWA 5I1QA 2FUIA 3P1DA 2I8NA 5A7CA 1XWHA 5EWWA 2Y1NA 2F6JA 4UIZA 5HRVA 5EQ1A 3Q2FA 5F5ZA 4UIUA 2LN0A 5BT5A 4E96A 4TZ2A 2MA5A 4QR5A 1JM7A 5C4QA 4ALHA 4HXNA 3MHHA 4LZRA 3N9PA 2RI7A 4HBWA 4NR8A 4QY4A 4PCEA 5CU8A 2K1JA 5AD2A 3N9QA 5FE8A 3C6WA 3UV5A 3ZTGA 4NR9A 2QJ0A 4HXPA 4O7EA 5CRMA 1Z60A 2MIQA 5D25A 5ENIA 3L1ZB 2OSSA 3UVYA 3IU6A 5G4RA 5D3HA 4O64A 4A4CA 3TLPA 5TCMA 5EV9A 3HMEA 2H0DA 5F60A 5A5RA 1WILA 4WHWA 5EPRA 4WZ2A 5E74A 4TU6A 4YYJA 5C8GA 2G45A 5IGLA 2VJEA 4YATA 2YYRA 4YH4A 2LGKA 3KNVA 4X2IA 4YYHA 4YYGA 4QEWA 5H1UA 4MR3A 4Y03A 5DFCA 2KTBB 3ASLA 1X4JA 2RO1A 1WEUA 4XUBA 4CUSA 5ENFA 4DONA 4BW3A 4IOQA 3P1FA 5C89A 5EA1A 3SVHA 3O7AA 4GNEA 2VP7A 2M3HA 5D3LA 2KR4A 2YDWA 4PPEA 4PTBA 5LCWB 5JI8A 3O37A 4UITA 3UV2A 2RS9B 5E9YA 4HXKA 4CFLA 2YURA 4IC2A 5B77A 5DYXA 2MNYA 5TDRA 4UIVA 4NQNA 3LQHA 4A9FA 5AMFA 4PS5A 1WENA 4LYWA 4HBVA 1ZBDB 2QIZA 4GNGA 5ACYA 2L5UA 3GL6A 5G0FA 3AADA 1X4UA 5DKDA 4LC2A 4IR4A 2DATA 3PHDA 5JWMA 3U5MA 3G0LA 5E9IA 4TS8A 4N4IA 4N4GA 4QYDA 5CY9A 3LQJA 1Z6UA 2XB1A 4YBMA 2YHNA 4O70A 4QSTA 2DVRA 1FBVA 5E7DA 2M6MA 5EWHA 2GRCA 5FG4A 4ZDTA 2BAYA 4OUFA 4NR4A 3T7LA 2ECJA 1HYIA 4I7DA 5ENEA 3JVKA 4YYIA 4HBXA 5E9MA 5LJ2A 1WUGA 5E3GA 5EWCA 4AP4A 4I7CA 5C87A 4GNDA 4NYVA 4C66A 3UVDA 2VPEA 5KTXA 2DWWA 3HMFA 3N9MA 5A82A 4WZ0A 2LXHC 5FG6A 4UYEA 4OGIA 2E7NA 5J0DA 5LKZA 2F42A 2KWOA 3L11A 4BW4A 4C9ZA 5D7XA 4LDFA 5I7YA 5LVQA 1WEPA 2YELA 4S3OB 5C7NA 4Z93A 4ALGA 2L0BA 4A0CD 4NXJA 5HRXA 3MXFA 3MB3A 3UVXA 5A5OA 4AYCB 5E9LA 1WESA 3P5OA 5D3NA 1JSPB 2I7KA 2MA6A 3JVJA 5B8DA 5E73A 4QC1A 3U5JA 1F68A 5DYUA 5C13A 4A9NA 3U5NA 5D1LB 5CUCA 2LSPB 2YW8A 1EQFA 2YT5A 4HXRA 2L84A 4CL9A 3HTKC 4MEOA 1BORA 4P5OB 3VK6A 4QSWA 4TT2A 5FE1A 2I50A 5F2PA 2C2VS 4LZSA 3N9NA 2WP2A 2MT5A 4UYHA 4HXOA 4A9OA 5A5QA 5HFRA 3DAIA 4IORA 4N3WA 2LGGA 2E6SA 3SOXA 5I89A 5JG6A 2QICA 3V43A 2K16A 5EM3A 4O75A 5D3RA 4QYLA 4KCXA 5FH6A 3P1EA 4QZSA 4BHWA 4FJCA 3C5KA 4CURA 4MR4A 4OGJA 4GPJA 1G25A 2M85A 5H1VA 4Q0NA 2NAAA 5FE6A 5EP7A 5DKHA 4YADA 1VD4A 5CUDA 4CFKA 4A9KA 1E4UA 2UZGA 5EVAA 4N4FA 1WGMA 2YEMA 4QBMA 3AQAA 5D1MB 4UYDA 2MNZA 2RNWA 2F6NA 4Z6IA 2KGIA 5LJ1A 2KWJA 2KU3A 4CA1A 2HDPA 5EISA 5B75A 5FE9A 4O76A 5F63A 2M1RA 2VNFA 3LRQA 4CUTA 5TB6A 4QNSA 2KGGA 4R7EA 4MEQA 5EU1A 5HQ7A 1Z2QA 5II1A 1WEMA 5FBXA 5A5PA 5KHMA 1WEEA 2ECNA 5IIDA 1F62A 4QSPA 3S92A 4UIWA 4XUAA 4YYDA 1WEQA 2L75A 5C11A 2RNYA 2VPGA 4ZC9A 4TZ8A 5F62A 2KE1A 3T6RA 4YC9A 3U5OA 2PUYA 5IGMA 2YU4A 1HYJA 1IYMA 3FL2A 2OXQC 4O7CA 5I40A 5LKTA 5F1HA 2D8SA 5LVRA 2YW5A 3P1CA 2L80A 5CP5A 5FDZA 5FH8A 4NR6A 4ZQLA 2VJFB 5EWVA 5H9MA 2C2LA 3HCTA 1WE9A 3DWYA 3MHSA 5D0CA 4TTEA 5HQ6A 4QSQA 4MVTA 4PCIA 3ZVZB 3HCSA 4BBQA 2N9GA 2CKLB 3G0JA 5EICA 1N87A 5CUBA 5COIA 5CS8A 3ZYUA 5FEYA 3LXJA 4LYIA 4Q6FA 2JMIA 4YYKA 5IGNA 4FIPA 5G4SA 3ONIA 5ENJA 2YQMA 3ZPV1 3LQIA 4O78A 5TABA 5FB1A 4MR6A 4YY6A 5L99A 4YY4A 4TYLA 5D3SA 1LDJB 2LRIC 2RSDA 5KO4A 4HBYA 5F61A 5KH3A 4UYGA 5KTUA 2CT2A 5DFDA 5D1KB 1ZS5A 4NN2A 3S91A 3NG2A 4KV1A 4UP5A 2KWNA 2OUOA 4X3GA 4HXLA 2YHOA 1WFKA 2R10A 3O34A 5FE3A 5I29A 3RPGC 4XI1A 2YYNA 4TQNA 5I7XA 4YBSA 4QSSA 4A9JA 3O35A 4BW2A 4Z1QA 4QSUA 5EPSA 2EGPA 2MD7B 4QSRA 4YYMA 3PUQA 4HXSA 5L8TA 1N72A 4QSVA 4QSXA 4QEUA 4YH3A 3I3JA 3U5LA 4XYAA 1VYXA 4FLPA 4XY9A 4QUUA 5B76A 4A9IA 4NUDA 2VPDA 2LV9A 4KV4A 4TT4A 5K29A 5C85A 4XY8A 2DKWA 5ETBA 2VPBA 5EYAF 4PKLA 5CUGA 5L96A 4AUQB 4J0RA 5D3JA 5DLZA 4UIXA 5CQTA 5ENGA 4A4BA 4O7FA 2DX8A 4J0SA 4O7AA 3M99A 4F52B 2L43A 5CQAA 4MENA 2YSMA 5DINA 2D9EA 5ENBA 3UV4A 4MSXA 3O33A 5IBNA 4GB0A 5CUAA 5EWDA 5LJ0A 4NR5A 4F3IA 4W4UA 5I83A 5KH7A 4O7BA 4R8PK 4NS5A 2H60A 2CKLA 3SHBA 1WUMA 4N4HA 5DW2A 5HFQA 2ECTA 2K17A 5A85A 5FE7A 4WA6A 3HCUA 4WIVA 4FO9A 2CSYA 4IR5A 5B78A 2FSAA 5A5NA 5EK9A 3SVFA 4CUPA 2ECGA 2KFTA 2XEUA 5CRZA 5E0RA 4NUEA 3M62A 3IHPA 1WEOA 5E9KA 1JOCA 5IGKA 5LKXA 5AITA 4V3LC 3KV5A 3L1XA 1E6IA 2YSJA 3GV4A 4LJNA 5F36A 5LKUA 2K4DA 5ETDA 5HLSA 3K2JA 5D24A 4LR6A 4MEPA 2PNXA 2E6RA 5F3AA 3RCWA 4NRAA 5DYAA 5AD3A 3N9LA 5E9VA 3UW9A 4O74A 2ZETC 5DX4A 4Z6HA 4QB3A 3ZVYA 3UVWA 4QR4A 4A49A 4NRBA 4YYNA 