5FB0A

Crystal structure of a phd finger bound to histone h3 t3ph peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
183
structure length
172
Chain Sequence
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERSGHQESEVLMRQMQPEEQLKCEFLLLKVYCDSKSSFFASEPYYGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear autoantigen Sp-100
publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/structural protein
total genus 59
structure length 172
sequence length 183
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb0A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb0A01
5EQ1A 4NRBA 4O7BA 4QSQA 2YYRA 5DW2A 3IHPA 5DYAA 4NRAA 4A9KA 4Z6IA 4TT6A 5DW1A 4HBVA 2HDPA 5CQTA 5KTXA 4UYHA 3N9MA 4LDFA 5DKHA 4QSWA 5FE0A 5HELA 3M62A 5CRZA 2JMIA 5KH3A 5HLSA 4A9FA 3P1FA 5BT3A 1V87A 5CUAA 2WP1A 2R0SA 5D3LA 1U6GB 4MEOA 4N4HA 3LQIA 3V43A 3PURA 2CT2A 1X0JA 2H0DA 5D0CA 5E73A 2PNXA 4QUUA 5ENJA 4UP5A 4V3LC 4WZ0A 4QB3A 1JM7A 5FE5A 5D1MB 5E9MA 3UVXA 5JI8A 4IR4A 4HXKA 5DBMA 2I50A 2MUMA 2LQ6A 2MD8C 4O71A 2R0YA 3AADA 4NN2A 5HRVA 3MB4A 4LYWA 4A49A 4L7XA 1FBVA 5D1LB 4TKPB 2KWNA 4QEUA 2LGKA 2L80A 4QEWA 4LZRA 4HBWA 1F62A 2D82A 4O74A 5D25A 5EWCA 5TDWA 5J3XA 4YK0A 1IYMA 4ZW1A 3DWYA 4BJXA 2LN0A 4FIPA 4O77A 1N87A 5FE2A 1WENA 3KV5A 2OXQC 3LQJA 2YEKA 5A81A 5J0DA 3O70A 2LXHC 4MEQA 1WEEA 4B7YC 2L84A 3QZTA 5FFYA 5FE9A 3LQHA 3S91A 5G0FA 2CSYA 4DONA 1CHCA 2MNZA 4HXLA 5AMFA 5E7DA 5I7XA 3SVFA 5ENFA 2RO1A 5D3HA 5FE8A 2YEMA 2CSZA 4V3KC 1T1HA 1X4JA 5EK9A 3O35A 4QUTA 1X4IA 2L43A 5ENBA 4FK5A 2HYED 4BBQA 4I7DA 1WUGA 2RFJA 2GRCA 4O7CA 2C2VS 4A9EA 4J1PA 3SOUA 3G0LA 5DY7A 4YYMA 2MT5A 4Z1SA 5D26A 4S3OB 3GG3A 3UV4A 4IORA 2D9EA 4HXNA 2LGLA 5CRMA 5E9VA 1G25A 5EWVA 4YABA 5F5ZA 3P1DA 2YQLA 2F6JA 5D7XA 5IGKA 2YU4A 4CUPA 5CQ7A 4A4CA 1FP0A 2L75A 3ZPVE 3C5KA 4WIVA 4MENA 5FE7A 5FE6A 5DKAA 4UYDA 4YATA 5FFVA 5I3LA 5HM0A 4ZQLA 5IG6A 5HQ7A 4MR3A 4W4UA 2MIQA 1JSPB 5BT4A 4LKAA 4AVXA 3TLPA 5HQ5A 4IR3A 2UZGA 4P5OB 5A5RA 4GNDA 5G04B 5CFWA 5TABA 4PTBA 2XB1A 4IC3A 5CS8A 3RPGB 4A0CD 3QZSA 5E0RA 2ECJA 1Z60A 2MNYA 3MQMA 5IGLA 1VFYA 2YSMA 4QSSA 4BHWA 5I80A 4R8PK 5CP5A 5KH7A 4LRGA 4ALHA 3IU5A 2LGVA 1HYJA 2DVQA 4O7AA 4YADA 5D3TA 2YHNA 3ZNIA 1VD4A 5II1A 2R10A 4AUQB 5HCLA 5CTLA 5FE1A 3ZYUA 5H1VA 3O37A 1E6IA 5IGNA 2G43A 1MM2A 4I7CA 2YURA 5JWMA 2M6MA 4LLBA 4CFLA 5A83A 4TYLA 5FH8A 3M63A 4PS5A 2M3HA 4QYLA 5A82A 4YYKA 3DPLR 4RVRA 5CQ3A 5CUGA 5I88A 1WILA 4UYGA 5B75A 2LDRA 3Q2FA 4CURA 5I1QA 4Q0OA 4WHWA 5FB1A 4A9LA 2ECTA 5F1HA 3FKMX 5HEMA 5G05B 4CUTA 4NR8A 3K2JA 2ECWA 2JMDA 2YELA 4NUEA 4O7FA 2LXPC 2NXBA 4N4GA 2RNXA 1JM4B 1WESA 4YY6A 1DVPA 4QF2A 2VPBA 4OUFA 2YSJA 4BW4A 4PCEA 4NQMA 2DVSA 4IC2A 5CQAA 4QF3A 5ENCA 4GNGA 4BW2A 2VJEB 3N9PA 4PY6A 4F52B 2ECIA 2KWOA 3ZTGA 3N9LA 2LGGA 2E7OA 5FBXA 4Z1QA 3KV6A 5DYCA 1WEMA 4IOOA 3P5OA 5E3GA 5HRXA 4N4FA 4MVTA 4IOQA 2LSPB 5I40A 5F2PA 2MA6A 3P1CA 2M85A 4NYWA 5DFDA 2DVRA 5L8TA 4WZ2A 5EP7A 1X4UA 3KNVA 5TRBA 4LR6A 4AYCB 1Z2QA 5E9KA 3ZYQA 5CZGA 4GNEA 3U5NA 4KV1A 2DATA 4Z6HA 3U5PA 4WZ3B 4XI1A 4FJCA 5LKUA 5C7NA 3HMEA 4XY9A 3FL2A 4CA1A 5LKXA 5G4RA 4XY8A 5FE4A 3MUKA 4UIZA 3U5MA 4GNFA 2QIZA 5EVAA 5FERA 5L96A 4A9HA 5CQ6A 5CQ5A 4CUUA 5FFWA 2E7NA 5A5PA 4FLPA 5IBNA 5KTUA 4J0RA 3HCTA 3SVGA 4WHUA 5G4SA 5L98A 3HTKC 2F6NA 2EODA 4TTEA 2CKLB 4HXOA 4NXJA 4LADB 5HQ6A 5F25A 4QYDA 2YREA 5JG6A 4O72A 2AN6A 5D3PA 2DVVA 5CQ4A 4R7EA 1ZS5A 4UYFB 4YC9A 5EV9A 3QZVA 1LDJB 2VJEA 4L58A 5KO4A 5F60A 3U5OA 5TB6A 1F68A 5I7YA 4A9IA 2KGIA 2L5UA 2VPGA 2EA6A 3T7LA 5LJ1A 2YQDA 3D7CA 3ZVZB 5DYUA 2I7KA 5D24A 4A9MA 1WGMA 4KCXA 3UVYA 2Y1NA 5IGMA 2KTBB 5EWHA 4AKNA 4YY4A 5C8GA 3I2DA 4YAXA 5E74A 5EA1A 2WP2A 4NYVA 5B78A 2YW5A 4QZSA 2KGGA 3C6WA 2VJFB 2YYNA 1K2FA 4UIUA 5LUUA 4NQNA 2YQMA 4YBMA 3O34A 4O78A 2L0BA 5C87A 5KU3A 2D8SA 4ZDTA 1RMDA 5II2A 4HXSA 5ETBA 2KFTA 2H60A 4XUAA 5CUEA 4R2YA 4YYIA 4J0SA 5FH7A 4O75A 2F42A 5E9IA 5C89A 4B86C 4CCGX 5CGPA 4O64A 5EWDA 4ZUXU 1ZBDB 2Y1MA 2CKLA 3O7AA 4QSPA 5D3NA 2R0VA 3HCSA 2KR4A 3SOWA 5DKDA 5EM3A 3I3JA 3N9OA 2RS9B 4YYNA 4GPJA 5H9MA 4NR5A 4TQNA 2M1RA 3IU6A 1WEVA 3P1EA 5EI4A 3RTRB 4YBTA 2H0DB 5LCWB 2JRJA 1LDKC 4UIYA 5EWWA 2ECGA 4QSVA 4LC2A 2KIZA 3GV4A 2G45A 1JM7B 3Q2EA 5LKTA 2YW8A 1HYIA 3LJWA 5DFCA 5A7CA 4ZC9A 3N9QA 5K29A 3S92A 4LYIA 3MHHA 3SOXA 4Z93A 2OO1A 3RCWA 2K17A 5D1KB 3UVWA 3AQAA 5A85A 3PHDA 5B77A 5FH6A 2K16A 4TZ8A 4A9OA 2VP7A 5B79A 5LJ2A 4O76A 2FUIA 3DQVR 1WIMA 3EB5A 2QICA 5KHMA 4QNSA 4YBSA 5CY9A 3LRQA 4IR5A 4QR3A 2XEUA 3ASLA 1WEOA 2LV9A 3GL6A 2E6RA 4Q6FA 4XYAA 4S3OC 5EISA 1EQFA 4HBXA 4TU4A 2EGPA 4OGJA 4PKLA 4YYDA 5F61A 1WE9A 4MSXA 5ACYA 5CPEA 4N4IA 5L97A 4E96A 4ALGA 4C9ZA 2PUYA 4UIVA 5EPBA 4C66A 5A5QA 5L99A 5DFBA 2MD7B 5EICA 4IR6A 5DX4A 4BW1A 4F3IA 5FG6A 5CQ8A 4CUSA 3JVKA 5AD3A 5C85A 2FSAA 5TBNA 5FE3A 5D3RA 4LJNA 4LZSA 5E9LA 2LRIC 2N9GA 4HXMA 3SHBA 3DAIA 4HXPA 3HMHA 4QR5A 3RPGC 5C13A 1E4UA 2YUCA 5BT5A 5CUDA 3UVDA 4X3GA 2BAYA 5E9YA 4QSRA 5TDRA 5FB0A 4MEPA 5DLZA 5COIA 2VPDA 1XWHA 4YYJA 5C11A 4A9JA 2RNWA 3NG2A 2RNYA 5DKCA 5EYAF 2OUOA 3LXJA 5F3AA 5KTWA 2YT5A 4PCIA 5AD2A 5C4QA 4NR6A 2JMJA 4HXRA 3JVMA 4QSXA 5HENA 2KREA 5FG5A 5LVRA 5FEYA 5EPRA 3U5LA 4KV4A 4CUQA 4QC3A 2FUUA 3MB3A 5HFRA 3U5KA 2K4DA 5I83A 5A5NA 3O36A 4NYXA 4TT2A 2OSSA 5F1LA 2ECNA 4LZ2A 2L85A 2KWJA 4HBYA 5D3SA 5EU1A 5LVQA 5B76A 5HFQA 2YDWA 3HCUA 1WUMA 4UYEA 5EPSA 5L8UA 2ZETC 1MM3A 2KU3A 5E3DA 5A5OA 4NS5A 2QJ0A 5KH9A 5I86A 3T6RA 5ENIA 4UI9B 5HRWA 5LJ0A 2KE1A 3JVLA 2K1JA 5H1TA 3L1ZB 5AMEA 5I89A 3M99A 4LK9A 4AYCA 4A9NA 4I7BA 1WFKA 4O70A 4J3IA 1JOCA 2MJVB 2VPEA 3O33A 1WEQA 4QSTA 5FDZA 2G6QA 5CU8A 5CUCA 4MR5A 4UIXA 5F63A 4NR7A 1WEUA 4N3WA 4GB0A 3HMFA 4QEVA 2ECVA 5F62A 3NXBA 5LKZA 4AP4A 4NUCA 3VK6A 4NR9A 3SVHA 4YYHA 3EB6A 5ENGA 3L1XA 3JVJA 3ONIA 4WA6A 2NAAA 4Q0NA 4QY4A 4TT4A 4X2IA 3UV5A 1WEPA 2MA5A 3N9NA 4CFKA 3UW9A 4LYSA 2I8NA 4QR4A 4QBMA 2KWKA 5H85A 4CLBA 1Z6UA 4UYFA 1BORA 4NUDA 4TS8A 2C2LA 1N72A 5B8DA 4BW3A 4UITA 5ENHA 2E3KA 5H1UA 4QSUA 4A4BA 5CUBA 3L11A 4MR4A 5I29A 4YH3A 5HJCA 1VYXA 4NRCA 2G4AA 5DINA 2KYUA 5FG4A 4UP0A 2YHOA 5EGUA 4TU6A 2DKWA 5IIDA 3MXFA 5AITA 4QC1A 3KQIA 3MHSA 4YH4A 5AIUA 2Y43A 5A5SA 5D3JA 2IDAA 2VJFA 2E6SA 4C67A 2L5EA 2DX8A 2VNFA 5DYXA 4UIWA 3ZVYA 4FO9A 4YYGA 4TZ2A 3MULA 5ETDA 4MR6A 3ZPV1 5ENEA 3G0JA 4OGIA 2RSDA 4XUBA 5TCMA 3PUQA 2RI7A 4NR4A 4PPEA 4CL9A 5DLXA 3UV2A 4Y03A 3U5JA 1WEWA 2DWWA 5F36A 4O7EA
