5FB0A

Crystal structure of a phd finger bound to histone h3 t3ph peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
183
structure length
172
Chain Sequence
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERSGHQESEVLMRQMQPEEQLKCEFLLLKVYCDSKSSFFASEPYYGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/structural protein
molecule keywords Nuclear autoantigen Sp-100
total genus 59
structure length 172
sequence length 183
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb0A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb0A01
4A4BA 5C11A 3S91A 1WEWA 4Z93A 1WEPA 4KV1A 1LDJB 5DW1A 5CQTA 1WILA 2LRIC 2OO1A 4FO9A 5CQ6A 5HRXA 2EGPA 4E96A 5CQ4A 2KU3A 3P5OA 4HBYA 4QSQA 5G4RA 3HMEA 4YADA 2F6JA 5HRVA 4LC2A 5IG6A 5AITA 3GL6A 2MIQA 3ZPV1 5H85A 4Q0OA 2I8NA 2KE1A 5ETDA 3IU6A 3UV4A 1JSPB 3SOXA 5LJ0A 2DVVA 1E4UA 3LQJA 2YUCA 4IR6A 1WIMA 4YATA 5I1QA 4IC2A 3KV6A 2LV9A 2G4AA 4NR9A 4QUUA 1JM4B 1JM7B 2JMJA 5AD2A 1X4UA 4N4HA 2E6RA 4Q0NA 5EWWA 5CY9A 2L0BA 3FL2A 4MSXA 4HXKA 2CKLB 5J3XA 5HRWA 2KTBB 5C8GA 3S92A 1WEOA 3ZVZB 3RPGC 2AN6A 4QNSA 2OUOA 3UVYA 2JMIA 3O7AA 5JWMA 4YBSA 4PPEA 4YH3A 2D8SA 4TT4A 4UP0A 3UV2A 5B79A 5F2PA 3Q2EA 5EWVA 2VP7A 2L80A 4NS5A 4LYSA 5ETBA 2ECWA 2VJFA 5DYCA 4ZC9A 4YYGA 5A82A 3FKMX 4WHUA 4B86C 4A9FA 2VPGA 5TB6A 5JI8A 5EPBA 5KTUA 2YW8A 1HYIA 5DLXA 4ZW1A 2PNXA 4HBVA 5FFVA 3Q2FA 4BW3A 2EODA 4PKLA 5CRMA 4YBMA 3G0LA 5HFRA 2H60A 2YW5A 4BHWA 2C2LA 3O36A 3NG2A 5C89A 5DKCA 2R0VA 4UYGA 2M1RA 1K2FA 4IOOA 4NQNA 4UYFB 5F25A 4TU4A 5CQ8A 1WESA 4S3OB 2OXQC 5A5NA 3L11A 2YHOA 4C9ZA 4PY6A 4NYXA 5ENEA 5KH9A 2N9GA 5FE1A 4LYIA 2M3HA 4Z6HA 2KWNA 4F52B 5EICA 4WHWA 2VJEA 3KV5A 2C2VS 4A9LA 5C13A 4PCIA 4NYVA 5LKZA 2D82A 5I3LA 4YYKA 1Z60A 2YHNA 1LDKC 4W4UA 2KFTA 4MENA 2R10A 4IR4A 1F62A 4YYMA 4N4IA 5KO4A 4B7YC 4Q6FA 