1V87A 5AIUA 5II2A 4O71A 4CUUA 4QR3A 2DVVA 5A5SA 1FP0A 4QF3A 4YAXA 3KV6A 2L5EA 5I3LA 5EPBA 5G04B 3QZSA 5AMEA 5F25A 1DVPA 1VFYA 3N9OA 4UIYA 4L7XA 2MD8C 4J1PA 4NYWA 4LADB 5FFVA 3I2DA 5A83A 5B79A 5DLXA 2R0YA 2KREA 3SOUA 2DVQA 2LQ6A 3ZPVE 1WEWA 4AYCA 5CZGA 3O36A 1LDKC 2KYUA 4O72A 4PY6A 4UYFB 3O70A 1WIMA 5EGUA 1T1HA 2YEKA 2CSZA 4LLBA 3GG3A 4NQMA 5DFBA 5CQ8A 4NRCA 2JRJA 4A9LA 4NYXA 3ZNIA 2YQDA 4AKNA 5HELA 4YABA 4TKPB 5BT3A 5TDWA 2HYED 3NXBA 3QZTA 4QUTA 5CQ3A 1WEVA 4A9EA 5L97A 1CHCA 5CFWA 5KU3A 2RFJA 5BT4A 2YUCA 2ECWA 5FE5A 5CPEA 3KQIA 4CUQA 5D3PA 2KWKA 4BJXA 4QEVA 4BW1A 2KIZA 4QF2A 5L8UA 2R0SA 4YK0A 3M63A 2LGLA 4WZ3B 3HMHA 5FG5A 2YREA 2EODA 1X0JA 3FKMX 1RMDA 5CGPA 5KH9A 2R0VA 2LGVA 5CTLA 2G6QA 5IG6A 4R2YA 5DKCA 4C67A 4CLBA 4A9MA 5HJCA 2LDRA 5H1TA 5H85A 4ZW1A 3U5PA 3LJWA 4QC3A 4CCGX 4IC3A 1MM2A 5FFYA 5I88A 4MR5A 5KTWA 5CQ4A 1K2FA 4LRGA 4O77A 5ENCA 5FE0A 4NUCA 4UP0A 3RTRB 2LXPC 5TRBA 1JM7B 4LYSA 2G43A 4FK5A 5I86A 5FERA 5FFWA 2MUMA 1JM4B 2E7OA 5D26A 4IR6A 4S3OC 4Z1SA 2ECIA 4YBTA 5HENA 5DYCA 5E3DA 5FE2A 3MB4A 4L58A 5DW1A 5G05B 4TT6A 3RPGB 5DKAA 4AVXA 4A9HA 3Q2EA 5I80A 4B7YC 2E3KA 4J3IA 1X4IA 2Y43A 2IDAA 5HRWA 3U5KA 4GNFA 5DY7A 2H0DB 5DBMA 5CQ5A 3JVMA 5EI4A 2FUUA 2L85A 3EB6A 4LK9A 5HM0A 4UYFA 1MM3A 3DQVR 2MJVB 2JMJA 2VJEB 5HQ5A 3EB5A 5FE4A 4NR7A 4WHUA 2DVSA 2VJFA 5TBNA 4B86C 2ECVA 5L98A 2YQLA 5J3XA 2NXBA 4TU4A 5HEMA 1U6GB 5ENHA 3PURA 3DPLR 2WP1A 5HCLA 4ZUXU 5D3TA 5CUEA 3SVGA 4V3KC 2RNXA 3IU5A 2EA6A 2G4AA 4LZ2A 4LKAA 5A81A 5CQ7A 3ZYQA 2JMDA 3QZVA 3D7CA 4UI9B 3JVLA 3MQMA 5FB0A 5F1LA 4I7BA 5CQ6A 2AN6A 2Y1MA 4RVRA 4IOOA 4Q0OA 5FH7A 2D82A 3MUKA 3MULA 2OO1A 5LUUA 4HXMA 4IR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOW A;  5I1Q A;  2FUI A;  3P1D A;  2I8N A;  5A7C A;  1XWH A;  5EWW A;  2Y1N A;  2F6J A;  4UIZ A;  5HRV A;  5EQ1 A;  3Q2F A;  5F5Z A;  4UIU A;  2LN0 A;  5BT5 A;  4E96 A;  4TZ2 A;  2MA5 A;  4QR5 A;  1JM7 A;  5C4Q A;  4ALH A;  4HXN A;  3MHH A;  4LZR A;  3N9P A;  2RI7 A;  4HBW A;  4NR8 A;  4QY4 A;  4PCE A;  5CU8 A;  2K1J A;  5AD2 A;  3N9Q A;  5FE8 A;  3C6W A;  3UV5 A;  3ZTG A;  4NR9 A;  2QJ0 A;  4HXP A;  4O7E A;  5CRM A;  1Z60 A;  2MIQ A;  5D25 A;  5ENI A;  3L1Z B;  2OSS A;  3UVY A;  3IU6 A;  5G4R A;  5D3H A;  4O64 A;  4A4C A;  3TLP A;  5TCM A;  5EV9 A;  3HME A;  2H0D A;  5F60 A;  5A5R A;  1WIL A;  4WHW A;  5EPR A;  4WZ2 A;  5E74 A;  4TU6 A;  4YYJ A;  5C8G A;  2G45 A;  5IGL A;  2VJE A;  4YAT A;  2YYR A;  4YH4 A;  2LGK A;  3KNV A;  4X2I A;  4YYH A;  4YYG A;  4QEW A;  5H1U A;  4MR3 A;  4Y03 A;  5DFC A;  2KTB B;  3ASL A;  1X4J A;  2RO1 A;  1WEU A;  4XUB A;  4CUS A;  5ENF A;  4DON A;  4BW3 A;  4IOQ A;  3P1F A;  5C89 A;  5EA1 A;  3SVH A;  3O7A A;  4GNE A;  2VP7 A;  2M3H A;  5D3L A;  2KR4 A;  2YDW A;  4PPE A;  4PTB A;  5LCW B;  5JI8 A;  3O37 A;  4UIT A;  3UV2 A;  2RS9 B;  5E9Y A;  4HXK A;  4CFL A;  2YUR A;  4IC2 A;  5B77 A;  5DYX A;  2MNY A;  5TDR A;  4UIV A;  4NQN A;  3LQH A;  4A9F A;  5AMF A;  4PS5 A;  1WEN A;  4LYW A;  4HBV A;  1ZBD B;  2QIZ A;  4GNG A;  5ACY A;  2L5U A;  3GL6 A;  5G0F A;  3AAD A;  1X4U A;  5DKD A;  4LC2 A;  4IR4 A;  2DAT A;  3PHD A;  5JWM A;  3U5M A;  3G0L A;  5E9I A;  4TS8 A;  4N4I A;  4N4G A;  4QYD A;  5CY9 A;  3LQJ A;  1Z6U A;  2XB1 A;  4YBM A;  2YHN A;  4O70 A;  4QST A;  2DVR A;  1FBV A;  5E7D A;  2M6M A;  5EWH A;  2GRC A;  5FG4 A;  4ZDT A;  2BAY A;  4OUF A;  4NR4 A;  3T7L A;  2ECJ A;  1HYI A;  4I7D A;  5ENE A;  3JVK A;  4YYI A;  4HBX A;  5E9M A;  5LJ2 A;  1WUG A;  5E3G A;  5EWC A;  4AP4 A;  4I7C A;  5C87 A;  4GND A;  4NYV A;  4C66 A;  3UVD A;  2VPE A;  5KTX A;  2DWW A;  3HMF A;  3N9M A;  5A82 A;  4WZ0 A;  2LXH C;  5FG6 A;  4UYE A;  4OGI A;  2E7N A;  5J0D A;  5LKZ A;  2F42 A;  2KWO A;  3L11 A;  4BW4 A;  4C9Z A;  5D7X A;  4LDF A;  5I7Y A;  5LVQ A;  1WEP A;  2YEL A;  4S3O B;  5C7N A;  4Z93 A;  4ALG A;  2L0B A;  4A0C D;  4NXJ A;  5HRX A;  3MXF A;  3MB3 A;  3UVX A;  5A5O A;  4AYC B;  5E9L A;  1WES A;  3P5O A;  5D3N A;  1JSP B;  2I7K A;  2MA6 A;  3JVJ A;  5B8D A;  5E73 A;  