chains in the Genus database with same CATH superfamily
5EQ1A 4NRBA 4O7BA 4QSQA 2YYRA 5DW2A 3IHPA 5DYAA 4NRAA 4A9KA 4Z6IA 4TT6A 5DW1A 3VKGA 4HBVA 2HDPA 5CQTA 5KTXA 4UYHA 3N9MA 4LDFA 5DKHA 4QSWA 5FE0A 5HELA 3M62A 3Q1DA 5CRZA 2JMIA 5KH3A 5HLSA 4A9FA 3P1FA 5BT3A 1V87A 5CUAA 2WP1A 2R0SA 5D3LA 1U6GB 4MEOA 4N4HA 3LQIA 3V43A 3PURA 2CT2A 1X0JA 2H0DA 5D0CA 5E73A 2PNXA 4QUUA 5ENJA 4UP5A 4V3LC 4WZ0A 2EGMA 4QB3A 1JM7A 5FE5A 3FJUB 5D1MB 5E9MA 3UVXA 1DCQA 5JI8A 4IR4A 4HXKA 5DBMA 2I50A 2MUMA 2LQ6A 2MD8C 4O71A 2R0YA 3AADA 4NN2A 5HRVA 3MB4A 4LYWA 2IQJA 4A49A 4L7XA 1FBVA 5D1LB 4TKPB 2KWNA 4QEUA 2LGKA 2L80A 4QEWA 4LZRA 4HBWA 1F62A 2D82A 4O74A 5D25A 5EWCA 5TDWA 5J3XA 4YK0A 1IYMA 4ZW1A 3DWYA 4BJXA 2LN0A 4FIPA 4O77A 1N87A 5FE2A 1WENA 3KV5A 2OXQC 3LQJA 2YEKA 5A81A 5J0DA 3O70A 2LXHC 4MEQA 1WEEA 4B7YC 2L84A 3QZTA 5FFYA 5FE9A 3LQHA 3S91A 4QQ4A 5G0FA 2CSYA 4DONA 1CHCA 2E61A 3M7KA 2MNZA 2FD4A 4HXLA 5AMFA 5E7DA 5I7XA 3SVFA 5ENFA 2RO1A 5D3HA 5FE8A 2YEMA 2CSZA 4V3KC 1T1HA 1X4JA 5EK9A 3O35A 4QUTA 1X4IA 2L43A 5ENBA 4FK5A 2HYED 2B0OE 4BBQA 3FEHA 4I7DA 1WUGA 2RFJA 2GRCA 4O7CA 2C2VS 4A9EA 4J1PA 3SOUA 3G0LA 5DY7A 4YYMA 4AKIA 2MT5A 4Z1SA 5D26A 4S3OB 3GG3A 3UV4A 4IORA 2D9EA 5SVXA 4HXNA 3MDBC 2LGLA 5CRMA 5E9VA 1G25A 5EWVA 4YABA 5F5ZA 3P1DA 2YQLA 2F6JA 5D7XA 5IGKA 2YU4A 4CUPA 5CQ7A 4A4CA 1FP0A 2L75A 3ZPVE 3C5KA 4WIVA 4MENA 5FE7A 2XOZA 5FE6A 5DKAA 4UYDA 4YATA 5FFVA 5I3LA 5HM0A 3DWDA 4ZQLA 5IG6A 3DDTA 5HQ7A 4MR3A 4W4UA 2MIQA 1JSPB 5BT4A 4LKAA 4AVXA 3TLPA 5HQ5A 4IR3A 2UZGA 4P5OB 4H9DA 5A5RA 4GNDA 5G04B 5CFWA 5TABA 4PTBA 2XB1A 2M13A 4IC3A 5CS8A 3RPGB 4A0CD 3QZSA 5E0RA 2ECJA 1Z60A 2MNYA 3MQMA 2XP0A 5IGLA 1VFYA 2YSMA 4QSSA 4BHWA 5I80A 4R8PK 5CP5A 5KH7A 4LRGA 4ALHA 3IU5A 2LGVA 1HYJA 2DVQA 4O7AA 4YADA 5D3TA 2YHNA 3ZNIA 1VD4A 5II1A 2R10A 4AUQB 5HCLA 3JUEA 5CTLA 5FE1A 3ZYUA 5H1VA 3O37A 1E6IA 5IGNA 2G43A 1MM2A 4I7CA 2YURA 5JWMA 2M6MA 4LLBA 4CFLA 5A83A 4TYLA 5FH8A 3M63A 4PS5A 2M3HA 4QYLA 5A82A 4YYKA 3DPLR 4RVRA 5CQ3A 5CUGA 5I88A 1WILA 4UYGA 5B75A 2LDRA 3Q2FA 4CURA 5I1QA 4Q0OA 3PLWA 4WHWA 5FB1A 4A9LA 2ECTA 5F1HA 3FKMX 5HEMA 5G05B 4CUTA 4NR8A 3K2JA 2ECWA 2CRRA 2JMDA 2YELA 4NUEA 4O7FA 2LXPC 2NXBA 4N4GA 2RNXA 1JM4B 1WESA 4O62A 4YY6A 3LDYA 2DSMA 1DVPA 4QF2A 2VPBA 4OUFA 2YSJA 4BW4A 4PCEA 4NQMA 2DVSA 4IC2A 5CQAA 4QF3A 5ENCA 4GNGA 4BW2A 2VJEB 3N9PA 4PY6A 4F52B 2ECIA 2KWOA 5SVYA 3ZTGA 3N9LA 3O47A 2LGGA 2E7OA 5FBXA 4Z1QA 3KV6A 5DYCA 1MBMA 1WEMA 4IOOA 3P5OA 5E3GA 5HRXA 4N4FA 4MVTA 4IOQA 4Z0OA 2LSPB 5I40A 5F2PA 2EXUA 3P1CA 2MA6A 2M85A 4NYWA 5DFDA 2DVRA 5L8TA 4WZ2A 5EP7A 1X4UA 3KNVA 5TRBA 4LR6A 4AYCB 1Z2QA 5E9KA 3ZYQA 5CZGA 4GNEA 3U5NA 4KV1A 2DATA 4Z6HA 3U5PA 4WZ3B 4XI1A 4FJCA 5LKUA 5C7NA 3HMEA 4XY9A 3FL2A 4CA1A 5LKXA 5G4RA 4XY8A 5FE4A 3MUKA 4UIZA 3U5MA 3FM8C 4GNFA 2QIZA 5EVAA 5FERA 5L96A 4A9HA 5CQ6A 5CQ5A 4CUUA 4F1PA 5FFWA 2E7NA 5A5PA 2FFWA 4FLPA 5IBNA 5KTUA 4J0RA 3HCTA 3SVGA 4WHUA 5G4SA 5L98A 2P57A 3HTKC 2F6NA 2EODA 4TTEA 2CKLB 4HXOA 4NXJA 4LADB 5HQ6A 5F25A 4QYDA 2YREA 5JG6A 2KKYA 4O72A 2AN6A 5D3PA 2DVVA 5CQ4A 4R7EA 1ZS5A 4UYFB 4YC9A 5EV9A 3QZVA 1LDJB 2VJEA 4L58A 5KO4A 5F60A 3U5OA 5TB6A 1F68A 5I7YA 4A9IA 2KGIA 2L5UA 2VPGA 2EA6A 3T7LA 5LJ1A 2YQDA 3D7CA 3ZVZB 5DYUA 2I7KA 5D24A 4A9MA 1WGMA 4KCXA 3UVYA 2L7PA 5IGMA 2Y1NA 2KTBB 5EWHA 4AKNA 4YY4A 5C8GA 3I2DA 4YAXA 5E74A 5EA1A 3T9KA 2WP2A 4NYVA 5B78A 2YW5A 4QZSA 2KGGA 3C6WA 2VJFB 2YYNA 1K2FA 4UIUA 2OWAA 5LUUA 4NQNA 2YQMA 4YBMA 3O34A 4O78A 2L0BA 5C87A 5KU3A 2D8SA 4ZDTA 1RMDA 5II2A 4HXSA 5ETBA 2KFTA 2H60A 4XUAA 5CUEA 4R2YA 4YYIA 4J0SA 5FH7A 4O75A 2F42A 5E9IA 5C89A 4B86C 4CCGX 5CGPA 2RR4A 4O64A 5EWDA 4ZUXU 1ZBDB 2Y1MA 2CKLA 3O7AA 4QSPA 5D3NA 2R0VA 3HCSA 2KR4A 3SOWA 5DKDA 5EM3A 3LVRE 3I3JA 3N9OA 2RS9B 4YYNA 4GPJA 5H9MA 4NR5A 4TQNA 2M1RA 3IU6A 1WEVA 3P1EA 5EI4A 3RTRB 4YBTA 2H0DB 5LCWB 2JRJA 1LDKC 4UIYA 5EWWA 2ECGA 4QSVA 4LC2A 2KIZA 3GV4A 2G45A 1JM7B 3Q2EA 5LKTA 2YW8A 4OGEA 1HYIA 3LJWA 5DFCA 5A7CA 4ZC9A 3N9QA 5K29A 3S92A 4LYIA 3MHHA 3SOXA 4Z93A 2OO1A 3E2DA 3RCWA 2K17A 5D1KB 3UVWA 3AQAA 5A85A 3PHDA 5B77A 5FH6A 2K16A 4TZ8A 4A9OA 2VP7A 5B79A 5LJ2A 4O76A 2FUIA 2JM3A 3DQVR 5SVIB 2MKEA 1WIMA 3EB5A 2QICA 5KHMA 4QNSA 4YBSA 5CY9A 3LRQA 4IR5A 4QR3A 2XEUA 3ASLA 1WEOA 2LV9A 3GL6A 2E6RA 2YVRA 3KDEC 4Q6FA 4XYAA 4S3OC 5EISA 1EQFA 4HBXA 4TU4A 2EGPA 2LAUA 4OGJA 4PKLA 4YYDA 5F61A 4OGCA 1WE9A 4MSXA 5ACYA 5CPEA 4N4IA 5L97A 4E96A 4ALGA 4C9ZA 2PUYA 4UIVA 5EPBA 4C66A 5A5QA 5L99A 5DFBA 2MD7B 5EICA 4IR6A 5DX4A 4BW1A 4F3IA 5FG6A 4AKHA 5CQ8A 4CUSA 3JVKA 5AD3A 5C85A 2FSAA 5TBNA 5FE3A 5D3RA 4AKGA 4LJNA 4LZSA 5E9LA 2LRIC 2N9GA 4HXMA 3SHBA 3DAIA 4HXPA 3HMHA 4QR5A 2EJNA 3RPGC 5C13A 1E4UA 2YUCA 5BT5A 5CUDA 3UVDA 3LJUX 4X3GA 2BAYA 5E9YA 4QSRA 5TDRA 5FB0A 4MEPA 5DLZA 5COIA 2VPDA 1XWHA 4YYJA 5C11A 4A9JA 2RNWA 3NG2A 2CONA 2RNYA 5DKCA 5EYAF 2OUOA 3LXJA 5F3AA 5KTWA 2YT5A 4PCIA 5AD2A 5C4QA 4NR6A 2JMJA 4HXRA 3JVMA 4QSXA 5HENA 2KREA 5FG5A 5LVRA 5SVIA 4Z0RA 5FEYA 5EPRA 3U5LA 4KV4A 