5E9YA 2JRJA 5AMEA 3JVKA 4NXJA 5HQ5A 5D24A 4QSPA 5F1HA 5CGPA 5DINA 5HELA 5I89A 4AUQB 5DLZA 1U6GB 4QSTA 2VJEB 2UZGA 5I88A 4Z1QA 3RPGB 4YYHA 3M62A 2YREA 5ENHA 4IOQA 5FE9A 4FK5A 5E9IA 4YAXA 4QC3A 5IGKA 4V3KC 5CQ3A 2CKLA 5DFBA 1JM7A 3UW9A 2GRCA 3LJWA 4QEVA 5TDWA 5TBNA 4UIVA 4A9EA 5E3DA 5DBMA 2FSAA 4LKAA 5D3NA 4XY9A 2HDPA 2HYED 5LKUA 2LGVA 4I7CA 5CTLA 5DKAA 4QSUA 3ZPVE 3V43A 5IGNA 4A49A 4CFKA 4YYNA 5CU8A 5CQ7A 4QY4A 5EA1A 4BBQA 5CUDA 5I40A 3PHDA 4O72A 4QR4A 3M63A 4KCXA 2E7OA 3U5PA 4CUPA 2JMDA 4TU6A 5FE4A 4GNGA 5D1LB 2KR4A 4I7DA 5CUBA 5C7NA 4A9KA 4UIXA 5KTWA 5II2A 5EU1A 5LKXA 2K16A 1WUGA 4ZQLA 4J1PA 2LGGA 4ALHA 2LGKA 5EVAA 2YEMA 4A0CD 5L98A 4LADB 5G0FA 4GNDA 2ECTA 5F3AA 3UVDA 5E0RA 2RNYA 3AADA 4NRAA 4CUTA 1E6IA 5JG6A 5D7XA 5DFDA 5C4QA 5HCLA 5H9MA 2RI7A 4R7EA 4AYCA 2EA6A 2KYUA 4HXMA 3ZYQA 3AQAA 4CCGX 2FUIA 4N3WA 2F42A 4MR5A 5B75A 4RVRA 3KNVA 1RMDA 5CUCA 3DAIA 5EYAF 5D1MB 4KV4A 4QEWA 5BT5A 1ZS5A 5L8UA 3P1FA 4O78A 2QIZA 1N87A 2LDRA 4YYIA 4UYHA 1WEUA 4L7XA 3MULA 2KGIA 5F5ZA 4MEOA 2RO1A 5AMFA 4QYLA 4R2YA 3HCUA 3O34A 1JOCA 1WGMA 3I3JA 5HFQA 4CLBA 4XY8A 3C6WA 3T7LA 3VK6A 4HXSA 5CP5A 4HBXA 4WIVA 5ENFA 5LCWB 2YSJA 3EB6A 5L8TA 4N4FA 1XWHA 3SHBA 4O75A 5EWHA 3MQMA 3HCSA 5ENJA 2DKWA 5D26A 1WEVA 5C87A 1F68A 4O7FA 5A81A 1WEMA 2KGGA 5D3JA 5ENIA 2MD8C 2NAAA 3N9NA 4WZ2A 3MB4A 4I7BA 5A83A 2L43A 3LRQA 2VNFA 3SOUA 3ZTGA 5DKHA 3LQIA 4A9NA 5G04B 5TABA 3U5LA 5LVQA 3P1CA 5DY7A 1VFYA 2YSMA 5E9MA 4GB0A 4J0SA 5D3HA 2XEUA 4YC9A 2CT2A 3D7CA 5CUAA 3N9MA 2K17A 3QZTA 5HQ7A 3U5NA 3RTRB 5FH7A 5HQ6A 2YU4A 3L1XA 5FFYA 4ZDTA 4HXNA 5IGMA 2F6NA 3T6RA 4CUQA 5EQ1A 5DYAA 2XB1A 2L5EA 4A9MA 5FG6A 4UYEA 3PURA 2DATA 3DWYA 5CS8A 4QF2A 3EB5A 3N9OA 4MR6A 5H1UA 4MEQA 2KWJA 5A5QA 4O77A 5CPEA 2NXBA 5KH7A 5G4SA 5EISA 3O35A 4YH4A 5I83A 2CSZA 2VJFB 4XUBA 1MM2A 4FIPA 4TT6A 