4QC1 A;  3U5J A;  1F68 A;  5DYU A;  5C13 A;  4A9N A;  3U5N A;  5D1L B;  5CUC A;  2LSP B;  2YW8 A;  1EQF A;  2YT5 A;  4HXR A;  2L84 A;  4CL9 A;  3HTK C;  4MEO A;  1BOR A;  4P5O B;  3VK6 A;  4QSW A;  4TT2 A;  5FE1 A;  2I50 A;  5F2P A;  2C2V S;  4LZS A;  3N9N A;  2WP2 A;  2MT5 A;  4UYH A;  4HXO A;  4A9O A;  5A5Q A;  5HFR A;  3DAI A;  4IOR A;  4N3W A;  2LGG A;  2E6S A;  3SOX A;  5I89 A;  5JG6 A;  2QIC A;  3V43 A;  2K16 A;  5EM3 A;  4O75 A;  5D3R A;  4QYL A;  4KCX A;  5FH6 A;  3P1E A;  4QZS A;  4BHW A;  4FJC A;  3C5K A;  4CUR A;  4MR4 A;  4OGJ A;  4GPJ A;  1G25 A;  2M85 A;  5H1V A;  4Q0N A;  2NAA A;  5FE6 A;  5EP7 A;  5DKH A;  4YAD A;  1VD4 A;  5CUD A;  4CFK A;  4A9K A;  1E4U A;  2UZG A;  5EVA A;  4N4F A;  1WGM A;  2YEM A;  4QBM A;  3AQA A;  5D1M B;  4UYD A;  2MNZ A;  2RNW A;  2F6N A;  4Z6I A;  2KGI A;  5LJ1 A;  2KWJ A;  2KU3 A;  4CA1 A;  2HDP A;  5EIS A;  5B75 A;  5FE9 A;  4O76 A;  5F63 A;  2M1R A;  2VNF A;  3LRQ A;  4CUT A;  5TB6 A;  4QNS A;  2KGG A;  4R7E A;  4MEQ A;  5EU1 A;  5HQ7 A;  1Z2Q A;  5II1 A;  1WEM A;  5FBX A;  5A5P A;  5KHM A;  1WEE A;  2ECN A;  5IID A;  1F62 A;  4QSP A;  3S92 A;  4UIW A;  4XUA A;  4YYD A;  1WEQ A;  2L75 A;  5C11 A;  2RNY A;  2VPG A;  4ZC9 A;  4TZ8 A;  5F62 A;  2KE1 A;  3T6R A;  4YC9 A;  3U5O A;  2PUY A;  5IGM A;  2YU4 A;  1HYJ A;  1IYM A;  3FL2 A;  2OXQ C;  4O7C A;  5I40 A;  5LKT A;  5F1H A;  2D8S A;  5LVR A;  2YW5 A;  3P1C A;  2L80 A;  5CP5 A;  5FDZ A;  5FH8 A;  4NR6 A;  4ZQL A;  2VJF B;  5EWV A;  5H9M A;  2C2L A;  3HCT A;  1WE9 A;  3DWY A;  3MHS A;  5D0C A;  4TTE A;  5HQ6 A;  4QSQ A;  4MVT A;  4PCI A;  3ZVZ B;  3HCS A;  4BBQ A;  2N9G A;  2CKL B;  3G0J A;  5EIC A;  1N87 A;  5CUB A;  5COI A;  5CS8 A;  3ZYU A;  5FEY A;  3LXJ A;  4LYI A;  4Q6F A;  2JMI A;  4YYK A;  5IGN A;  4FIP A;  5G4S A;  3ONI A;  5ENJ A;  2YQM A;  3ZPV 1;  3LQI A;  4O78 A;  5TAB A;  5FB1 A;  4MR6 A;  4YY6 A;  5L99 A;  4YY4 A;  4TYL A;  5D3S A;  1LDJ B;  2LRI C;  2RSD A;  5KO4 A;  4HBY A;  5F61 A;  5KH3 A;  4UYG A;  5KTU A;  2CT2 A;  5DFD A;  5D1K B;  1ZS5 A;  4NN2 A;  3S91 A;  3NG2 A;  4KV1 A;  4UP5 A;  2KWN A;  2OUO A;  4X3G A;  4HXL A;  2YHO A;  1WFK A;  2R10 A;  3O34 A;  5FE3 A;  5I29 A;  3RPG C;  4XI1 A;  2YYN A;  4TQN A;  5I7X A;  4YBS A;  4QSS A;  4A9J A;  3O35 A;  4BW2 A;  4Z1Q A;  4QSU A;  5EPS A;  2EGP A;  2MD7 B;  4QSR A;  4YYM A;  3PUQ A;  4HXS A;  5L8T A;  1N72 A;  4QSV A;  4QSX A;  4QEU A;  4YH3 A;  3I3J A;  3U5L A;  4XYA A;  1VYX A;  4FLP A;  4XY9 A;  4QUU A;  5B76 A;  4A9I A;  4NUD A;  2VPD A;  2LV9 A;  4KV4 A;  4TT4 A;  5K29 A;  5C85 A;  4XY8 A;  2DKW A;  5ETB A;  2VPB A;  5EYA F;  4PKL A;  5CUG A;  5L96 A;  4AUQ B;  4J0R A;  5D3J A;  5DLZ A;  4UIX A;  5CQT A;  5ENG A;  4A4B A;  4O7F A;  2DX8 A;  4J0S A;  4O7A A;  3M99 A;  4F52 B;  2L43 A;  5CQA A;  4MEN A;  2YSM A;  5DIN A;  2D9E A;  5ENB A;  3UV4 A;  4MSX A;  3O33 A;  5IBN A;  4GB0 A;  5CUA A;  5EWD A;  5LJ0 A;  4NR5 A;  4F3I A;  4W4U A;  5I83 A;  5KH7 A;  4O7B A;  4R8P K;  4NS5 A;  2H60 A;  2CKL A;  3SHB A;  1WUM A;  4N4H A;  5DW2 A;  5HFQ A;  2ECT A;  2K17 A;  5A85 A;  5FE7 A;  4WA6 A;  3HCU A;  4WIV A;  4FO9 A;  2CSY A;  4IR5 A;  5B78 A;  2FSA A;  5A5N A;  5EK9 A;  3SVF A;  4CUP A;  2ECG A;  2KFT A;  2XEU A;  5CRZ A;  5E0R A;  4NUE A;  3M62 A;  3IHP A;  1WEO A;  5E9K A;  1JOC A;  5IGK A;  5LKX A;  5AIT A;  4V3L C;  3KV5 A;  3L1X A;  1E6I A;  2YSJ A;  3GV4 A;  4LJN A;  5F36 A;  5LKU A;  2K4D A;  5ETD A;  5HLS A;  3K2J A;  5D24 A;  4LR6 A;  4MEP A;  2PNX A;  2E6R A;  5F3A A;  3RCW A;  4NRA A;  5DYA A;  5AD3 A;  3N9L A;  5E9V A;  3UW9 A;  4O74 A;  2ZET C;  5DX4 A;  4Z6H A;  4QB3 A;  3ZVY A;  3UVW A;  4QR4 A;  4A49 A;  4NRB A;  4YYN A;  1V87 A;  5AIU A;  5II2 A;  4O71 A;  4CUU A;  4QR3 A;  2DVV A;  5A5S A;  1FP0 A;  4QF3 A;  4YAX A;  3KV6 A;  2L5E A;  5I3L A;  5EPB A;  5G04 B;  3QZS A;  5AME A;  5F25 A;  1DVP A;  1VFY A;  3N9O A;  4UIY A;  4L7X A;  2MD8 C;  4J1P A;  4NYW A;  4LAD B;  5FFV A;  3I2D A;  5A83 A;  5B79 A;  5DLX