4CUQA 4QC3A 2FUUA 3MB3A 5HFRA 3U5KA 2K4DA 5I83A 5A5NA 3O36A 4NYXA 4TT2A 2OSSA 5F1LA 2ECNA 4LZ2A 2L85A 2KWJA 4HBYA 5D3SA 5EU1A 5LVQA 5B76A 5HFQA 2YDWA 3HCUA 1WUMA 4UYEA 5EPSA 5L8UA 2ZETC 1MM3A 2KU3A 5E3DA 5A5OA 4NS5A 2QJ0A 5KH9A 5I86A 3T6RA 5ENIA 2CRWA 4UI9B 5HRWA 5LJ0A 2KE1A 3JVLA 2K1JA 5H1TA 3L1ZB 5AMEA 5I89A 3VKHA 3M99A 4LK9A 4AYCA 4A9NA 4I7BA 1WFKA 4O70A 4J3IA 1JOCA 2MJVB 2VPEA 3O33A 1WEQA 4QSTA 5FDZA 2G6QA 5CU8A 3ERRA 4MR5A 4UIXA 5CUCA 4NR7A 5F63A 1WEUA 4N3WA 4GB0A 3HMFA 4QEVA 2ECVA 5F62A 3NXBA 2D8UA 5LKZA 4AP4A 3H7HA 4NUCA 3VK6A 4NR9A 3SVHA 4YYHA 3EB6A 3SUBA 5ENGA 1PUOA 2JUNA 3L1XA 3JVJA 3ONIA 4WA6A 2NAAA 4Q0NA 4QY4A 4TT4A 4X2IA 3UV5A 1WEPA 2MA5A 3N9NA 4CFKA 3UW9A 4LYSA 2I8NA 4QR4A 4QBMA 2KWKA 5H85A 4CLBA 1Z6UA 4UYFA 1BORA 4NUDA 4TS8A 2C2LA 1N72A 2XOYA 5B8DA 4BW3A 3D1DA 3FANA 4UITA 2KKXA 5ENHA 2E3KA 5H1UA 2DJAA 4QSUA 3D1BA 4A4BA 5CUBA 3L11A 2CSVA 4MR4A 5I29A 4YH3A 5HJCA 1VYXA 4NRCA 2G4AA 5DINA 2KYUA 5FG4A 4UP0A 3FAOA 2YHOA 5EGUA 4TU6A 2DKWA 5IIDA 3MXFA 5AITA 4QC1A 4AI6A 3KQIA 4YH4A 3MHSA 5AIUA 2Y43A 5A5SA 5D3JA 2IDAA 2VJFA 2E6SA 4C67A 1ZKRA 2L5EA 2DX8A 2VNFA 5DYXA 4UIWA 3ZVYA 4FO9A 4YYGA 4TZ2A 3MULA 5K3QA 5ETDA 4MR6A 3ZPV1 5ENEA 3G0JA 4OGIA 2RSDA 4XUBA 5TCMA 3PUQA 2RI7A 4NR4A 4PPEA 4CL9A 5DLXA 3UV2A 4Y03A 3U5JA 3LVQE 1WEWA 2XOCA 2DWWA 5F36A 4O7EA
chains in the Genus database with same CATH topology
5EQ1A 4NRBA 4O7BA 4QSQA 2YYRA 5DW2A 3IHPA 5DYAA 4NRAA 4A9KA 4Z6IA 4TT6A 5DW1A 4HBVA 2HDPA 5CQTA 5KTXA 4UYHA 3N9MA 4LDFA 5DKHA 4QSWA 5FE0A 5HELA 3M62A 5CRZA 2JMIA 5KH3A 5HLSA 4A9FA 3P1FA 5BT3A 1V87A 5CUAA 2WP1A 2R0SA 5D3LA 1U6GB 4MEOA 4N4HA 3LQIA 3V43A 3PURA 2CT2A 1X0JA 2H0DA 5D0CA 5E73A 2PNXA 4QUUA 5ENJA 4UP5A 4V3LC 4WZ0A 4QB3A 1JM7A 5FE5A 5D1MB 5E9MA 3UVXA 5JI8A 4IR4A 4HXKA 5DBMA 2I50A 2MUMA 2LQ6A 2MD8C 4O71A 2R0YA 3AADA 4NN2A 5HRVA 3MB4A 4LYWA 4A49A 4L7XA 1FBVA 5D1LB 4TKPB 2KWNA 4QEUA 2LGKA 2L80A 4QEWA 4LZRA 4HBWA 1F62A 2D82A 4O74A 5D25A 5EWCA 5TDWA 5J3XA 4YK0A 1IYMA 4ZW1A 3DWYA 4BJXA 2LN0A 4FIPA 4O77A 1N87A 5FE2A 1WENA 3KV5A 2OXQC 3LQJA 2YEKA 5A81A 5J0DA 3O70A 2LXHC 4MEQA 1WEEA 4B7YC 2L84A 3QZTA 5FFYA 5FE9A 3LQHA 3S91A 5G0FA 2CSYA 4DONA 1CHCA 2MNZA 4HXLA 5AMFA 5E7DA 5I7XA 3SVFA 5ENFA 2RO1A 5D3HA 5FE8A 2YEMA 2CSZA 4V3KC 1T1HA 1X4JA 5EK9A 3O35A 4QUTA 1X4IA 2L43A 5ENBA 4FK5A 2HYED 4BBQA 4I7DA 1WUGA 2RFJA 2GRCA 4O7CA 2C2VS 4A9EA 4J1PA 3SOUA 3G0LA 5DY7A 4YYMA 2MT5A 4Z1SA 5D26A 4S3OB 3GG3A 3UV4A 4IORA 2D9EA 4HXNA 2LGLA 5CRMA 5E9VA 1G25A 5EWVA 4YABA 5F5ZA 3P1DA 2YQLA 2F6JA 5D7XA 5IGKA 2YU4A 4CUPA 5CQ7A 4A4CA 1FP0A 2L75A 3ZPVE 3C5KA 4WIVA 4MENA 5FE7A 5FE6A 5DKAA 4UYDA 4YATA 5FFVA 5I3LA 5HM0A 4ZQLA 5IG6A 5HQ7A 4MR3A 4W4UA 2MIQA 1JSPB 5BT4A 4LKAA 4AVXA 3TLPA 5HQ5A 4IR3A 2UZGA 4P5OB 5A5RA 4GNDA 5G04B 5CFWA 5TABA 4PTBA 2XB1A 4IC3A 5CS8A 3RPGB 4A0CD 3QZSA 5E0RA 2ECJA 1Z60A 2MNYA 3MQMA 5IGLA 1VFYA 2YSMA 4QSSA 4BHWA 5I80A 4R8PK 5CP5A 5KH7A 4LRGA 4ALHA 3IU5A 2LGVA 1HYJA 2DVQA 4O7AA 4YADA 5D3TA 2YHNA 3ZNIA 1VD4A 5II1A 2R10A 4AUQB 5HCLA 5CTLA 5FE1A 3ZYUA 5H1VA 3O37A 1E6IA 5IGNA 2G43A 1MM2A 4I7CA 2YURA 5JWMA 2M6MA 4LLBA 4CFLA 5A83A 4TYLA 5FH8A 3M63A 4PS5A 2M3HA 4QYLA 5A82A 4YYKA 3DPLR 4RVRA 5CQ3A 5CUGA 5I88A 1WILA 4UYGA 5B75A 2LDRA 3Q2FA 4CURA 5I1QA 4Q0OA 4WHWA 5FB1A 4A9LA 2ECTA 5F1HA 3FKMX 5HEMA 5G05B 4CUTA 4NR8A 3K2JA 2ECWA 2JMDA 2YELA 4NUEA 4O7FA 2LXPC 2NXBA 4N4GA 2RNXA 1JM4B 1WESA 4YY6A 1DVPA 4QF2A 2VPBA 4OUFA 2YSJA 4BW4A 4PCEA 4NQMA 2DVSA 4IC2A 5CQAA 4QF3A 5ENCA 4GNGA 4BW2A 2VJEB 3N9PA 4PY6A 4F52B 2ECIA 2KWOA 3ZTGA 3N9LA 2LGGA 2E7OA 5FBXA 4Z1QA 3KV6A 5DYCA 1WEMA 4IOOA 3P5OA 5E3GA 5HRXA 4N4FA 4MVTA 4IOQA 2LSPB 5I40A 5F2PA 2MA6A 3P1CA 2M85A 4NYWA 5DFDA 2DVRA 5L8TA 4WZ2A 5EP7A 1X4UA 3KNVA 5TRBA 4LR6A 4AYCB 1Z2QA 5E9KA 3ZYQA 5CZGA 4GNEA 3U5NA 4KV1A 2DATA 4Z6HA 3U5PA 4WZ3B 4XI1A 4FJCA 5LKUA 5C7NA 3HMEA 4XY9A 3FL2A 4CA1A 5LKXA 5G4RA 4XY8A 5FE4A 3MUKA 4UIZA 3U5MA 4GNFA 2QIZA 5EVAA 5FERA 5L96A 4A9HA 5CQ6A 5CQ5A 4CUUA 5FFWA 2E7NA 5A5PA 4FLPA 5IBNA 5KTUA 4J0RA 3HCTA 3SVGA 4WHUA 5G4SA 5L98A 3HTKC 2F6NA 2EODA 4TTEA 2CKLB 4HXOA 4NXJA 4LADB 5HQ6A 5F25A 4QYDA 2YREA 5JG6A 4O72A 2AN6A 5D3PA 2DVVA 5CQ4A 4R7EA 1ZS5A 4UYFB 4YC9A 5EV9A 3QZVA 1LDJB 2VJEA 4L58A 5KO4A 5F60A 3U5OA 5TB6A 1F68A 5I7YA 4A9IA 2KGIA 2L5UA 2VPGA 2EA6A 3T7LA 5LJ1A 2YQDA 3D7CA 3ZVZB 5DYUA 2I7KA 5D24A 4A9MA 1WGMA 4KCXA 3UVYA 2Y1NA 5IGMA 2KTBB 5EWHA 4AKNA 4YY4A 5C8GA 3I2DA 4YAXA 5E74A 5EA1A 2WP2A 4NYVA 5B78A 2YW5A 4QZSA 2KGGA 3C6WA 2VJFB 2YYNA 1K2FA 4UIUA 5LUUA 4NQNA 2YQMA 4YBMA 3O34A 4O78A 2L0BA 5C87A 5KU3A 2D8SA 4ZDTA 1RMDA 5II2A 4HXSA 5ETBA 2KFTA 2H60A 4XUAA 5CUEA 4R2YA 4YYIA 4J0SA 5FH7A 4O75A 2F42A 5E9IA 5C89A 4B86C 4CCGX 5CGPA 4O64A 5EWDA 4ZUXU 1ZBDB 2Y1MA 2CKLA 3O7AA 4QSPA 5D3NA 2R0VA 3HCSA 2KR4A 3SOWA 5DKDA 5EM3A 3I3JA 3N9OA 2RS9B 4YYNA 4GPJA 5H9MA 4NR5A 4TQNA 2M1RA 3IU6A 1WEVA 3P1EA 5EI4A 3RTRB 4YBTA 2H0DB 5LCWB 2JRJA 1LDKC 4UIYA 5EWWA 2ECGA 4QSVA 4LC2A 2KIZA 3GV4A 2G45A 1JM7B 3Q2EA 5LKTA 2YW8A 1HYIA 3LJWA 5DFCA 5A7CA 4ZC9A 3N9QA 5K29A 3S92A 4LYIA 3MHHA 3SOXA 4Z93A 2OO1A 3RCWA 2K17A 5D1KB 3UVWA 3AQAA 5A85A 3PHDA 5B77A 5FH6A 2K16A 4TZ8A 4A9OA 2VP7A 5B79A 5LJ2A 4O76A 2FUIA 3DQVR 1WIMA 3EB5A 2QICA 5KHMA 4QNSA 4YBSA 5CY9A 3LRQA 4IR5A 4QR3A 2XEUA 3ASLA 1WEOA 2LV9A 3GL6A 2E6RA 4Q6FA 4XYAA 4S3OC 5EISA 1EQFA 4HBXA 4TU4A 2EGPA 4OGJA 4PKLA 4YYDA 5F61A 1WE9A 4MSXA 5ACYA 5CPEA 4N4IA 5L97A 4E96A 4ALGA 4C9ZA 2PUYA 4UIVA 5EPBA 4C66A 5A5QA 5L99A 5DFBA 2MD7B 5EICA 4IR6A 5DX4A 4BW1A 4F3IA 5FG6A 5CQ8A 4CUSA 3JVKA 5AD3A 5C85A 2FSAA 5TBNA 5FE3A 5D3RA 4LJNA 4LZSA 5E9LA 2LRIC 2N9GA 4HXMA 3SHBA 3DAIA 4HXPA 3HMHA 4QR5A 3RPGC 5C13A 1E4UA 2YUCA 