3SVHA 2YYNA 2WP1A 5FE3A 3TLPA 5EM3A 2K4DA 4HXRA 4Z1SA 4TS8A 4O70A 5H1VA 5EPSA 2Y43A 5E7DA 5E74A 1WE9A 5TCMA 5CUEA 2MUMA 3SOWA 5HJCA 2VPDA 5D1KB 4YY6A 2LQ6A 1DVPA 2MA6A 1FP0A 4J0RA 1V87A 4CL9A 1FBVA 3O33A 4QR5A 3ZYUA 5KHMA 4NN2A 4LK9A 3P1DA 1VD4A 3O37A 5D3PA 2ZETC 4V3LC 5L96A 5I29A 3DPLR 2KWOA 4IC3A 2ECGA 4QUTA 2MNZA 4FJCA 5CRZA 3IU5A 3ZNIA 4NRBA 5II1A 3M99A 5LJ1A 4TZ2A 2R0SA 2QICA 5DX4A 1ZBDB 3MHSA 4QZSA 5DKDA 4QC1A 3MUKA 4A4CA 1X4JA 4QR3A 5ENGA 5LUUA 1MM3A 5FE5A 3G0JA 2YYRA 1VYXA 4CFLA 5I80A 5I7XA 5COIA 4L58A 5HEMA 4P5OB 4HBWA 4HXLA 4LRGA 4O7AA 2KWKA 4LLBA 4X3GA 4NR4A 2L5UA 2Y1NA 5B78A 4UIUA 4NR8A 3SVGA 4O64A 5FB1A 5DW2A 3N9QA 4UITA 4X2IA 5F61A 3UVWA 4CUSA 2K1JA 5FEYA 2RNWA 2LSPB 5D25A 2Y1MA 1IYMA 5F63A 2DVSA 3NXBA 4QBMA 2MD7B 3JVMA 1Z2QA 5F1LA 2G43A 1X0JA 2L85A 3P1EA 5D3TA 5ENCA 5LJ2A 5B8DA 2YURA 2KIZA 2RS9B 5ACYA 5FE8A 3QZSA 4CURA 3DQVR 5E9KA 5EGUA 4UI9B 2CSYA 4IORA 2RFJA 3MB3A 5HENA 2YQDA 4O7CA 5EPRA 4BW4A 4A9HA 1WEQA 4AVXA 5D0CA 3PUQA 5LVRA 2IDAA 5FBXA 1HYJA 2ECNA 5D3SA 5E9VA 2KREA 2LXPC 2YEKA 4MR4A 5FH6A 5I86A 4Y03A 2MNYA 4OGIA 2YQLA 3MHHA 2D9EA 5AIUA 2L84A 5CZGA 5FB0A 4HXPA 4CA1A 4MVTA 3K2JA 4YBTA 4QSVA 4YYJA 5J0DA 5EK9A 3HMFA 5FG4A 5EI4A 2BAYA 5I7YA 2VPBA 1EQFA 4AP4A 3MXFA 4TT2A 2E3KA 3ZVYA 4J3IA 4AYCB 2DVRA 4NUDA 2H0DB 5KH3A 3U5OA 5A85A 3SVFA 5KTXA 4ZUXU 2L75A 4WZ0A 4QSRA 4A9IA 4LJNA 2MA5A 2ECJA 4QSWA 3C5KA 4MR3A 4IR5A 4TQNA 4NUCA 4NRCA 5IGLA 5FE7A 4HXOA 5A7CA 2G45A 4LYWA 2I50A 2VPEA 2YELA 5FE6A 5D3LA 4LZ2A 2YDWA 2MJVB 4LDFA 4XUAA 4UIZA 4A9OA 4CUUA 2PUYA 5TDRA 4NR7A 3U5KA 1X4IA 5E3GA 4NR6A 1G25A 5A5RA 5B77A 3ONIA 4S3OC 5A5PA 4TKPB 2ECVA 5FE0A 2LXHC 1WUMA 2R0YA 1CHCA 4O71A 5FH8A 4YY4A 4PS5A 5A5OA 2LN0A 4UIYA 2QJ0A 5DFCA 5LKTA 3N9LA 4GPJA 4NYWA 2FUUA 5EV9A 5EWDA 4DONA 1Z6UA 5BT4A 3QZVA 2WP2A 4Z6IA 