A;  2R0Y A;  2KRE A;  3SOU A;  2DVQ A;  2LQ6 A;  3ZPV E;  1WEW A;  4AYC A;  5CZG A;  3O36 A;  1LDK C;  2KYU A;  4O72 A;  4PY6 A;  4UYF B;  3O70 A;  1WIM A;  5EGU A;  1T1H A;  2YEK A;  2CSZ A;  4LLB A;  3GG3 A;  4NQM A;  5DFB A;  5CQ8 A;  4NRC A;  2JRJ A;  4A9L A;  4NYX A;  3ZNI A;  2YQD A;  4AKN A;  5HEL A;  4YAB A;  4TKP B;  5BT3 A;  5TDW A;  2HYE D;  3NXB A;  3QZT A;  4QUT A;  5CQ3 A;  1WEV A;  4A9E A;  5L97 A;  1CHC A;  5CFW A;  5KU3 A;  2RFJ A;  5BT4 A;  2YUC A;  2ECW A;  5FE5 A;  5CPE A;  3KQI A;  4CUQ A;  5D3P A;  2KWK A;  4BJX A;  4QEV A;  4BW1 A;  2KIZ A;  4QF2 A;  5L8U A;  2R0S A;  4YK0 A;  3M63 A;  2LGL A;  4WZ3 B;  3HMH A;  5FG5 A;  2YRE A;  2EOD A;  1X0J A;  3FKM X;  1RMD A;  5CGP A;  5KH9 A;  2R0V A;  2LGV A;  5CTL A;  2G6Q A;  5IG6 A;  4R2Y A;  5DKC A;  4C67 A;  4CLB A;  4A9M A;  5HJC A;  2LDR A;  5H1T A;  5H85 A;  4ZW1 A;  3U5P A;  3LJW A;  4QC3 A;  4CCG X;  4IC3 A;  1MM2 A;  5FFY A;  5I88 A;  4MR5 A;  5KTW A;  5CQ4 A;  1K2F A;  4LRG A;  4O77 A;  5ENC A;  5FE0 A;  4NUC A;  4UP0 A;  3RTR B;  2LXP C;  5TRB A;  1JM7 B;  4LYS A;  2G43 A;  4FK5 A;  5I86 A;  5FER A;  5FFW A;  2MUM A;  1JM4 B;  2E7O A;  5D26 A;  4IR6 A;  4S3O C;  4Z1S A;  2ECI A;  4YBT A;  5HEN A;  5DYC A;  5E3D A;  5FE2 A;  3MB4 A;  4L58 A;  5DW1 A;  5G05 B;  4TT6 A;  3RPG B;  5DKA A;  4AVX A;  4A9H A;  3Q2E A;  5I80 A;  4B7Y C;  2E3K A;  4J3I A;  1X4I A;  2Y43 A;  2IDA A;  5HRW A;  3U5K A;  4GNF A;  5DY7 A;  2H0D B;  5DBM A;  5CQ5 A;  3JVM A;  5EI4 A;  2FUU A;  2L85 A;  3EB6 A;  4LK9 A;  5HM0 A;  4UYF A;  1MM3 A;  3DQV R;  2MJV B;  2JMJ A;  2VJE B;  5HQ5 A;  3EB5 A;  5FE4 A;  4NR7 A;  4WHU A;  2DVS A;  2VJF A;  5TBN A;  4B86 C;  2ECV A;  5L98 A;  2YQL A;  5J3X A;  2NXB A;  4TU4 A;  5HEM A;  1U6G B;  5ENH A;  3PUR A;  3DPL R;  2WP1 A;  5HCL A;  4ZUX U;  5D3T A;  5CUE A;  3SVG A;  4V3K C;  2RNX A;  3IU5 A;  2EA6 A;  2G4A A;  4LZ2 A;  4LKA A;  5A81 A;  5CQ7 A;  3ZYQ A;  2JMD A;  3QZV A;  3D7C A;  4UI9 B;  3JVL A;  3MQM A;  5FB0 A;  5F1L A;  4I7B A;  5CQ6 A;  2AN6 A;  2Y1M A;  4RVR A;  4IOO A;  4Q0O A;  5FH7 A;  2D82 A;  3MUK A;  3MUL A;  2OO1 A;  5LUU A;  4HXM A;  4IR3 A; 
#chains in the Genus database with same CATH topology
 3SOW A;  5I1Q A;  2FUI A;  3P1D A;  2I8N A;  5A7C A;  1XWH A;  5EWW A;  2Y1N A;  2F6J A;  4UIZ A;  5HRV A;  5EQ1 A;  3Q2F A;  5F5Z A;  4UIU A;  2LN0 A;  5BT5 A;  4E96 A;  4TZ2 A;  2MA5 A;  4QR5 A;  1JM7 A;  5C4Q A;  4ALH A;  4HXN A;  2FD4 A;  3MHH A;  4LZR A;  3N9P A;  2RI7 A;  4HBW A;  4NR8 A;  4QY4 A;  4PCE A;  5CU8 A;  4F1P A;  2K1J A;  5AD2 A;  3N9Q A;  5FE8 A;  3C6W A;  3UV5 A;  3ZTG A;  4NR9 A;  2IQJ A;  2QJ0 A;  4HXP A;  4O7E A;  5CRM A;  1Z60 A;  2MIQ A;  5D25 A;  5ENI A;  3L1Z B;  2OSS A;  3UVY A;  3IU6 A;  5G4R A;  5D3H A;  4O64 A;  4A4C A;  3TLP A;  5TCM A;  5EV9 A;  3HME A;  1MBM A;  2H0D A;  5F60 A;  5A5R A;  1WIL A;  4WHW A;  5EPR A;  4WZ2 A;  5E74 A;  4TU6 A;  4YYJ A;  5C8G A;  2G45 A;  5IGL A;  2VJE A;  4YAT A;  2YYR A;  4YH4 A;  2LGK A;  3KNV A;  4X2I A;  4YYH A;  4YYG A;  4QEW A;  2JUN A;  5H1U A;  4MR3 A;  4Y03 A;  5DFC A;  2KTB B;  3ASL A;  1X4J A;  2RO1 A;  1WEU A;  4XUB A;  4CUS A;  5ENF A;  4DON A;  4BW3 A;  4IOQ A;  3FAN A;  3P1F A;  5C89 A;  5EA1 A;  3SVH A;  3O7A A;  4GNE A;  2VP7 A;  2M3H A;  5D3L A;  2KR4 A;  2YDW A;  4PPE A;  4PTB A;  5LCW B;  5JI8 A;  3O37 A;  4UIT A;  3UV2 A;  2RS9 B;  5E9Y A;  4HXK A;  4CFL A;  2YUR A;  4IC2 A;  5B77 A;  5DYX A;  2MNY A;  5TDR A;  4UIV A;  4NQN A;  3LQH A;  4A9F A;  5AMF A;  4PS5 A;  1WEN A;  4LYW A;  4HBV A;  1ZBD B;  2QIZ A;  4GNG A;  5ACY A;  2L5U A;  3D1B A;  3GL6 A;  5G0F A;  3AAD A;  1X4U A;  5DKD A;  4LC2 A;  4IR4 A;  2DAT A;  3PHD A;  5JWM A;  3U5M A;  3G0L A;  5E9I A;  4TS8 A;  4N4I A;  4N4G A;  4QYD A;  5CY9 A;  3LQJ A;  1Z6U A;  2XB1 A;  4YBM A;  2YHN A;  4O70 A;  4QST A;  2L7P A;  2XOY A;  2DVR A;  1FBV A;  5E7D A;  2M6M A;  3Q1D A;  5EWH A;  2OWA A;  2GRC A;  5FG4 A;  4ZDT A;  2BAY A;  4OUF A;  4NR4 A;  3T7L A;  