5BT5A 5CUDA 3UVDA 4X3GA 2BAYA 5E9YA 4QSRA 5TDRA 5FB0A 4MEPA 5DLZA 5COIA 2VPDA 1XWHA 4YYJA 5C11A 4A9JA 2RNWA 3NG2A 2RNYA 5DKCA 5EYAF 2OUOA 3LXJA 5F3AA 5KTWA 2YT5A 4PCIA 5AD2A 5C4QA 4NR6A 2JMJA 4HXRA 3JVMA 4QSXA 5HENA 2KREA 5FG5A 5LVRA 5FEYA 5EPRA 3U5LA 4KV4A 4CUQA 4QC3A 2FUUA 3MB3A 5HFRA 3U5KA 2K4DA 5I83A 5A5NA 3O36A 4NYXA 4TT2A 2OSSA 5F1LA 2ECNA 4LZ2A 2L85A 2KWJA 4HBYA 5D3SA 5EU1A 5LVQA 5B76A 5HFQA 2YDWA 3HCUA 1WUMA 4UYEA 5EPSA 5L8UA 2ZETC 1MM3A 2KU3A 5E3DA 5A5OA 4NS5A 2QJ0A 5KH9A 5I86A 3T6RA 5ENIA 4UI9B 5HRWA 5LJ0A 2KE1A 3JVLA 2K1JA 5H1TA 3L1ZB 5AMEA 5I89A 3M99A 4LK9A 4AYCA 4A9NA 4I7BA 1WFKA 4O70A 4J3IA 1JOCA 2MJVB 2VPEA 3O33A 1WEQA 4QSTA 5FDZA 2G6QA 5CU8A 5CUCA 4MR5A 4UIXA 5F63A 4NR7A 1WEUA 4N3WA 4GB0A 3HMFA 4QEVA 2ECVA 5F62A 3NXBA 5LKZA 4AP4A 4NUCA 3VK6A 4NR9A 3SVHA 4YYHA 3EB6A 5ENGA 3L1XA 3JVJA 3ONIA 4WA6A 2NAAA 4Q0NA 4QY4A 4TT4A 4X2IA 3UV5A 1WEPA 2MA5A 3N9NA 4CFKA 3UW9A 4LYSA 2I8NA 4QR4A 4QBMA 2KWKA 5H85A 4CLBA 1Z6UA 4UYFA 1BORA 4NUDA 4TS8A 2C2LA 1N72A 5B8DA 4BW3A 4UITA 5ENHA 2E3KA 5H1UA 4QSUA 4A4BA 5CUBA 3L11A 4MR4A 5I29A 4YH3A 5HJCA 1VYXA 4NRCA 2G4AA 5DINA 2KYUA 5FG4A 4UP0A 2YHOA 5EGUA 4TU6A 2DKWA 5IIDA 3MXFA 5AITA 4QC1A 3KQIA 3MHSA 4YH4A 5AIUA 2Y43A 5A5SA 5D3JA 2IDAA 2VJFA 2E6SA 4C67A 2L5EA 2DX8A 2VNFA 5DYXA 4UIWA 3ZVYA 4FO9A 4YYGA 4TZ2A 3MULA 5ETDA 4MR6A 3ZPV1 5ENEA 3G0JA 4OGIA 2RSDA 4XUBA 5TCMA 3PUQA 2RI7A 4NR4A 4PPEA 4CL9A 5DLXA 3UV2A 4Y03A 3U5JA 1WEWA 2DWWA 5F36A 4O7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQ1 A;  4NRB A;  4O7B A;  4QSQ A;  2YYR A;  5DW2 A;  3IHP A;  5DYA A;  4NRA A;  4A9K A;  4Z6I A;  4TT6 A;  5DW1 A;  4HBV A;  2HDP A;  5CQT A;  5KTX A;  4UYH A;  3N9M A;  4LDF A;  5DKH A;  4QSW A;  5FE0 A;  5HEL A;  3M62 A;  5CRZ A;  2JMI A;  5KH3 A;  5HLS A;  4A9F A;  3P1F A;  5BT3 A;  1V87 A;  5CUA A;  2WP1 A;  2R0S A;  5D3L A;  1U6G B;  4MEO A;  4N4H A;  3LQI A;  3V43 A;  3PUR A;  2CT2 A;  1X0J A;  2H0D A;  5D0C A;  5E73 A;  2PNX A;  4QUU A;  5ENJ A;  4UP5 A;  4V3L C;  4WZ0 A;  4QB3 A;  1JM7 A;  5FE5 A;  5D1M B;  5E9M A;  3UVX A;  5JI8 A;  4IR4 A;  4HXK A;  5DBM A;  2I50 A;  2MUM A;  2LQ6 A;  2MD8 C;  4O71 A;  2R0Y A;  3AAD A;  4NN2 A;  5HRV A;  3MB4 A;  4LYW A;  4A49 A;  4L7X A;  1FBV A;  5D1L B;  4TKP B;  2KWN A;  4QEU A;  2LGK A;  2L80 A;  4QEW A;  4LZR A;  4HBW A;  1F62 A;  2D82 A;  4O74 A;  5D25 A;  5EWC A;  5TDW A;  5J3X A;  4YK0 A;  1IYM A;  4ZW1 A;  3DWY A;  4BJX A;  2LN0 A;  4FIP A;  4O77 A;  1N87 A;  5FE2 A;  1WEN A;  3KV5 A;  2OXQ C;  3LQJ A;  2YEK A;  5A81 A;  5J0D A;  3O70 A;  2LXH C;  4MEQ A;  1WEE A;  4B7Y C;  2L84 A;  3QZT A;  5FFY A;  5FE9 A;  3LQH A;  3S91 A;  5G0F A;  2CSY A;  4DON A;  1CHC A;  2MNZ A;  4HXL A;  5AMF A;  5E7D A;  5I7X A;  3SVF A;  5ENF A;  2RO1 A;  5D3H A;  5FE8 A;  2YEM A;  2CSZ A;  4V3K C;  1T1H A;  1X4J A;  5EK9 A;  3O35 A;  4QUT A;  1X4I A;  2L43 A;  5ENB A;  4FK5 A;  2HYE D;  4BBQ A;  4I7D A;  1WUG A;  2RFJ A;  2GRC A;  4O7C A;  2C2V S;  4A9E A;  4J1P A;  3SOU A;  3G0L A;  5DY7 A;  4YYM A;  2MT5 A;  4Z1S A;  5D26 A;  4S3O B;  3GG3 A;  3UV4 A;  4IOR A;  2D9E A;  4HXN A;  2LGL A;  5CRM A;  5E9V A;  1G25 A;  5EWV A;  4YAB A;  5F5Z A;  3P1D A;  2YQL A;  2F6J A;  5D7X A;  5IGK A;  2YU4 A;  4CUP A;  5CQ7 A;  4A4C A;  1FP0 A;  2L75 A;  3ZPV E;  3C5K A;  4WIV A;  4MEN A;  5FE7 A;  5FE6 A;  5DKA A;  4UYD A;  4YAT A;  5FFV A;  5I3L A;  5HM0 A;  4ZQL A;  5IG6 A;  5HQ7 A;  4MR3 A;  4W4U A;  2MIQ A;  1JSP B;  5BT4 A;  4LKA A;  4AVX A;  3TLP A;  5HQ5 A;  4IR3 A;  2UZG A;  4P5O B;  5A5R A;  4GND A;  5G04 B;  5CFW A;  5TAB A;  4PTB A;  2XB1 A;  4IC3 A;  5CS8 A;  3RPG B;  4A0C D;  3QZS A;  5E0R A;  2ECJ A;  1Z60 A;  2MNY A;  3MQM A;  5IGL A;  1VFY A;  2YSM A;  4QSS A;  4BHW A;  5I80 A;  4R8P K;  5CP5 A;  5KH7 A;  4LRG A;  4ALH A;  3IU5 A;  2LGV A;  1HYJ A;  2DVQ A;  4O7A A;  4YAD A;  5D3T A;  2YHN A;  3ZNI A;  1VD4 A;  5II1 A;  2R10 A;  4AUQ B;  5HCL A;  5CTL A;  5FE1 A;  3ZYU A;  5H1V A;  3O37 A;  1E6I A;  5IGN A;  2G43 A;  1MM2 A;  4I7C A;  2YUR A;  5JWM A;  2M6M A;  4LLB A;  4CFL A;  5A83 A;  4TYL A;  5FH8 A;  3M63 A;  4PS5 A;  2M3H A;  4QYL A;  5A82 A;  4YYK A;  3DPL R;  4RVR A;  5CQ3 A;  5CUG A;  5I88 A;  1WIL A;  4UYG A;  5B75 A;  2LDR A;  3Q2F A;  4CUR A;  5I1Q A;  4Q0O A;  4WHW A;  5FB1 A;  4A9L A;  2ECT A;  5F1H A;  3FKM X;  5HEM A;  5G05 B;  4CUT A;  4NR8 A;  3K2J A;  2ECW A;  2JMD A;  2YEL A;  4NUE A;  4O7F A;  2LXP C;  2NXB A;  4N4G A;  2RNX A;  1JM4 B;  1WES A;  4YY6 A;  1DVP A;  4QF2 A;  2VPB A;  4OUF A;  2YSJ A;  4BW4 A;  4PCE A;  4NQM A;  2DVS A;  4IC2 A;  5CQA A;  4QF3 A;  5ENC A;  4GNG A;  4BW2 A;  2VJE B;  3N9P A;  4PY6 A;  4F52 B;  2ECI A;  2KWO A;  3ZTG A;  3N9L A;  2LGG A;  2E7O A;  5FBX A;  4Z1Q A;  3KV6 A;  5DYC A;  1WEM A;  4IOO A;  3P5O A;  5E3G A;  5HRX A;  4N4F A;  4MVT A;  4IOQ A;  2LSP B;  5I40 A;  5F2P A;  2MA6 A;  3P1C A;  2M85 A;  4NYW A;  5DFD A;  2DVR A;  5L8T A;  4WZ2 A;  5EP7 A;  1X4U A;  3KNV A;  5TRB A;  4LR6 A;  4AYC B;  1Z2Q A;  5E9K A;  3ZYQ A;  5CZG A;  4GNE A;  3U5N A;  4KV1 A;  2DAT A;  4Z6H A;  3U5P A;  4WZ3 B;  4XI1 A;  4FJC A;  5LKU A;  5C7N A;  3HME A;  4XY9 A;  3FL2 A;  4CA1 A;  5LKX A;  5G4R A;  4XY8 A;  5FE4 A;  3MUK A;  4UIZ A;  3U5M A;  4GNF A;  2QIZ A;  5EVA A;  5FER A;  5L96 A;  4A9H A;  5CQ6 A;  5CQ5 A;  4CUU A;  5FFW A;  2E7N A;  5A5P A;  4FLP A;  5IBN A;  5KTU A;  4J0R A;  3HCT A;  3SVG A;  4WHU A;  5G4S A;  5L98 A;  3HTK C;  2F6N A;  2EOD A;  4TTE A;  2CKL B;  4HXO A;  4NXJ A;  4LAD B;  5HQ6 A;  5F25 A;  4QYD A;  2YRE A;  5JG6 A;  4O72 A;  2AN6 A;  5D3P