2MT5A 4AKNA 4PCEA 5F62A 4MEPA 4O7EA 4GNFA 5AD3A 4UP5A 5DYUA 1WEEA 2M6MA 2RSDA 3HTKC 4BJXA 3O70A 2LGLA 4LZSA 4NUEA 3HMHA 5HLSA 5CFWA 4O74A 2E6SA 4UIWA 5IBNA 5FDZA 1WFKA 3ASLA 3GV4A 3RCWA 4BW2A 3JVJA 3IHPA 4PTBA 5L99A 4OGJA 4QSXA 4C67A 5G05B 3LXJA 4TTEA 5IIDA 4O76A 2RNXA 4N4GA 5CQ5A 2E7NA 1WENA 3HCTA 4ALGA 4LZRA 4TZ8A 3LQHA 5FG5A 1T1HA 2OSSA 4A9JA 3N9PA 5KU3A 5B76A 4FLPA 5A5SA 2DX8A 2ECIA 5C85A 4UYDA 4XI1A 4F3IA 1N72A 5F60A 4WA6A 5ENBA 3U5MA 2DVQA 3GG3A 5DYXA 4XYAA 4YK0A 3U5JA 4NQMA 4C66A 3KQIA 5FE2A 5E9LA 4QSSA 2G6QA 4YYDA 4QEUA 5CUGA 1BORA 4QYDA 5H1TA 3I2DA 5L97A 5TRBA 4TYLA 5CQAA 5EWCA 3UV5A 5EP7A 4NR5A 4O7BA 4UYFA 4QF3A 5D3RA 5FERA 2YQMA 5K29A 4LR6A 4OUFA 4BW1A 4R8PK 4IR3A 2M85A 2H0DA 4YABA 4WZ3B 2YT5A 5E73A 2DWWA 4GNEA 2I7KA 4QB3A 5BT3A 3JVLA 5F36A 3UVXA 5FFWA 3L1ZB 5HM0A
chains in the Genus database with same CATH superfamily
4A4BA 4QQ4A 1DCQA 5C11A 3S91A 1WEWA 2B0OE 4Z93A 1WEPA 4KV1A 1LDJB 3D1DA 5DW1A 5CQTA 1WILA 2LRIC 2OO1A 4FO9A 5CQ6A 5HRXA 2EGPA 4E96A 5CQ4A 2KU3A 3P5OA 4HBYA 4QSQA 5G4RA 3HMEA 4YADA 2F6JA 5HRVA 4LC2A 5IG6A 2XOYA 3GL6A 2MIQA 5AITA 3ZPV1 5H85A 4Q0OA 4F1PA 2I8NA 2KE1A 5ETDA 3IU6A 3UV4A 1JSPB 3SOXA 5LJ0A 2DVVA 1E4UA 3LQJA 2YUCA 4IR6A 1WIMA 4YATA 5I1QA 4IC2A 3LVQE 3KV6A 2LV9A 2G4AA 4NR9A 4QUUA 1JM4B 1JM7B 2JMJA 5AD2A 1X4UA 4N4HA 2E6RA 4Q0NA 5EWWA 5CY9A 2L0BA 3FL2A 4MSXA 4HXKA 2CKLB 5J3XA 5HRWA 2KTBB 5C8GA 3S92A 1WEOA 4O62A 3ZVZB 3RPGC 2AN6A 4QNSA 2OUOA 3UVYA 2JMIA 3O7AA 2JUNA 3O47A 5JWMA 4YBSA 4PPEA 4YH3A 2D8SA 4TT4A 4UP0A 3UV2A 5B79A 5F2PA 3Q2EA 5EWVA 2VP7A 2L80A 4NS5A 4LYSA 5ETBA 2ECWA 2VJFA 5DYCA 3JUEA 4ZC9A 4YYGA 5A82A 3FKMX 4WHUA 4B86C 4A9FA 2VPGA 5TB6A 5JI8A 5EPBA 5KTUA 2YW8A 1HYIA 3H7HA 5DLXA 4ZW1A 2PNXA 4HBVA 5FFVA 3Q2FA 4BW3A 2EODA 4PKLA 5CRMA 3FANA 4YBMA 3G0LA 5HFRA 2H60A 