2ECJ A;  1HYI A;  4I7D A;  5ENE A;  3JVK A;  4YYI A;  4HBX A;  5E9M A;  5LJ2 A;  1WUG A;  5E3G A;  2FFW A;  3FM8 C;  5EWC A;  4AP4 A;  4I7C A;  5C87 A;  4GND A;  4AKH A;  4NYV A;  4C66 A;  3UVD A;  2VPE A;  5KTX A;  2DWW A;  3HMF A;  3N9M A;  5A82 A;  4WZ0 A;  2CON A;  2LXH C;  5FG6 A;  4UYE A;  4OGI A;  2E7N A;  5J0D A;  5LKZ A;  2F42 A;  2KWO A;  3L11 A;  4BW4 A;  3MDB C;  4C9Z A;  5D7X A;  4LDF A;  5I7Y A;  5LVQ A;  1WEP A;  1ZKR A;  2YEL A;  4S3O B;  5C7N A;  4Z93 A;  4ALG A;  2L0B A;  4A0C D;  4NXJ A;  2KKX A;  5HRX A;  3MXF A;  2XOC A;  2XOZ A;  3MB3 A;  3UVX A;  5A5O A;  4AYC B;  5E9L A;  1WES A;  3P5O A;  5D3N A;  1JSP B;  2I7K A;  2MA6 A;  3JVJ A;  3SUB A;  5B8D A;  5E73 A;  4QC1 A;  3U5J A;  1F68 A;  5DYU A;  5C13 A;  4A9N A;  3U5N A;  5D1L B;  5CUC A;  2LSP B;  2YW8 A;  1EQF A;  2YT5 A;  4HXR A;  2L84 A;  4CL9 A;  3HTK C;  4MEO A;  1BOR A;  4P5O B;  3VK6 A;  4QSW A;  2DJA A;  4AKI A;  4TT2 A;  5FE1 A;  2I50 A;  5F2P A;  2C2V S;  4LZS A;  3N9N A;  2WP2 A;  2MT5 A;  4UYH A;  4HXO A;  4A9O A;  5A5Q A;  5HFR A;  3DAI A;  4IOR A;  4N3W A;  2LGG A;  2E6S A;  3SOX A;  5I89 A;  5JG6 A;  2QIC A;  3V43 A;  2K16 A;  5EM3 A;  4O75 A;  5D3R A;  4QYL A;  4KCX A;  5FH6 A;  3P1E A;  4QZS A;  4BHW A;  3FJU B;  3C5K A;  4FJC A;  4CUR A;  4MR4 A;  4OGJ A;  4GPJ A;  1G25 A;  2M85 A;  5H1V A;  4Q0N A;  3D1D A;  2NAA A;  5FE6 A;  5EP7 A;  5DKH A;  4YAD A;  1VD4 A;  5CUD A;  4CFK A;  4A9K A;  1E4U A;  2UZG A;  5EVA A;  4N4F A;  1WGM A;  2YEM A;  4QBM A;  3AQA A;  5D1M B;  4UYD A;  2MNZ A;  2RNW A;  2F6N A;  4Z6I A;  2KGI A;  3KDE C;  5LJ1 A;  2KWJ A;  2KU3 A;  4CA1 A;  2HDP A;  2MKE A;  5EIS A;  5B75 A;  5FE9 A;  4O76 A;  5F63 A;  2M1R A;  2VNF A;  3LRQ A;  4CUT A;  4O62 A;  5TB6 A;  4QNS A;  2D8U A;  2KGG A;  4R7E A;  4MEQ A;  5EU1 A;  5HQ7 A;  1Z2Q A;  5II1 A;  1WEM A;  5FBX A;  5A5P A;  5KHM A;  1WEE A;  2ECN A;  5IID A;  1F62 A;  4QSP A;  3S92 A;  4UIW A;  4XUA A;  4YYD A;  5SVI B;  1WEQ A;  2L75 A;  5C11 A;  2RNY A;  2VPG A;  4ZC9 A;  4TZ8 A;  5F62 A;  2KE1 A;  3T6R A;  4YC9 A;  4AKG A;  3U5O A;  2PUY A;  5IGM A;  2YU4 A;  1HYJ A;  1IYM A;  3FL2 A;  2OXQ C;  4O7C A;  5I40 A;  5LKT A;  5F1H A;  2CSV A;  2D8S A;  5LVR A;  2YW5 A;  3P1C A;  2L80 A;  3H7H A;  5CP5 A;  5FDZ A;  5FH8 A;  4NR6 A;  4ZQL A;  2VJF B;  5EWV A;  5H9M A;  2C2L A;  3HCT A;  1WE9 A;  3DWY A;  3MHS A;  5D0C A;  4TTE A;  5HQ6 A;  4QSQ A;  2XP0 A;  4MVT A;  4PCI A;  3ZVZ B;  3HCS A;  4BBQ A;  2N9G A;  2CKL B;  3G0J A;  5EIC A;  1N87 A;  5CUB A;  5COI A;  5CS8 A;  3ZYU A;  5FEY A;  3LXJ A;  4LYI A;  4Q6F A;  2JMI A;  4YYK A;  5IGN A;  4FIP A;  4Z0R A;  5G4S A;  3ONI A;  5ENJ A;  2YQM A;  3ZPV 1;  3LQI A;  4O78 A;  5TAB A;  5FB1 A;  4MR6 A;  4YY6 A;  5L99 A;  2B0O E;  4YY4 A;  4TYL A;  4AI6 A;  3LJU X;  5D3S A;  1LDJ B;  2LRI C;  2RSD A;  5KO4 A;  4HBY A;  5F61 A;  5KH3 A;  3LDY A;  4UYG A;  5KTU A;  2CT2 A;  5DFD A;  5D1K B;  1ZS5 A;  4NN2 A;  3S91 A;  3NG2 A;  4KV1 A;  4UP5 A;  2KWN A;  2OUO A;  4X3G A;  4HXL A;  2YHO A;  1WFK A;  2R10 A;  3O34 A;  5FE3 A;  5I29 A;  3RPG C;  4XI1 A;  2YYN A;  4TQN A;  5I7X A;  4YBS A;  4QSS A;  4A9J A;  3O35 A;  4BW2 A;  4Z1Q A;  4QSU A;  5EPS A;  2EGP A;  2MD7 B;  4QSR A;  4YYM A;  3PUQ A;  4HXS A;  3O47 A;  5L8T A;  1N72 A;  4QSV A;  4QSX A;  4QEU A;  4YH3 A;  3I3J A;  3U5L A;  4XYA A;  1VYX A;  4FLP A;  4XY9 A;  4QUU A;  4OGE A;  5B76 A;  4A9I A;  4NUD A;  2VPD A;  2LV9 A;  4KV4 A;  4TT4 A;  5K29 A;  2YVR A;  5C85 A;  4XY8 A;  2DKW A;  5ETB A;  2VPB A;  2DSM A;  5EYA F;  5SVI A;  4PKL A;  5CUG A;  5L96 A;  4AUQ B;  4J0R A;  5D3J A;  5DLZ A;  4UIX A;  5CQT A;  5ENG A;  4A4B A;  4O7F A;  2DX8 A;  4J0S A;  4O7A A;  3DWD A;  3M99 A;  4F52 B;  2L43 A;  5CQA A;  4MEN A;  2YSM A;  5DIN A;  2D9E A;  5ENB A;  3UV4 A;  4MSX A;  3O33 A;  5IBN A;  4GB0 A;  5CUA A;  5EWD A;  5LJ0 A;  4NR5 A;  4F3I A;  4W4U A;  5I83 A;  5KH7 A;  4O7B A;  4R8P K;  4QQ4 A;  4NS5 A;  2H60 A;  2CKL A;  3SHB A;  1WUM A;  4N4H