A;  2DVV A;  5CQ4 A;  4R7E A;  1ZS5 A;  4UYF B;  4YC9 A;  5EV9 A;  3QZV A;  1LDJ B;  2VJE A;  4L58 A;  5KO4 A;  5F60 A;  3U5O A;  5TB6 A;  1F68 A;  5I7Y A;  4A9I A;  2KGI A;  2L5U A;  2VPG A;  2EA6 A;  3T7L A;  5LJ1 A;  2YQD A;  3D7C A;  3ZVZ B;  5DYU A;  2I7K A;  5D24 A;  4A9M A;  1WGM A;  4KCX A;  3UVY A;  2Y1N A;  5IGM A;  2KTB B;  5EWH A;  4AKN A;  4YY4 A;  5C8G A;  3I2D A;  4YAX A;  5E74 A;  5EA1 A;  2WP2 A;  4NYV A;  5B78 A;  2YW5 A;  4QZS A;  2KGG A;  3C6W A;  2VJF B;  2YYN A;  1K2F A;  4UIU A;  5LUU A;  4NQN A;  2YQM A;  4YBM A;  3O34 A;  4O78 A;  2L0B A;  5C87 A;  5KU3 A;  2D8S A;  4ZDT A;  1RMD A;  5II2 A;  4HXS A;  5ETB A;  2KFT A;  2H60 A;  4XUA A;  5CUE A;  4R2Y A;  4YYI A;  4J0S A;  5FH7 A;  4O75 A;  2F42 A;  5E9I A;  5C89 A;  4B86 C;  4CCG X;  5CGP A;  4O64 A;  5EWD A;  4ZUX U;  1ZBD B;  2Y1M A;  2CKL A;  3O7A A;  4QSP A;  5D3N A;  2R0V A;  3HCS A;  2KR4 A;  3SOW A;  5DKD A;  5EM3 A;  3I3J A;  3N9O A;  2RS9 B;  4YYN A;  4GPJ A;  5H9M A;  4NR5 A;  4TQN A;  2M1R A;  3IU6 A;  1WEV A;  3P1E A;  5EI4 A;  3RTR B;  4YBT A;  2H0D B;  5LCW B;  2JRJ A;  1LDK C;  4UIY A;  5EWW A;  2ECG A;  4QSV A;  4LC2 A;  2KIZ A;  3GV4 A;  2G45 A;  1JM7 B;  3Q2E A;  5LKT A;  2YW8 A;  1HYI A;  3LJW A;  5DFC A;  5A7C A;  4ZC9 A;  3N9Q A;  5K29 A;  3S92 A;  4LYI A;  3MHH A;  3SOX A;  4Z93 A;  2OO1 A;  3RCW A;  2K17 A;  5D1K B;  3UVW A;  3AQA A;  5A85 A;  3PHD A;  5B77 A;  5FH6 A;  2K16 A;  4TZ8 A;  4A9O A;  2VP7 A;  5B79 A;  5LJ2 A;  4O76 A;  2FUI A;  3DQV R;  1WIM A;  3EB5 A;  2QIC A;  5KHM A;  4QNS A;  4YBS A;  5CY9 A;  3LRQ A;  4IR5 A;  4QR3 A;  2XEU A;  3ASL A;  1WEO A;  2LV9 A;  3GL6 A;  2E6R A;  4Q6F A;  4XYA A;  4S3O C;  5EIS A;  1EQF A;  4HBX A;  4TU4 A;  2EGP A;  4OGJ A;  4PKL A;  4YYD A;  5F61 A;  1WE9 A;  4MSX A;  5ACY A;  5CPE A;  4N4I A;  5L97 A;  4E96 A;  4ALG A;  4C9Z A;  2PUY A;  4UIV A;  5EPB A;  4C66 A;  5A5Q A;  5L99 A;  5DFB A;  2MD7 B;  5EIC A;  4IR6 A;  5DX4 A;  4BW1 A;  4F3I A;  5FG6 A;  5CQ8 A;  4CUS A;  3JVK A;  5AD3 A;  5C85 A;  2FSA A;  5TBN A;  5FE3 A;  5D3R A;  4LJN A;  4LZS A;  5E9L A;  2LRI C;  2N9G A;  4HXM A;  3SHB A;  3DAI A;  4HXP A;  3HMH A;  4QR5 A;  3RPG C;  5C13 A;  1E4U A;  2YUC A;  5BT5 A;  5CUD A;  3UVD A;  4X3G A;  2BAY A;  5E9Y A;  4QSR A;  5TDR A;  5FB0 A;  4MEP A;  5DLZ A;  5COI A;  2VPD A;  1XWH A;  4YYJ A;  5C11 A;  4A9J A;  2RNW A;  3NG2 A;  2RNY A;  5DKC A;  5EYA F;  2OUO A;  3LXJ A;  5F3A A;  5KTW A;  2YT5 A;  4PCI A;  5AD2 A;  5C4Q A;  4NR6 A;  2JMJ A;  4HXR A;  3JVM A;  4QSX A;  5HEN A;  2KRE A;  5FG5 A;  5LVR A;  5FEY A;  5EPR A;  3U5L A;  4KV4 A;  4CUQ A;  4QC3 A;  2FUU A;  3MB3 A;  5HFR A;  3U5K A;  2K4D A;  5I83 A;  5A5N A;  3O36 A;  4NYX A;  4TT2 A;  2OSS A;  5F1L A;  2ECN A;  4LZ2 A;  2L85 A;  2KWJ A;  4HBY A;  5D3S A;  5EU1 A;  5LVQ A;  5B76 A;  5HFQ A;  2YDW A;  3HCU A;  1WUM A;  4UYE A;  5EPS A;  5L8U A;  2ZET C;  1MM3 A;  2KU3 A;  5E3D A;  5A5O A;  4NS5 A;  2QJ0 A;  5KH9 A;  5I86 A;  3T6R A;  5ENI A;  4UI9 B;  5HRW A;  5LJ0 A;  2KE1 A;  3JVL A;  2K1J A;  5H1T A;  3L1Z B;  5AME A;  5I89 A;  3M99 A;  4LK9 A;  4AYC A;  4A9N A;  4I7B A;  1WFK A;  4O70 A;  4J3I A;  1JOC A;  2MJV B;  2VPE A;  3O33 A;  1WEQ A;  4QST A;  5FDZ A;  2G6Q A;  5CU8 A;  5CUC A;  4MR5 A;  4UIX A;  5F63 A;  4NR7 A;  1WEU A;  4N3W A;  4GB0 A;  3HMF A;  4QEV A;  2ECV A;  5F62 A;  3NXB A;  5LKZ A;  4AP4 A;  4NUC A;  3VK6 A;  4NR9 A;  3SVH A;  4YYH A;  3EB6 A;  5ENG A;  3L1X A;  3JVJ A;  3ONI A;  4WA6 A;  2NAA A;  4Q0N A;  4QY4 A;  4TT4 A;  4X2I A;  3UV5 A;  1WEP A;  2MA5 A;  3N9N A;  4CFK A;  3UW9 A;  4LYS A;  2I8N A;  4QR4 A;  4QBM A;  2KWK A;  5H85 A;  4CLB A;  1Z6U A;  4UYF A;  1BOR A;  4NUD A;  4TS8 A;  2C2L A;  1N72 A;  5B8D A;  4BW3 A;  4UIT A;  5ENH A;  2E3K A;  5H1U A;  4QSU A;  4A4B A;  5CUB A;  3L11 A;  4MR4 A;  5I29 A;  4YH3 A;  5HJC A;  1VYX A;  4NRC A;  2G4A A;  5DIN A;  2KYU A;  5FG4 A;  4UP0 A;  2YHO A;  5EGU A;  4TU6 A;  2DKW A;  5IID A;  3MXF A;  5AIT A;  4QC1 A;  3KQI A;  3MHS A;  4YH4 A;  5AIU A;  2Y43 A;  5A5S A;  5D3J A;  2IDA A;  2VJF A;  2E6S A;  4C67 A;  2L5E A;  2DX8 A;  2VNF A;  5DYX A;  4UIW A;  3ZVY A;  4FO9 A;  4YYG A;  4TZ2 A;  3MUL A;  5ETD A;  4MR6 A;  3ZPV 1;  5ENE A;  3G0J A;  4OGI A;  2RSD A;  4XUB A;  5TCM A;  3PUQ A;  2RI7 A;  4NR4 A;  4PPE A;  4CL9 A;  5DLX A;  3UV2 A;  4Y03 A;  3U5J A;  1WEW A;  2DWW A;  5F36 A;  4O7E A; 
#chains in the Genus database with same CATH topology
 5EQ1 A;  4NRB A;  4O7B A;  4QSQ A;  2YYR A;  5DW2 A;  3IHP A;  5DYA A;  4NRA A;  4A9K A;  4Z6I A;  4TT6 A;  5DW1 A;  3VKG A;  4HBV A;  2HDP A;  5CQT A;  5KTX A;  4UYH A;  3N9M A;  4LDF A;  5DKH A;  4QSW A;  5FE0 A;  5HEL A;  3M62 A;  3Q1D A;  5CRZ A;  2JMI A;  5KH3 A;  5HLS A;  4A9F A;  3P1F A;  5BT3 A;  1V87 A;  5CUA A;  2WP1 A;  2R0S A;  5D3L A;  1U6G B;  4MEO A;  4N4H A;  3LQI A;  3V43 A;  3PUR A;  2CT2 A;  1X0J A;  2H0D A;  5D0C A;  5E73 A;  2PNX A;  4QUU A;  5ENJ A;  4UP5 A;  4V3L C;  4WZ0 A;  2EGM A;  4QB3 A;  1JM7 A;  5FE5 A;  3FJU B;  5D1M B;  5E9M A;  3UVX A;  1DCQ A;  5JI8 A;  4IR4 A;  4HXK A;  5DBM A;  2I50 A;  2MUM A;  2LQ6 A;  2MD8 C;  4O71 A;  2R0Y A;  3AAD A;  4NN2 A;  5HRV A;  3MB4 A;  4LYW A;  2IQJ A;  4A49 A;  4L7X A;  1FBV A;  5D1L B;  4TKP B;  2KWN A;  4QEU A;  2LGK A;  2L80 A;  4QEW A;  4LZR A;  4HBW A;  1F62 A;  2D82 A;  4O74 A;  5D25 A;  5EWC A;  5TDW A;  5J3X A;  4YK0 A;  1IYM A;  4ZW1 A;  3DWY A;  4BJX A;  2LN0 A;  4FIP A;  4O77 A;  1N87 A;  5FE2 A;  1WEN A;  3KV5 A;  2OXQ C;  3LQJ A;  2YEK A;  5A81 A;  5J0D A;  