2YW5A 4BHWA 2C2LA 3O36A 3NG2A 5C89A 5DKCA 2R0VA 4UYGA 2M1RA 1K2FA 4IOOA 4NQNA 4UYFB 5F25A 4TU4A 5CQ8A 1WESA 4S3OB 2OXQC 5A5NA 1MBMA 2YHOA 3L11A 4C9ZA 4PY6A 4NYXA 5ENEA 5KH9A 5SVXA 2N9GA 5FE1A 4LYIA 2M3HA 4Z6HA 2KWNA 3T9KA 4F52B 5EICA 4WHWA 3LVRE 4Z0RA 2VJEA 3KV5A 2C2VS 4A9LA 5C13A 4PCIA 4Z0OA 4NYVA 5LKZA 2D82A 5I3LA 4YYKA 1Z60A 3LJUX 2YHNA 1LDKC 4W4UA 2KFTA 4MENA 2R10A 3MDBC 4IR4A 1F62A 4YYMA 4N4IA 5KO4A 4B7YC 4Q6FA 5E9YA 2JRJA 5AMEA 3JVKA 4NXJA 5SVIB 5HQ5A 5D24A 4QSPA 5F1HA 5CGPA 2RR4A 5HELA 5I89A 2IQJA 5DLZA 1U6GB 5DINA 4QSTA 2VJEB 2UZGA 4AUQB 5I88A 4Z1QA 3RPGB 4YYHA 3VKGA 3M62A 2YREA 5ENHA 4IOQA 5FE9A 4FK5A 5E9IA 4YAXA 4QC3A 5IGKA 4V3KC 5CQ3A 2EJNA 2CKLA 5DFBA 1JM7A 3UW9A 2GRCA 3LJWA 4QEVA 5TDWA 5TBNA 4UIVA 4A9EA 5E3DA 5DBMA 2FSAA 4LKAA 5D3NA 4XY9A 2HDPA 2HYED 5LKUA 2LGVA 4I7CA 5CTLA 5DKAA 4QSUA 4H9DA 3ZPVE 3V43A 5IGNA 4A49A 4CFKA 4YYNA 5CU8A 5CQ7A 4QY4A 5EA1A 4BBQA 5CUDA 5I40A 3PHDA 4O72A 4QR4A 3M63A 4KCXA 2E7OA 3U5PA 4CUPA 2JMDA 4TU6A 5FE4A 2M13A 4GNGA 5D1LB 2KR4A 4I7DA 5CUBA 5C7NA 4A9KA 4UIXA 5KTWA 5II2A 5EU1A 5LKXA 2K16A 1WUGA 4ZQLA 4J1PA 2LGGA 4ALHA 4AKIA 2LGKA 5EVAA 2YEMA 4A0CD 5L98A 4LADB 3KDEC 5G0FA 4GNDA 2ECTA 1ZKRA 5F3AA 3UVDA 5E0RA 2RNYA 3AADA 4NRAA 4CUTA 1E6IA 5JG6A 5D7XA 5DFDA 5C4QA 2FD4A 5HCLA 5H9MA 2RI7A 4R7EA 4AYCA 2EA6A 2KYUA 4HXMA 3ZYQA 3AQAA 4CCGX 2FUIA 4N3WA 2F42A 4MR5A 5B75A 4RVRA 3KNVA 1RMDA 1PUOA 5CUCA 3DAIA 5EYAF 5D1MB 4KV4A 4QEWA 5BT5A 1ZS5A 5L8UA 3P1FA 4O78A 2QIZA 1N87A 2LDRA 4YYIA 4UYHA 1WEUA 4L7XA 3MULA 2KGIA 5F5ZA 4MEOA 2RO1A 5AMFA 4QYLA 4R2YA 3HCUA 3O34A 1JOCA 1WGMA 3I3JA 5HFQA 4CLBA 4XY8A 3C6WA 3T7LA 3VK6A 4HXSA 5CP5A 4HBXA 4WIVA 5ENFA 5LCWB 2EGMA 2YSJA 3EB6A 5L8TA 4N4FA 1XWHA 3SHBA 4O75A 5EWHA 3MQMA 2KKXA 3HCSA 5ENJA 2DKWA 5D26A 1WEVA 3PLWA 5C87A 1F68A 4O7FA 5A81A 1WEMA 2KGGA 