A;  3VKH A;  5DW2 A;  5HFQ A;  2ECT A;  2K17 A;  5A85 A;  5FE7 A;  4WA6 A;  3HCU A;  4WIV A;  4FO9 A;  2CSY A;  4IR5 A;  5B78 A;  2FSA A;  5A5N A;  5EK9 A;  3SVF A;  4CUP A;  2ECG A;  2KFT A;  2RR4 A;  2XEU A;  5CRZ A;  5E0R A;  4NUE A;  3M62 A;  3IHP A;  2EGM A;  1WEO A;  5E9K A;  1JOC A;  5IGK A;  5LKX A;  5AIT A;  4V3L C;  3KV5 A;  3L1X A;  1E6I A;  2YSJ A;  3GV4 A;  5SVY A;  4LJN A;  5F36 A;  5LKU A;  2K4D A;  5ETD A;  5HLS A;  3K2J A;  5D24 A;  4LR6 A;  4MEP A;  2PNX A;  5SVX A;  2E6R A;  5F3A A;  2EJN A;  3RCW A;  4NRA A;  5DYA A;  5AD3 A;  3N9L A;  5E9V A;  3UW9 A;  3ERR A;  4O74 A;  2ZET C;  5DX4 A;  4Z6H A;  4QB3 A;  3ZVY A;  3UVW A;  4QR4 A;  4A49 A;  4NRB A;  3JUE A;  4YYN A;  1V87 A;  5AIU A;  5II2 A;  4O71 A;  4CUU A;  2E61 A;  4QR3 A;  2DVV A;  5A5S A;  1FP0 A;  3LVQ E;  4QF3 A;  4YAX A;  3KV6 A;  2L5E A;  5I3L A;  5EPB A;  5G04 B;  3QZS A;  5AME A;  5F25 A;  1DVP A;  1VFY A;  3N9O A;  4UIY A;  4L7X A;  2MD8 C;  4J1P A;  4NYW A;  4LAD B;  5FFV A;  3I2D A;  5A83 A;  5B79 A;  5DLX A;  2R0Y A;  1DCQ A;  2KRE A;  3SOU A;  2DVQ A;  1PUO A;  2LQ6 A;  3ZPV E;  1WEW A;  4AYC A;  5CZG A;  3O36 A;  1LDK C;  2KYU A;  4O72 A;  4PY6 A;  4UYF B;  3O70 A;  1WIM A;  5EGU A;  1T1H A;  2YEK A;  2CSZ A;  4LLB A;  2JM3 A;  3GG3 A;  4NQM A;  5DFB A;  5CQ8 A;  4NRC A;  2JRJ A;  4A9L A;  4NYX A;  3ZNI A;  2M13 A;  2YQD A;  4AKN A;  5HEL A;  4YAB A;  4TKP B;  5BT3 A;  5TDW A;  2HYE D;  3NXB A;  3QZT A;  4QUT A;  5CQ3 A;  1WEV A;  4A9E A;  5L97 A;  1CHC A;  5CFW A;  5KU3 A;  2RFJ A;  5BT4 A;  2YUC A;  2ECW A;  5FE5 A;  5CPE A;  3KQI A;  4CUQ A;  5D3P A;  2KWK A;  4BJX A;  3PLW A;  4QEV A;  2LAU A;  4BW1 A;  2KIZ A;  4QF2 A;  2P57 A;  5L8U A;  2R0S A;  4YK0 A;  3M63 A;  2LGL A;  4WZ3 B;  3HMH A;  5FG5 A;  2YRE A;  2CRW A;  2EOD A;  1X0J A;  3FKM X;  1RMD A;  5CGP A;  5KH9 A;  2R0V A;  2LGV A;  5CTL A;  2G6Q A;  5IG6 A;  4R2Y A;  5DKC A;  4C67 A;  4CLB A;  4A9M A;  5HJC A;  2LDR A;  5H1T A;  5H85 A;  4ZW1 A;  3U5P A;  3LJW A;  4QC3 A;  4CCG X;  4IC3 A;  1MM2 A;  5FFY A;  5I88 A;  4MR5 A;  4H9D A;  5KTW A;  5CQ4 A;  1K2F A;  3LVR E;  4LRG A;  4O77 A;  5ENC A;  5FE0 A;  4NUC A;  4UP0 A;  5K3Q A;  2LXP C;  5TRB A;  3RTR B;  1JM7 B;  3DDT A;  3M7K A;  4LYS A;  2G43 A;  4FK5 A;  5I86 A;  5FER A;  2EXU A;  5FFW A;  2MUM A;  1JM4 B;  2E7O A;  5D26 A;  4IR6 A;  4S3O C;  4Z1S A;  2ECI A;  4YBT A;  2KKY A;  3T9K A;  5HEN A;  5DYC A;  5E3D A;  5FE2 A;  3MB4 A;  3VKG A;  4L58 A;  5DW1 A;  5G05 B;  4TT6 A;  3E2D A;  3RPG B;  5DKA A;  4AVX A;  4A9H A;  3Q2E A;  5I80 A;  4B7Y C;  2E3K A;  4J3I A;  1X4I A;  2CRR A;  2Y43 A;  2IDA A;  5HRW A;  3U5K A;  4GNF A;  5DY7 A;  2H0D B;  5DBM A;  5CQ5 A;  3JVM A;  5EI4 A;  2FUU A;  2L85 A;  3EB6 A;  4LK9 A;  5HM0 A;  4UYF A;  1MM3 A;  3DQV R;  2MJV B;  2JMJ A;  2VJE B;  5HQ5 A;  3EB5 A;  5FE4 A;  4NR7 A;  4WHU A;  2DVS A;  2VJF A;  5TBN A;  3FAO A;  4B86 C;  2ECV A;  5L98 A;  2YQL A;  5J3X A;  2NXB A;  4TU4 A;  5HEM A;  1U6G B;  5ENH A;  3PUR A;  3DPL R;  2WP1 A;  5HCL A;  4ZUX U;  5D3T A;  5CUE A;  3SVG A;  4V3K C;  2RNX A;  3IU5 A;  2EA6 A;  2G4A A;  4LZ2 A;  4LKA A;  5A81 A;  5CQ7 A;  3ZYQ A;  4OGC A;  2JMD A;  3QZV A;  3D7C A;  4UI9 B;  3JVL A;  3MQM A;  5FB0 A;  5F1L A;  4I7B A;  5CQ6 A;  2AN6 A;  2Y1M A;  4Z0O A;  3FEH A;  4RVR A;  4IOO A;  4Q0O A;  5FH7 A;  2D82 A;  3MUK A;  3MUL A;  2OO1 A;  5LUU A;  4HXM A;  4IR3 A; 
#chains in the Genus database with same CATH homology