3O70 A;  2LXH C;  4MEQ A;  1WEE A;  4B7Y C;  2L84 A;  3QZT A;  5FFY A;  5FE9 A;  3LQH A;  3S91 A;  4QQ4 A;  5G0F A;  2CSY A;  4DON A;  1CHC A;  2E61 A;  3M7K A;  2MNZ A;  2FD4 A;  4HXL A;  5AMF A;  5E7D A;  5I7X A;  3SVF A;  5ENF A;  2RO1 A;  5D3H A;  5FE8 A;  2YEM A;  2CSZ A;  4V3K C;  1T1H A;  1X4J A;  5EK9 A;  3O35 A;  4QUT A;  1X4I A;  2L43 A;  5ENB A;  4FK5 A;  2HYE D;  2B0O E;  4BBQ A;  3FEH A;  4I7D A;  1WUG A;  2RFJ A;  2GRC A;  4O7C A;  2C2V S;  4A9E A;  4J1P A;  3SOU A;  3G0L A;  5DY7 A;  4YYM A;  4AKI A;  2MT5 A;  4Z1S A;  5D26 A;  4S3O B;  3GG3 A;  3UV4 A;  4IOR A;  2D9E A;  5SVX A;  4HXN A;  3MDB C;  2LGL A;  5CRM A;  5E9V A;  1G25 A;  5EWV A;  4YAB A;  5F5Z A;  3P1D A;  2YQL A;  2F6J A;  5D7X A;  5IGK A;  2YU4 A;  4CUP A;  5CQ7 A;  4A4C A;  1FP0 A;  2L75 A;  3ZPV E;  3C5K A;  4WIV A;  4MEN A;  5FE7 A;  2XOZ A;  5FE6 A;  5DKA A;  4UYD A;  4YAT A;  5FFV A;  5I3L A;  5HM0 A;  3DWD A;  4ZQL A;  5IG6 A;  3DDT A;  5HQ7 A;  4MR3 A;  4W4U A;  2MIQ A;  1JSP B;  5BT4 A;  4LKA A;  4AVX A;  3TLP A;  5HQ5 A;  4IR3 A;  2UZG A;  4P5O B;  4H9D A;  5A5R A;  4GND A;  5G04 B;  5CFW A;  5TAB A;  4PTB A;  2XB1 A;  2M13 A;  4IC3 A;  5CS8 A;  3RPG B;  4A0C D;  3QZS A;  5E0R A;  2ECJ A;  1Z60 A;  2MNY A;  3MQM A;  2XP0 A;  5IGL A;  1VFY A;  2YSM A;  4QSS A;  4BHW A;  5I80 A;  4R8P K;  5CP5 A;  5KH7 A;  4LRG A;  4ALH A;  3IU5 A;  2LGV A;  1HYJ A;  2DVQ A;  4O7A A;  4YAD A;  5D3T A;  2YHN A;  3ZNI A;  1VD4 A;  5II1 A;  2R10 A;  4AUQ B;  5HCL A;  3JUE A;  5CTL A;  5FE1 A;  3ZYU A;  5H1V A;  3O37 A;  1E6I A;  5IGN A;  2G43 A;  1MM2 A;  4I7C A;  2YUR A;  5JWM A;  2M6M A;  4LLB A;  4CFL A;  5A83 A;  4TYL A;  5FH8 A;  3M63 A;  4PS5 A;  2M3H A;  4QYL A;  5A82 A;  4YYK A;  3DPL R;  4RVR A;  5CQ3 A;  5CUG A;  5I88 A;  1WIL A;  4UYG A;  5B75 A;  2LDR A;  3Q2F A;  4CUR A;  5I1Q A;  4Q0O A;  3PLW A;  4WHW A;  5FB1 A;  4A9L A;  2ECT A;  5F1H A;  3FKM X;  5HEM A;  5G05 B;  4CUT A;  4NR8 A;  3K2J A;  2ECW A;  2CRR A;  2JMD A;  2YEL A;  4NUE A;  4O7F A;  2LXP C;  2NXB A;  4N4G A;  2RNX A;  1JM4 B;  1WES A;  4O62 A;  4YY6 A;  3LDY A;  2DSM A;  1DVP A;  4QF2 A;  2VPB A;  4OUF A;  2YSJ A;  4BW4 A;  4PCE A;  4NQM A;  2DVS A;  4IC2 A;  5CQA A;  4QF3 A;  5ENC A;  4GNG A;  4BW2 A;  2VJE B;  3N9P A;  4PY6 A;  4F52 B;  2ECI A;  2KWO A;  5SVY A;  3ZTG A;  3N9L A;  3O47 A;  2LGG A;  2E7O A;  5FBX A;  4Z1Q A;  3KV6 A;  5DYC A;  1MBM A;  1WEM A;  4IOO A;  3P5O A;  5E3G A;  5HRX A;  4N4F A;  4MVT A;  4IOQ A;  4Z0O A;  2LSP B;  5I40 A;  5F2P A;  2EXU A;  3P1C A;  2MA6 A;  2M85 A;  4NYW A;  5DFD A;  2DVR A;  5L8T A;  4WZ2 A;  5EP7 A;  1X4U A;  3KNV A;  5TRB A;  4LR6 A;  4AYC B;  1Z2Q A;  5E9K A;  3ZYQ A;  5CZG A;  4GNE A;  3U5N A;  4KV1 A;  2DAT A;  4Z6H A;  3U5P A;  4WZ3 B;  4XI1 A;  4FJC A;  5LKU A;  5C7N A;  3HME A;  4XY9 A;  3FL2 A;  4CA1 A;  5LKX A;  5G4R A;  4XY8 A;  5FE4 A;  3MUK A;  4UIZ A;  3U5M A;  3FM8 C;  4GNF A;  2QIZ A;  5EVA A;  5FER A;  5L96 A;  4A9H A;  5CQ6 A;  5CQ5 A;  4CUU A;  4F1P A;  5FFW A;  2E7N A;  5A5P A;  2FFW A;  4FLP A;  5IBN A;  5KTU A;  4J0R A;  3HCT A;  3SVG A;  4WHU A;  5G4S A;  5L98 A;  2P57 A;  3HTK C;  2F6N A;  2EOD A;  4TTE A;  2CKL B;  4HXO A;  4NXJ A;  4LAD B;  5HQ6 A;  5F25 A;  4QYD A;  2YRE A;  5JG6 A;  2KKY A;  4O72 A;  2AN6 A;  5D3P A;  2DVV A;  5CQ4 A;  4R7E A;  1ZS5 A;  4UYF B;  4YC9 A;  5EV9 A;  3QZV A;  1LDJ B;  2VJE A;  4L58 A;  5KO4 A;  5F60 A;  3U5O A;  5TB6 A;  1F68 A;  5I7Y A;  4A9I A;  2KGI A;  2L5U A;  2VPG A;  2EA6 A;  3T7L A;  5LJ1 A;  2YQD A;  3D7C A;  3ZVZ B;  5DYU A;  2I7K A;  5D24 A;  4A9M A;  1WGM A;  4KCX A;  3UVY A;  2L7P A;  5IGM A;  2Y1N A;  2KTB B;  5EWH A;  4AKN A;  4YY4 A;  5C8G A;  3I2D A;  4YAX A;  5E74 A;  5EA1 A;  3T9K A;  2WP2 A;  4NYV A;  5B78 A;  2YW5 A;  4QZS A;  2KGG A;  3C6W A;  2VJF B;  2YYN A;  1K2F A;  4UIU A;  2OWA A;  5LUU A;  4NQN A;  2YQM A;  4YBM A;  3O34 A;  4O78 A;  2L0B A;  5C87 A;  5KU3 A;  2D8S A;  4ZDT A;  1RMD A;  5II2 A;  4HXS A;  5ETB A;  2KFT A;  2H60 A;  4XUA A;  5CUE A;  4R2Y A;  4YYI A;  4J0S A;  5FH7 A;  4O75 A;  2F42 A;  5E9I A;  5C89 A;  4B86 C;  4CCG X;  5CGP A;  2RR4 A;  4O64 A;  5EWD A;  4ZUX U;  1ZBD B;  2Y1M A;  2CKL A;  3O7A A;  4QSP A;  5D3N A;  2R0V A;  3HCS A;  2KR4 A;  3SOW A;  5DKD A;  5EM3 A;  3LVR E;  3I3J A;  3N9O A;  2RS9 B;  4YYN A;  4GPJ A;  5H9M A;  4NR5 A;  4TQN A;  2M1R A;  3IU6 A;  1WEV A;  3P1E A;  5EI4 A;  3RTR B;  4YBT A;  2H0D B;  5LCW B;  2JRJ A;  1LDK C;  4UIY A;  5EWW A;  2ECG A;  4QSV A;  4LC2 A;  2KIZ A;  3GV4 A;  2G45 A;  1JM7 B;  3Q2E A;  5LKT A;  2YW8 A;  4OGE A;  1HYI A;  3LJW A;  5DFC A;  5A7C A;  4ZC9 A;  3N9Q A;  5K29 A;  3S92 A;  4LYI A;  3MHH A;  3SOX A;  4Z93 A;  2OO1 A;  3E2D A;  3RCW A;  2K17 A;  5D1K B;  3UVW A;  3AQA A;  5A85 A;  3PHD A;  5B77 A;  5FH6 A;  2K16 A;  4TZ8 A;  4A9O A;  2VP7 A;  5B79 A;  5LJ2 A;  4O76 A;  2FUI A;  2JM3 A;  3DQV R;  5SVI B;  2MKE A;  1WIM A;  3EB5 A;  2QIC A;  5KHM A;  4QNS A;  4YBS A;  5CY9 A;  3LRQ A;  4IR5 A;  4QR3 A;  2XEU A;  3ASL A;  1WEO A;  2LV9 A;  3GL6 A;  2E6R A;  2YVR A;  3KDE C;  4Q6F A;  4XYA A;  4S3O C;  5EIS A;  1EQF A;  4HBX A;  4TU4 A;  2EGP A;  2LAU A;  4OGJ A;  4PKL A;  4YYD A;  5F61 A;  4OGC A;  1WE9 A;  4MSX A;  5ACY A;  5CPE A;  4N4I A;  5L97 A;  4E96 A;  4ALG A;  4C9Z A;  2PUY A;  4UIV A;  5EPB A;  4C66 A;  5A5Q A;  5L99 A;  5DFB A;  2MD7 B;  5EIC A;  4IR6 A;  5DX4 A;  4BW1 A;  4F3I A;  5FG6 A;  4AKH A;  5CQ8 A;  4CUS A;  3JVK A;  5AD3 A;  5C85 A;  2FSA A;  5TBN A;  5FE3 A;  5D3R A;  4AKG A;  4LJN A;  4LZS A;  