5D3JA 5ENIA 2MD8C 2NAAA 3N9NA 4WZ2A 2CRWA 2L7PA 3M7KA 4AI6A 3MB4A 4I7BA 5A83A 2L43A 3LRQA 2VNFA 3SOUA 3ZTGA 5DKHA 3ERRA 3LQIA 4A9NA 2DSMA 5G04B 3U5LA 5TABA 5LVQA 3P1CA 5DY7A 3VKHA 1VFYA 2YSMA 5E9MA 4GB0A 4J0SA 5D3HA 2XEUA 4YC9A 2CT2A 3D7CA 5CUAA 2DJAA 3D1BA 3N9MA 2OWAA 2K17A 3QZTA 5HQ7A 3U5NA 3RTRB 5FH7A 5HQ6A 2YU4A 3L1XA 5FFYA 4ZDTA 4HXNA 5IGMA 2F6NA 3T6RA 4CUQA 3E2DA 5EQ1A 5DYAA 2XB1A 3DWDA 2L5EA 4A9MA 5FG6A 4UYEA 3PURA 2EXUA 2DATA 3DWYA 5CS8A 4QF2A 2XOZA 3EB5A 3N9OA 4MR6A 5H1UA 4MEQA 2KWJA 5A5QA 4O77A 5CPEA 2NXBA 5KH7A 5G4SA 5EISA 3O35A 4YH4A 5I83A 2CSZA 2VJFB 4XUBA 1MM2A 4FIPA 4TT6A 3SVHA 2YYNA 2WP1A 5FE3A 3TLPA 2D8UA 5EM3A 2K4DA 4HXRA 4Z1SA 4TS8A 4O70A 5H1VA 5EPSA 2Y43A 5E7DA 5E74A 1WE9A 5TCMA 4AKGA 5CUEA 2MUMA 3SOWA 5HJCA 2VPDA 5D1KB 4YY6A 2LQ6A 1DVPA 2MA6A 1FP0A 4J0RA 1V87A 4CL9A 2XP0A 1FBVA 3O33A 4QR5A 3ZYUA 5KHMA 4NN2A 4LK9A 3P1DA 1VD4A 3O37A 5D3PA 2ZETC 4V3LC 5L96A 5I29A 3DPLR 2P57A 2KWOA 4IC3A 2ECGA 4QUTA 2MNZA 4FJCA 5CRZA 3IU5A 3ZNIA 4NRBA 5II1A 3M99A 3FAOA 5LJ1A 4TZ2A 2R0SA 2QICA 5DX4A 1ZBDB 3MHSA 3FJUB 4QZSA 5DKDA 4QC1A 3MUKA 4A4CA 1X4JA 4QR3A 5ENGA 5LUUA 1MM3A 5FE5A 3G0JA 2YYRA 1VYXA 4CFLA 5I80A 5I7XA 2E61A 5COIA 4L58A 5HEMA 4P5OB 4HBWA 4HXLA 4LRGA 4O7AA 2KWKA 4LLBA 4X3GA 4NR4A 2L5UA 2Y1NA 5B78A 3Q1DA 4UIUA 4NR8A 3SVGA 4O64A 5FB1A 5DW2A 3N9QA 4UITA 4X2IA 5F61A 3UVWA 4CUSA 4AKHA 2K1JA 2RNWA 2LSPB 5D25A 2Y1MA 5FEYA 1IYMA 5F63A 2DVSA 3NXBA 4QBMA 2MD7B 3JVMA 1Z2QA 5F1LA 2G43A 1X0JA 2CSVA 2L85A 3P1EA 5D3TA 5ENCA 5LJ2A 5B8DA 2YURA 2KIZA 3FM8C 2RS9B 5ACYA 5FE8A 3QZSA 4CURA 3DQVR 5E9KA 5EGUA 4UI9B 2CSYA 4IORA 2RFJA 3MB3A 5HENA 2YQDA 4O7CA 5EPRA 4BW4A 4A9HA 1WEQA 4AVXA 5D0CA 3PUQA 5LVRA 2IDAA 5FBXA 1HYJA 2ECNA 5D3SA 5E9VA 2KREA 2LXPC 2YEKA 4MR4A 5FH6A 5I86A 4Y03A 2MNYA 4OGIA 2YQLA 3MHHA 2D9EA 5AIUA 