 3SOW A;  5I1Q A;  2FUI A;  3P1D A;  2I8N A;  5A7C A;  1XWH A;  5EWW A;  2Y1N A;  2F6J A;  4UIZ A;  5HRV A;  5EQ1 A;  3Q2F A;  5F5Z A;  4UIU A;  2LN0 A;  5BT5 A;  4E96 A;  4TZ2 A;  2MA5 A;  4QR5 A;  1JM7 A;  5C4Q A;  4ALH A;  4HXN A;  3MHH A;  4LZR A;  3N9P A;  2RI7 A;  4HBW A;  4NR8 A;  4QY4 A;  4PCE A;  5CU8 A;  2K1J A;  5AD2 A;  3N9Q A;  5FE8 A;  3C6W A;  3UV5 A;  3ZTG A;  4NR9 A;  2QJ0 A;  4HXP A;  4O7E A;  5CRM A;  1Z60 A;  2MIQ A;  5D25 A;  5ENI A;  3L1Z B;  2OSS A;  3UVY A;  3IU6 A;  5G4R A;  5D3H A;  4O64 A;  4A4C A;  3TLP A;  5TCM A;  5EV9 A;  3HME A;  2H0D A;  5F60 A;  5A5R A;  1WIL A;  4WHW A;  5EPR A;  4WZ2 A;  5E74 A;  4TU6 A;  4YYJ A;  5C8G A;  2G45 A;  5IGL A;  2VJE A;  4YAT A;  2YYR A;  4YH4 A;  2LGK A;  3KNV A;  4X2I A;  4YYH A;  4YYG A;  4QEW A;  5H1U A;  4MR3 A;  4Y03 A;  5DFC A;  2KTB B;  3ASL A;  1X4J A;  2RO1 A;  1WEU A;  4XUB A;  4CUS A;  5ENF A;  4DON A;  4BW3 A;  4IOQ A;  3P1F A;  5C89 A;  5EA1 A;  3SVH A;  3O7A A;  4GNE A;  2VP7 A;  2M3H A;  5D3L A;  2KR4 A;  2YDW A;  4PPE A;  4PTB A;  5LCW B;  5JI8 A;  3O37 A;  4UIT A;  3UV2 A;  2RS9 B;  5E9Y A;  4HXK A;  4CFL A;  2YUR A;  4IC2 A;  5B77 A;  5DYX A;  2MNY A;  5TDR A;  4UIV A;  4NQN A;  3LQH A;  4A9F A;  5AMF A;  4PS5 A;  1WEN A;  4LYW A;  4HBV A;  1ZBD B;  2QIZ A;  4GNG A;  5ACY A;  2L5U A;  3GL6 A;  5G0F A;  3AAD A;  1X4U A;  5DKD A;  4LC2 A;  4IR4 A;  2DAT A;  3PHD A;  5JWM A;  3U5M A;  3G0L A;  5E9I A;  4TS8 A;  4N4I A;  4N4G A;  4QYD A;  5CY9 A;  3LQJ A;  1Z6U A;  2XB1 A;  4YBM A;  2YHN A;  4O70 A;  4QST A;  2DVR A;  1FBV A;  5E7D A;  2M6M A;  5EWH A;  2GRC A;  5FG4 A;  4ZDT A;  2BAY A;  4OUF A;  4NR4 A;  3T7L A;  2ECJ A;  1HYI A;  4I7D A;  5ENE A;  3JVK A;  4YYI A;  4HBX A;  5E9M A;  5LJ2 A;  1WUG A;  5E3G A;  5EWC A;  4AP4 A;  4I7C A;  5C87 A;  4GND A;  4NYV A;  4C66 A;  3UVD A;  2VPE A;  5KTX A;  2DWW A;  3HMF A;  3N9M A;  5A82 A;  4WZ0 A;  2LXH C;  5FG6 A;  4UYE A;  4OGI A;  2E7N A;  5J0D A;  5LKZ A;  2F42 A;  2KWO A;  3L11 A;  4BW4 A;  4C9Z A;  5D7X A;  4LDF A;  5I7Y A;  5LVQ A;  1WEP A;  2YEL A;  4S3O B;  5C7N A;  4Z93 A;  4ALG A;  2L0B A;  4A0C D;  4NXJ A;  5HRX A;  3MXF A;  3MB3 A;  3UVX A;  5A5O A;  4AYC B;  5E9L A;  1WES A;  3P5O A;  5D3N A;  1JSP B;  2I7K A;  2MA6 A;  3JVJ A;  5B8D A;  5E73 A;  4QC1 A;  3U5J A;  1F68 A;  5DYU A;  5C13 A;  4A9N A;  3U5N A;  5D1L B;  5CUC A;  2LSP B;  2YW8 A;  1EQF A;  2YT5 A;  4HXR A;  2L84 A;  4CL9 A;  3HTK C;  4MEO A;  1BOR A;  4P5O B;  3VK6 A;  4QSW A;  4TT2 A;  5FE1 A;  2I50 A;  5F2P A;  2C2V S;  4LZS A;  3N9N A;  2WP2 A;  2MT5 A;  4UYH A;  4HXO A;  4A9O A;  5A5Q A;  5HFR A;  3DAI A;  4IOR A;  4N3W A;  2LGG A;  2E6S A;  3SOX A;  5I89 A;  5JG6 A;  2QIC A;  3V43 A;  2K16 A;  5EM3 A;  4O75 A;  5D3R A;  4QYL A;  4KCX A;  5FH6 A;  3P1E A;  4QZS A;  4BHW A;  4FJC A;  3C5K A;  4CUR A;  4MR4 A;  4OGJ A;  4GPJ A;  1G25 A;  2M85 A;  5H1V A;  4Q0N A;  2NAA A;  5FE6 A;  5EP7 A;  5DKH A;  4YAD A;  1VD4 A;  5CUD A;  4CFK A;  4A9K A;  1E4U A;  2UZG A;  5EVA A;  4N4F A;  1WGM A;  2YEM A;  4QBM A;  3AQA A;  5D1M B;  4UYD A;  2MNZ A;  2RNW A;  2F6N A;  4Z6I A;  2KGI A;  5LJ1 A;  2KWJ A;  2KU3 A;  4CA1 A;  2HDP A;  5EIS A;  5B75 A;  5FE9 A;  4O76 A;  5F63 A;  2M1R A;  2VNF A;  3LRQ A;  4CUT A;  5TB6 A;  4QNS A;  2KGG A;  4R7E A;  4MEQ A;  5EU1 A;  5HQ7 A;  1Z2Q A;  5II1 A;  1WEM A;  5FBX A;  5A5P A;  5KHM A;  1WEE A;  2ECN A;  5IID A;  1F62 A;  4QSP A;  3S92 A;  4UIW A;  4XUA A;  4YYD A;  1WEQ A;  2L75 A;  5C11 A;  2RNY A;  2VPG A;  4ZC9 A;  4TZ8 A;  5F62 A;  2KE1 A;  3T6R A;  4YC9 A;  3U5O A;  2PUY A;  5IGM A;  2YU4 A;  1HYJ A;  1IYM A;  3FL2 A;  2OXQ C;  4O7C A;  5I40 A;  5LKT A;  5F1H A;  2D8S A;  5LVR A;  2YW5 A;  3P1C A;  2L80 A;  5CP5 A;  5FDZ A;  5FH8 A;  4NR6 A;  4ZQL A;  2VJF B;  5EWV A;  5H9M A;  2C2L A;  3HCT A;  1WE9 A;  3DWY A;  3MHS A;  5D0C A;  4TTE A;  5HQ6 A;  4QSQ A;  4MVT A;  4PCI A;  3ZVZ B;  3HCS A;  4BBQ A;  2N9G A;  2CKL B;  3G0J A;  5EIC A;  1N87 A;  5CUB A;  5COI A;  5CS8 A;  3ZYU A;  5FEY A;  3LXJ A;  4LYI A;  4Q6F A;  2JMI A;  4YYK A;  5IGN A;  4FIP A;  5G4S A;  3ONI A;  5ENJ A;  2YQM A;  3ZPV 1;  3LQI A;  4O78 A;  5TAB A;  5FB1 A;  4MR6 A;  4YY6 A;  5L99 A;  4YY4 A;  4TYL A;  5D3S A;  1LDJ B;  2LRI C;  2RSD A;  5KO4 A;  4HBY A;  5F61 A;  5KH3 A;  4UYG A;  5KTU A;  2CT2 A;  5DFD A;  5D1K B;  1ZS5 A;  4NN2 A;  3S91 A;  3NG2 A;  4KV1 A;  4UP5 A;  2KWN A;  2OUO A;  4X3G A;  4HXL A;  2YHO A;  1WFK A;  2R10 A;  3O34 A;  5FE3 A;  5I29 A;  3RPG C;  