5E9L A;  2LRI C;  2N9G A;  4HXM A;  3SHB A;  3DAI A;  4HXP A;  3HMH A;  4QR5 A;  2EJN A;  3RPG C;  5C13 A;  1E4U A;  2YUC A;  5BT5 A;  5CUD A;  3UVD A;  3LJU X;  4X3G A;  2BAY A;  5E9Y A;  4QSR A;  5TDR A;  5FB0 A;  4MEP A;  5DLZ A;  5COI A;  2VPD A;  1XWH A;  4YYJ A;  5C11 A;  4A9J A;  2RNW A;  3NG2 A;  2CON A;  2RNY A;  5DKC A;  5EYA F;  2OUO A;  3LXJ A;  5F3A A;  5KTW A;  2YT5 A;  4PCI A;  5AD2 A;  5C4Q A;  4NR6 A;  2JMJ A;  4HXR A;  3JVM A;  4QSX A;  5HEN A;  2KRE A;  5FG5 A;  5LVR A;  5SVI A;  4Z0R A;  5FEY A;  5EPR A;  3U5L A;  4KV4 A;  4CUQ A;  4QC3 A;  2FUU A;  3MB3 A;  5HFR A;  3U5K A;  2K4D A;  5I83 A;  5A5N A;  3O36 A;  4NYX A;  4TT2 A;  2OSS A;  5F1L A;  2ECN A;  4LZ2 A;  2L85 A;  2KWJ A;  4HBY A;  5D3S A;  5EU1 A;  5LVQ A;  5B76 A;  5HFQ A;  2YDW A;  3HCU A;  1WUM A;  4UYE A;  5EPS A;  5L8U A;  2ZET C;  1MM3 A;  2KU3 A;  5E3D A;  5A5O A;  4NS5 A;  2QJ0 A;  5KH9 A;  5I86 A;  3T6R A;  5ENI A;  2CRW A;  4UI9 B;  5HRW A;  5LJ0 A;  2KE1 A;  3JVL A;  2K1J A;  5H1T A;  3L1Z B;  5AME A;  5I89 A;  3VKH A;  3M99 A;  4LK9 A;  4AYC A;  4A9N A;  4I7B A;  1WFK A;  4O70 A;  4J3I A;  1JOC A;  2MJV B;  2VPE A;  3O33 A;  1WEQ A;  4QST A;  5FDZ A;  2G6Q A;  5CU8 A;  3ERR A;  4MR5 A;  4UIX A;  5CUC A;  4NR7 A;  5F63 A;  1WEU A;  4N3W A;  4GB0 A;  3HMF A;  4QEV A;  2ECV A;  5F62 A;  3NXB A;  2D8U A;  5LKZ A;  4AP4 A;  3H7H A;  4NUC A;  3VK6 A;  4NR9 A;  3SVH A;  4YYH A;  3EB6 A;  3SUB A;  5ENG A;  1PUO A;  2JUN A;  3L1X A;  3JVJ A;  3ONI A;  4WA6 A;  2NAA A;  4Q0N A;  4QY4 A;  4TT4 A;  4X2I A;  3UV5 A;  1WEP A;  2MA5 A;  3N9N A;  4CFK A;  3UW9 A;  4LYS A;  2I8N A;  4QR4 A;  4QBM A;  2KWK A;  5H85 A;  4CLB A;  1Z6U A;  4UYF A;  1BOR A;  4NUD A;  4TS8 A;  2C2L A;  1N72 A;  2XOY A;  5B8D A;  4BW3 A;  3D1D A;  3FAN A;  4UIT A;  2KKX A;  5ENH A;  2E3K A;  5H1U A;  2DJA A;  4QSU A;  3D1B A;  4A4B A;  5CUB A;  3L11 A;  2CSV A;  4MR4 A;  5I29 A;  4YH3 A;  5HJC A;  1VYX A;  4NRC A;  2G4A A;  5DIN A;  2KYU A;  5FG4 A;  4UP0 A;  3FAO A;  2YHO A;  5EGU A;  4TU6 A;  2DKW A;  5IID A;  3MXF A;  5AIT A;  4QC1 A;  4AI6 A;  3KQI A;  4YH4 A;  3MHS A;  5AIU A;  2Y43 A;  5A5S A;  5D3J A;  2IDA A;  2VJF A;  2E6S A;  4C67 A;  1ZKR A;  2L5E A;  2DX8 A;  2VNF A;  5DYX A;  4UIW A;  3ZVY A;  4FO9 A;  4YYG A;  4TZ2 A;  3MUL A;  5K3Q A;  5ETD A;  4MR6 A;  3ZPV 1;  5ENE A;  3G0J A;  4OGI A;  2RSD A;  4XUB A;  5TCM A;  3PUQ A;  2RI7 A;  4NR4 A;  4PPE A;  4CL9 A;  5DLX A;  3UV2 A;  4Y03 A;  3U5J A;  3LVQ E;  1WEW A;  2XOC A;  2DWW A;  5F36 A;  4O7E A; 
#chains in the Genus database with same CATH homology
 5EQ1 A;  4NRB A;  4O7B A;  4QSQ A;  2YYR A;  5DW2 A;  3IHP A;  5DYA A;  4NRA A;  4A9K A;  4Z6I A;  4TT6 A;  5DW1 A;  4HBV A;  2HDP A;  5CQT A;  5KTX A;  4UYH A;  3N9M A;  4LDF A;  5DKH A;  4QSW A;  5FE0 A;  5HEL A;  3M62 A;  5CRZ A;  2JMI A;  5KH3 A;  5HLS A;  4A9F A;  3P1F A;  5BT3 A;  1V87 A;  5CUA A;  2WP1 A;  2R0S A;  5D3L A;  1U6G B;  4MEO A;  4N4H A;  3LQI A;  3V43 A;  3PUR A;  2CT2 A;  1X0J A;  2H0D A;  5D0C A;  5E73 A;  2PNX A;  4QUU A;  5ENJ A;  4UP5 A;  4V3L C;  4WZ0 A;  4QB3 A;  1JM7 A;  5FE5 A;  5D1M B;  5E9M A;  3UVX A;  5JI8 A;  4IR4 A;  4HXK A;  5DBM A;  2I50 A;  2MUM A;  2LQ6 A;  2MD8 C;  4O71 A;  2R0Y A;  3AAD A;  4NN2 A;  5HRV A;  3MB4 A;  4LYW A;  4A49 A;  4L7X A;  1FBV A;  5D1L B;  4TKP B;  2KWN A;  4QEU A;  2LGK A;  2L80 A;  4QEW A;  4LZR A;  4HBW A;  1F62 A;  2D82 A;  4O74 A;  5D25 A;  5EWC A;  5TDW A;  5J3X A;  4YK0 A;  1IYM A;  4ZW1 A;  3DWY A;  4BJX A;  2LN0 A;  4FIP A;  4O77 A;  1N87 A;  5FE2 A;  1WEN A;  3KV5 A;  2OXQ C;  3LQJ A;  2YEK A;  5A81 A;  5J0D A;  3O70 A;  2LXH C;  4MEQ A;  1WEE A;  4B7Y C;  2L84 A;  3QZT A;  5FFY A;  5FE9 A;  3LQH A;  3S91 A;  5G0F A;  2CSY A;  4DON A;  1CHC A;  2MNZ A;  4HXL A;  5AMF A;  5E7D A;  5I7X A;  3SVF A;  5ENF A;  2RO1 A;  5D3H A;  5FE8 A;  2YEM A;  2CSZ A;  4V3K C;  1T1H A;  1X4J A;  5EK9 A;  3O35 A;  4QUT A;  1X4I A;  2L43 A;  5ENB A;  4FK5 A;  2HYE D;  4BBQ A;  4I7D A;  1WUG A;  2RFJ A;  2GRC A;  4O7C A;  2C2V S;  4A9E A;  4J1P A;  3SOU A;  3G0L A;  5DY7 A;  4YYM A;  2MT5 A;  4Z1S A;  5D26 A;  4S3O B;  3GG3 A;  3UV4 A;  4IOR A;  2D9E A;  4HXN A;  2LGL A;  5CRM A;  5E9V A;  1G25 A;  5EWV A;  4YAB A;  5F5Z A;  3P1D A;  2YQL A;  2F6J A;  5D7X A;  5IGK A;  2YU4 A;  4CUP A;  5CQ7 A;  4A4C A;  1FP0 A;  2L75 A;  3ZPV E;  3C5K A;  4WIV A;  4MEN A;  5FE7 A;  5FE6 A;  5DKA A;  4UYD A;  4YAT A;  5FFV A;  5I3L A;  5HM0 A;  4ZQL A;  5IG6 A;  5HQ7 A;  4MR3 A;  4W4U A;  2MIQ A;  1JSP B;  5BT4 A;  4LKA A;  4AVX A;  3TLP A;  5HQ5 A;  4IR3 A;  2UZG A;  4P5O B;  5A5R A;  4GND A;  5G04 B;  5CFW A;  5TAB A;  4PTB A;  2XB1 A;  4IC3 A;  5CS8 A;  3RPG B;  4A0C D;  3QZS A;  5E0R A;  2ECJ A;  1Z60 A;  2MNY A;  3MQM A;  5IGL A;  1VFY A;  2YSM A;  4QSS A;  4BHW A;  5I80 A;  4R8P K;  5CP5 A;  5KH7 A;  4LRG A;  4ALH A;  3IU5 A;  2LGV A;  1HYJ A;  2DVQ A;  4O7A A;  4YAD A;  5D3T A;  2YHN A;  3ZNI A;  1VD4 A;  5II1 A;  2R10 A;  4AUQ B;  5HCL A;  5CTL A;  5FE1 A;  3ZYU A;  5H1V A;  3O37 A;  1E6I A;  5IGN A;  2G43 A;  1MM2 A;  4I7C A;  2YUR A;  5JWM A;  2M6M A;  4LLB A;  4CFL A;  5A83 A;  4TYL A;  5FH8 A;  3M63 A;  4PS5 A;  2M3H A;  4QYL A;  5A82 A;  4YYK A;  3DPL R;  4RVR A;  5CQ3 A;  5CUG A;  5I88 A;  1WIL A;  4UYG A;  5B75 A;  2LDR A;  3Q2F A;  4CUR A;  5I1Q A;  4Q0O A;  4WHW A;  5FB1 A;  4A9L A;  2ECT A;  5F1H A;  3FKM X;  5HEM A;  5G05 B;  4CUT A;  4NR8 A;  3K2J A;  2ECW A;  2JMD A;  2YEL A;  4NUE A;  4O7F A;  2LXP C;  2NXB A;  4N4G A;  2RNX A;  1JM4 B;  1WES