2L84A 5CZGA 5FB0A 4HXPA 4CA1A 4MVTA 3K2JA 4YBTA 4QSVA 4YYJA 5J0DA 5EK9A 3HMFA 5FG4A 5EI4A 2BAYA 5I7YA 2VPBA 1EQFA 4AP4A 3MXFA 4TT2A 2E3KA 3ZVYA 4J3IA 4AYCB 2DVRA 4NUDA 2H0DB 5KH3A 3U5OA 5A85A 2XOCA 3SVFA 5KTXA 2MKEA 2L75A 4ZUXU 4WZ0A 4QSRA 4A9IA 4LJNA 5SVYA 2MA5A 2ECJA 4QSWA 3C5KA 4MR3A 4IR5A 4TQNA 4NUCA 4NRCA 5IGLA 5FE7A 2YVRA 4HXOA 5A7CA 2G45A 4LYWA 2I50A 2VPEA 2YELA 5FE6A 5SVIA 5D3LA 4LZ2A 2YDWA 2MJVB 4LDFA 4XUAA 4UIZA 4A9OA 4CUUA 2PUYA 5TDRA 4NR7A 3U5KA 1X4IA 5E3GA 4NR6A 1G25A 5A5RA 2CONA 2JM3A 5K3QA 5B77A 3ONIA 4S3OC 5A5PA 2CRRA 2ECVA 2KKYA 4TKPB 5FE0A 2LXHC 1WUMA 2R0YA 1CHCA 4O71A 5FH8A 4YY4A 4PS5A 5A5OA 2LN0A 4UIYA 2QJ0A 5DFCA 5LKTA 3N9LA 4GPJA 4NYWA 2FUUA 5EV9A 5EWDA 4DONA 1Z6UA 5BT4A 3QZVA 2WP2A 4Z6IA 2MT5A 4AKNA 4PCEA 5F62A 4MEPA 4O7EA 4GNFA 5AD3A 4UP5A 5DYUA 1WEEA 2M6MA 2RSDA 3HTKC 4BJXA 3O70A 2LGLA 4LZSA 4NUEA 3SUBA 3HMHA 5HLSA 4OGEA 5CFWA 4O74A 2E6SA 3DDTA 4UIWA 5IBNA 5FDZA 1WFKA 3ASLA 3GV4A 3RCWA 4BW2A 3JVJA 3IHPA 4PTBA 5L99A 4OGJA 4QSXA 4C67A 5G05B 3LXJA 4TTEA 5IIDA 4O76A 2RNXA 4N4GA 5CQ5A 2E7NA 1WENA 3HCTA 4ALGA 4LZRA 4TZ8A 3LQHA 5FG5A 1T1HA 2OSSA 4A9JA 3N9PA 5KU3A 5B76A 4FLPA 5A5SA 2DX8A 2ECIA 5C85A 4UYDA 4OGCA 4XI1A 4F3IA 1N72A 5F60A 4WA6A 5ENBA 3U5MA 2FFWA 2DVQA 3GG3A 5DYXA 4XYAA 4YK0A 3U5JA 4NQMA 4C66A 3KQIA 5FE2A 5E9LA 4QSSA 2G6QA 4YYDA 2LAUA 4QEUA 5CUGA 1BORA 4QYDA 5H1TA 3I2DA 5L97A 5TRBA 4TYLA 5CQAA 5EWCA 3UV5A 5EP7A 4NR5A 4O7BA 4UYFA 4QF3A 5D3RA 5FERA 2YQMA 5K29A 4LR6A 4OUFA 4BW1A 4R8PK 4IR3A 2M85A 2H0DA 4YABA 4WZ3B 2YT5A 3FEHA 5E73A 3LDYA 2DWWA 4GNEA 2I7KA 4QB3A 5BT3A 3JVLA 5F36A 3UVXA 5FFWA 3L1ZB 5HM0A
chains in the Genus database with same CATH topology