4XI1 A;  2YYN A;  4TQN A;  5I7X A;  4YBS A;  4QSS A;  4A9J A;  3O35 A;  4BW2 A;  4Z1Q A;  4QSU A;  5EPS A;  2EGP A;  2MD7 B;  4QSR A;  4YYM A;  3PUQ A;  4HXS A;  5L8T A;  1N72 A;  4QSV A;  4QSX A;  4QEU A;  4YH3 A;  3I3J A;  3U5L A;  4XYA A;  1VYX A;  4FLP A;  4XY9 A;  4QUU A;  5B76 A;  4A9I A;  4NUD A;  2VPD A;  2LV9 A;  4KV4 A;  4TT4 A;  5K29 A;  5C85 A;  4XY8 A;  2DKW A;  5ETB A;  2VPB A;  5EYA F;  4PKL A;  5CUG A;  5L96 A;  4AUQ B;  4J0R A;  5D3J A;  5DLZ A;  4UIX A;  5CQT A;  5ENG A;  4A4B A;  4O7F A;  2DX8 A;  4J0S A;  4O7A A;  3M99 A;  4F52 B;  2L43 A;  5CQA A;  4MEN A;  2YSM A;  5DIN A;  2D9E A;  5ENB A;  3UV4 A;  4MSX A;  3O33 A;  5IBN A;  4GB0 A;  5CUA A;  5EWD A;  5LJ0 A;  4NR5 A;  4F3I A;  4W4U A;  5I83 A;  5KH7 A;  4O7B A;  4R8P K;  4NS5 A;  2H60 A;  2CKL A;  3SHB A;  1WUM A;  4N4H A;  5DW2 A;  5HFQ A;  2ECT A;  2K17 A;  5A85 A;  5FE7 A;  4WA6 A;  3HCU A;  4WIV A;  4FO9 A;  2CSY A;  4IR5 A;  5B78 A;  2FSA A;  5A5N A;  5EK9 A;  3SVF A;  4CUP A;  2ECG A;  2KFT A;  2XEU A;  5CRZ A;  5E0R A;  4NUE A;  3M62 A;  3IHP A;  1WEO A;  5E9K A;  1JOC A;  5IGK A;  5LKX A;  5AIT A;  4V3L C;  3KV5 A;  3L1X A;  1E6I A;  2YSJ A;  3GV4 A;  4LJN A;  5F36 A;  5LKU A;  2K4D A;  5ETD A;  5HLS A;  3K2J A;  5D24 A;  4LR6 A;  4MEP A;  2PNX A;  2E6R A;  5F3A A;  3RCW A;  4NRA A;  5DYA A;  5AD3 A;  3N9L A;  5E9V A;  3UW9 A;  4O74 A;  2ZET C;  5DX4 A;  4Z6H A;  4QB3 A;  3ZVY A;  3UVW A;  4QR4 A;  4A49 A;  4NRB A;  4YYN A;  1V87 A;  5AIU A;  5II2 A;  4O71 A;  4CUU A;  4QR3 A;  2DVV A;  5A5S A;  1FP0 A;  4QF3 A;  4YAX A;  3KV6 A;  2L5E A;  5I3L A;  5EPB A;  5G04 B;  3QZS A;  5AME A;  5F25 A;  1DVP A;  1VFY A;  3N9O A;  4UIY A;  4L7X A;  2MD8 C;  4J1P A;  4NYW A;  4LAD B;  5FFV A;  3I2D A;  5A83 A;  5B79 A;  5DLX A;  2R0Y A;  2KRE A;  3SOU A;  2DVQ A;  2LQ6 A;  3ZPV E;  1WEW A;  4AYC A;  5CZG A;  3O36 A;  1LDK C;  2KYU A;  4O72 A;  4PY6 A;  4UYF B;  3O70 A;  1WIM A;  5EGU A;  1T1H A;  2YEK A;  2CSZ A;  4LLB A;  3GG3 A;  4NQM A;  5DFB A;  5CQ8 A;  4NRC A;  2JRJ A;  4A9L A;  4NYX A;  3ZNI A;  2YQD A;  4AKN A;  5HEL A;  4YAB A;  4TKP B;  5BT3 A;  5TDW A;  2HYE D;  3NXB A;  3QZT A;  4QUT A;  5CQ3 A;  1WEV A;  4A9E A;  5L97 A;  1CHC A;  5CFW A;  5KU3 A;  2RFJ A;  5BT4 A;  2YUC A;  2ECW A;  5FE5 A;  5CPE A;  3KQI A;  4CUQ A;  5D3P A;  2KWK A;  4BJX A;  4QEV A;  4BW1 A;  2KIZ A;  4QF2 A;  5L8U A;  2R0S A;  4YK0 A;  3M63 A;  2LGL A;  4WZ3 B;  3HMH A;  5FG5 A;  2YRE A;  2EOD A;  1X0J A;  3FKM X;  1RMD A;  5CGP A;  5KH9 A;  2R0V A;  2LGV A;  5CTL A;  2G6Q A;  5IG6 A;  4R2Y A;  5DKC A;  4C67 A;  4CLB A;  4A9M A;  5HJC A;  2LDR A;  5H1T A;  5H85 A;  4ZW1 A;  3U5P A;  3LJW A;  4QC3 A;  4CCG X;  4IC3 A;  1MM2 A;  5FFY A;  5I88 A;  4MR5 A;  5KTW A;  5CQ4 A;  1K2F A;  4LRG A;  4O77 A;  5ENC A;  5FE0 A;  4NUC A;  4UP0 A;  3RTR B;  2LXP C;  5TRB A;  1JM7 B;  4LYS A;  2G43 A;  4FK5 A;  5I86 A;  5FER A;  5FFW A;  2MUM A;  1JM4 B;  2E7O A;  5D26 A;  4IR6 A;  4S3O C;  4Z1S A;  2ECI A;  4YBT A;  5HEN A;  5DYC A;  5E3D A;  5FE2 A;  3MB4 A;  4L58 A;  5DW1 A;  5G05 B;  4TT6 A;  3RPG B;  5DKA A;  4AVX A;  4A9H A;  3Q2E A;  5I80 A;  4B7Y C;  2E3K A;  4J3I A;  1X4I A;  2Y43 A;  2IDA A;  5HRW A;  3U5K A;  4GNF A;  5DY7 A;  2H0D B;  5DBM A;  5CQ5 A;  3JVM A;  5EI4 A;  2FUU A;  2L85 A;  3EB6 A;  4LK9 A;  5HM0 A;  4UYF A;  1MM3 A;  3DQV R;  2MJV B;  2JMJ A;  2VJE B;  5HQ5 A;  3EB5 A;  5FE4 A;  4NR7 A;  4WHU A;  2DVS A;  2VJF A;  5TBN A;  4B86 C;  2ECV A;  5L98 A;  2YQL A;  5J3X A;  2NXB A;  4TU4 A;  5HEM A;  1U6G B;  5ENH A;  3PUR A;  3DPL R;  2WP1 A;  5HCL A;  4ZUX U;  5D3T A;  5CUE A;  3SVG A;  4V3K C;  2RNX A;  3IU5 A;  2EA6 A;  2G4A A;  4LZ2 A;  4LKA A;  5A81 A;  5CQ7 A;  3ZYQ A;  2JMD A;  3QZV A;  3D7C A;  4UI9 B;  3JVL A;  3MQM A;  5FB0 A;  5F1L A;  4I7B A;  5CQ6 A;  2AN6 A;  2Y1M A;  4RVR A;  4IOO A;  4Q0O A;  5FH7 A;  2D82 A;  3MUK A;  3MUL A;  2OO1 A;  5LUU A;  4HXM A;  4IR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...