A;  4YY6 A;  1DVP A;  4QF2 A;  2VPB A;  4OUF A;  2YSJ A;  4BW4 A;  4PCE A;  4NQM A;  2DVS A;  4IC2 A;  5CQA A;  4QF3 A;  5ENC A;  4GNG A;  4BW2 A;  2VJE B;  3N9P A;  4PY6 A;  4F52 B;  2ECI A;  2KWO A;  3ZTG A;  3N9L A;  2LGG A;  2E7O A;  5FBX A;  4Z1Q A;  3KV6 A;  5DYC A;  1WEM A;  4IOO A;  3P5O A;  5E3G A;  5HRX A;  4N4F A;  4MVT A;  4IOQ A;  2LSP B;  5I40 A;  5F2P A;  2MA6 A;  3P1C A;  2M85 A;  4NYW A;  5DFD A;  2DVR A;  5L8T A;  4WZ2 A;  5EP7 A;  1X4U A;  3KNV A;  5TRB A;  4LR6 A;  4AYC B;  1Z2Q A;  5E9K A;  3ZYQ A;  5CZG A;  4GNE A;  3U5N A;  4KV1 A;  2DAT A;  4Z6H A;  3U5P A;  4WZ3 B;  4XI1 A;  4FJC A;  5LKU A;  5C7N A;  3HME A;  4XY9 A;  3FL2 A;  4CA1 A;  5LKX A;  5G4R A;  4XY8 A;  5FE4 A;  3MUK A;  4UIZ A;  3U5M A;  4GNF A;  2QIZ A;  5EVA A;  5FER A;  5L96 A;  4A9H A;  5CQ6 A;  5CQ5 A;  4CUU A;  5FFW A;  2E7N A;  5A5P A;  4FLP A;  5IBN A;  5KTU A;  4J0R A;  3HCT A;  3SVG A;  4WHU A;  5G4S A;  5L98 A;  3HTK C;  2F6N A;  2EOD A;  4TTE A;  2CKL B;  4HXO A;  4NXJ A;  4LAD B;  5HQ6 A;  5F25 A;  4QYD A;  2YRE A;  5JG6 A;  4O72 A;  2AN6 A;  5D3P A;  2DVV A;  5CQ4 A;  4R7E A;  1ZS5 A;  4UYF B;  4YC9 A;  5EV9 A;  3QZV A;  1LDJ B;  2VJE A;  4L58 A;  5KO4 A;  5F60 A;  3U5O A;  5TB6 A;  1F68 A;  5I7Y A;  4A9I A;  2KGI A;  2L5U A;  2VPG A;  2EA6 A;  3T7L A;  5LJ1 A;  2YQD A;  3D7C A;  3ZVZ B;  5DYU A;  2I7K A;  5D24 A;  4A9M A;  1WGM A;  4KCX A;  3UVY A;  2Y1N A;  5IGM A;  2KTB B;  5EWH A;  4AKN A;  4YY4 A;  5C8G A;  3I2D A;  4YAX A;  5E74 A;  5EA1 A;  2WP2 A;  4NYV A;  5B78 A;  2YW5 A;  4QZS A;  2KGG A;  3C6W A;  2VJF B;  2YYN A;  1K2F A;  4UIU A;  5LUU A;  4NQN A;  2YQM A;  4YBM A;  3O34 A;  4O78 A;  2L0B A;  5C87 A;  5KU3 A;  2D8S A;  4ZDT A;  1RMD A;  5II2 A;  4HXS A;  5ETB A;  2KFT A;  2H60 A;  4XUA A;  5CUE A;  4R2Y A;  4YYI A;  4J0S A;  5FH7 A;  4O75 A;  2F42 A;  5E9I A;  5C89 A;  4B86 C;  4CCG X;  5CGP A;  4O64 A;  5EWD A;  4ZUX U;  1ZBD B;  2Y1M A;  2CKL A;  3O7A A;  4QSP A;  5D3N A;  2R0V A;  3HCS A;  2KR4 A;  3SOW A;  5DKD A;  5EM3 A;  3I3J A;  3N9O A;  2RS9 B;  4YYN A;  4GPJ A;  5H9M A;  4NR5 A;  4TQN A;  2M1R A;  3IU6 A;  1WEV A;  3P1E A;  5EI4 A;  3RTR B;  4YBT A;  2H0D B;  5LCW B;  2JRJ A;  1LDK C;  4UIY A;  5EWW A;  2ECG A;  4QSV A;  4LC2 A;  2KIZ A;  3GV4 A;  2G45 A;  1JM7 B;  3Q2E A;  5LKT A;  2YW8 A;  1HYI A;  3LJW A;  5DFC A;  5A7C A;  4ZC9 A;  3N9Q A;  5K29 A;  3S92 A;  4LYI A;  3MHH A;  3SOX A;  4Z93 A;  2OO1 A;  3RCW A;  2K17 A;  5D1K B;  3UVW A;  3AQA A;  5A85 A;  3PHD A;  5B77 A;  5FH6 A;  2K16 A;  4TZ8 A;  4A9O A;  2VP7 A;  5B79 A;  5LJ2 A;  4O76 A;  2FUI A;  3DQV R;  1WIM A;  3EB5 A;  2QIC A;  5KHM A;  4QNS A;  4YBS A;  5CY9 A;  3LRQ A;  4IR5 A;  4QR3 A;  2XEU A;  3ASL A;  1WEO A;  2LV9 A;  3GL6 A;  2E6R A;  4Q6F A;  4XYA A;  4S3O C;  5EIS A;  1EQF A;  4HBX A;  4TU4 A;  2EGP A;  4OGJ A;  4PKL A;  4YYD A;  5F61 A;  1WE9 A;  4MSX A;  5ACY A;  5CPE A;  4N4I A;  5L97 A;  4E96 A;  4ALG A;  4C9Z A;  2PUY A;  4UIV A;  5EPB A;  4C66 A;  5A5Q A;  5L99 A;  5DFB A;  2MD7 B;  5EIC A;  4IR6 A;  5DX4 A;  4BW1 A;  4F3I A;  5FG6 A;  5CQ8 A;  4CUS A;  3JVK A;  5AD3 A;  5C85 A;  2FSA A;  5TBN A;  5FE3 A;  5D3R A;  4LJN A;  4LZS A;  5E9L A;  2LRI C;  2N9G A;  4HXM A;  3SHB A;  3DAI A;  4HXP A;  3HMH A;  4QR5 A;  3RPG C;  5C13 A;  1E4U A;  2YUC A;  5BT5 A;  5CUD A;  3UVD A;  4X3G A;  2BAY A;  5E9Y A;  4QSR A;  5TDR A;  5FB0 A;  4MEP A;  5DLZ A;  5COI A;  2VPD A;  1XWH A;  4YYJ A;  5C11 A;  4A9J A;  2RNW A;  3NG2 A;  2RNY A;  5DKC A;  5EYA F;  2OUO A;  3LXJ A;  5F3A A;  5KTW A;  2YT5 A;  4PCI A;  5AD2 A;  5C4Q A;  4NR6 A;  2JMJ A;  4HXR A;  3JVM A;  4QSX A;  5HEN A;  2KRE A;  5FG5 A;  5LVR A;  5FEY A;  5EPR A;  3U5L A;  4KV4 A;  4CUQ A;  4QC3 A;  2FUU A;  3MB3 A;  5HFR A;  3U5K A;  2K4D A;  5I83 A;  5A5N A;  3O36 A;  4NYX A;  4TT2 A;  2OSS A;  5F1L A;  2ECN A;  4LZ2 A;  2L85 A;  2KWJ A;  4HBY A;  5D3S A;  5EU1 A;  5LVQ A;  5B76 A;  5HFQ A;  2YDW A;  3HCU A;  1WUM A;  4UYE A;  5EPS A;  5L8U A;  2ZET C;  1MM3 A;  2KU3 A;  5E3D A;  5A5O A;  4NS5 A;  2QJ0 A;  5KH9 A;  5I86 A;  3T6R A;  5ENI A;  4UI9 B;  5HRW A;  5LJ0 A;  2KE1 A;  3JVL A;  2K1J A;  5H1T A;  3L1Z B;  5AME A;  5I89 A;  3M99 A;  4LK9 A;  4AYC A;  4A9N A;  4I7B A;  1WFK A;  4O70 A;  4J3I A;  1JOC A;  2MJV B;  2VPE A;  3O33 A;  1WEQ A;  4QST A;  5FDZ A;  2G6Q A;  5CU8 A;  5CUC A;  4MR5 A;  4UIX A;  5F63 A;  4NR7 A;  1WEU A;  4N3W A;  4GB0 A;  3HMF A;  4QEV A;  2ECV A;  5F62 A;  3NXB A;  5LKZ A;  4AP4 A;  4NUC A;  3VK6 A;  4NR9 A;  3SVH A;  4YYH A;  3EB6 A;  5ENG A;  3L1X A;  3JVJ A;  3ONI A;  4WA6 A;  2NAA A;  4Q0N A;  4QY4 A;  4TT4 A;  4X2I A;  3UV5 A;  1WEP A;  2MA5 A;  3N9N A;  4CFK A;  3UW9 A;  4LYS A;  2I8N A;  4QR4 A;  4QBM A;  2KWK A;  5H85 A;  4CLB A;  1Z6U A;  4UYF A;  1BOR A;  4NUD A;  4TS8 A;  2C2L A;  1N72 A;  5B8D A;  4BW3 A;  4UIT A;  5ENH A;  2E3K A;  5H1U A;  4QSU A;  4A4B A;  5CUB A;  3L11 A;  4MR4 A;  5I29 A;  4YH3 A;  5HJC A;  1VYX A;  4NRC A;  2G4A A;  5DIN A;  2KYU A;  5FG4 A;  4UP0 A;  2YHO A;  5EGU A;  4TU6 A;  2DKW A;  5IID A;  3MXF A;  5AIT A;  4QC1 A;  3KQI A;  3MHS A;  4YH4 A;  5AIU A;  2Y43 A;  5A5S A;  5D3J A;  2IDA A;  2VJF A;  2E6S A;  4C67 A;  2L5E A;  2DX8 A;  2VNF A;  5DYX A;  4UIW A;  3ZVY A;  4FO9 A;  4YYG A;  4TZ2 A;  3MUL A;  5ETD A;  4MR6 A;  3ZPV 1;  5ENE A;  3G0J A;  4OGI A;  2RSD A;  4XUB A;  5TCM A;  3PUQ A;  2RI7 A;  4NR4 A;  4PPE A;  4CL9 A;  5DLX A;  3UV2 A;  4Y03 A;  3U5J A;  1WEW A;  2DWW A;  5F36 A;  4O7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...