4A4BA 5C11A 3S91A 1WEWA 4Z93A 1WEPA 4KV1A 1LDJB 5DW1A 5CQTA 1WILA 2LRIC 2OO1A 4FO9A 5CQ6A 5HRXA 2EGPA 4E96A 5CQ4A 2KU3A 3P5OA 4HBYA 4QSQA 5G4RA 3HMEA 4YADA 2F6JA 5HRVA 4LC2A 5IG6A 5AITA 3GL6A 2MIQA 3ZPV1 5H85A 4Q0OA 2I8NA 2KE1A 5ETDA 3IU6A 3UV4A 1JSPB 3SOXA 5LJ0A 2DVVA 1E4UA 3LQJA 2YUCA 4IR6A 1WIMA 4YATA 5I1QA 4IC2A 3KV6A 2LV9A 2G4AA 4NR9A 4QUUA 1JM4B 1JM7B 2JMJA 5AD2A 1X4UA 4N4HA 2E6RA 4Q0NA 5EWWA 5CY9A 2L0BA 3FL2A 4MSXA 4HXKA 2CKLB 5J3XA 5HRWA 2KTBB 5C8GA 3S92A 1WEOA 3ZVZB 3RPGC 2AN6A 4QNSA 2OUOA 3UVYA 2JMIA 3O7AA 5JWMA 4YBSA 4PPEA 4YH3A 2D8SA 4TT4A 4UP0A 3UV2A 5B79A 5F2PA 3Q2EA 5EWVA 2VP7A 2L80A 4NS5A 4LYSA 5ETBA 2ECWA 2VJFA 5DYCA 4ZC9A 4YYGA 5A82A 3FKMX 4WHUA 4B86C 4A9FA 2VPGA 5TB6A 5JI8A 5EPBA 5KTUA 2YW8A 1HYIA 5DLXA 4ZW1A 2PNXA 4HBVA 5FFVA 3Q2FA 4BW3A 2EODA 4PKLA 5CRMA 4YBMA 3G0LA 5HFRA 2H60A 2YW5A 4BHWA 2C2LA 3O36A 3NG2A 5C89A 5DKCA 2R0VA 4UYGA 2M1RA 1K2FA 4IOOA 4NQNA 4UYFB 5F25A 4TU4A 5CQ8A 1WESA 4S3OB 2OXQC 5A5NA 3L11A 2YHOA 4C9ZA 4PY6A 4NYXA 5ENEA 5KH9A 2N9GA 5FE1A 4LYIA 2M3HA 4Z6HA 2KWNA 4F52B 5EICA 4WHWA 2VJEA 3KV5A 2C2VS 4A9LA 5C13A 4PCIA 4NYVA 5LKZA 2D82A 5I3LA 4YYKA 1Z60A 2YHNA 1LDKC 4W4UA 2KFTA 4MENA 2R10A 4IR4A 1F62A 4YYMA 4N4IA 5KO4A 4B7YC 4Q6FA 5E9YA 2JRJA 5AMEA 3JVKA 4NXJA 5HQ5A 5D24A 4QSPA 5F1HA 5CGPA 5DINA 5HELA 5I89A 4AUQB 5DLZA 1U6GB 4QSTA 2VJEB 2UZGA 5I88A 4Z1QA 3RPGB 4YYHA 3M62A 2YREA 5ENHA 4IOQA 5FE9A 4FK5A 5E9IA 4YAXA 4QC3A 5IGKA 4V3KC 5CQ3A 2CKLA 5DFBA 1JM7A 3UW9A 2GRCA 3LJWA 4QEVA 5TDWA 5TBNA 4UIVA 4A9EA 5E3DA 5DBMA 2FSAA 4LKAA 5D3NA 4XY9A 2HDPA 2HYED 5LKUA 2LGVA 4I7CA 5CTLA 5DKAA 4QSUA 3ZPVE 3V43A 5IGNA 4A49A 4CFKA 4YYNA 5CU8A 5CQ7A 4QY4A 5EA1A 4BBQA 5CUDA 5I40A 3PHDA 4O72A 4QR4A 3M63A 4KCXA 2E7OA 3U5PA 4CUPA 2JMDA 4TU6A 5FE4A 4GNGA 5D1LB 2KR4A 4I7DA 5CUBA 5C7NA 4A9KA 4UIXA 5KTWA 5II2A 5EU1A 5LKXA 2K16A 1WUGA 4ZQLA 4J1PA 2LGGA 4ALHA 2LGKA 5EVAA 2YEMA 4A0CD 5L98A 4LADB 5G0FA 4GNDA 2ECTA 5F3AA 3UVDA 5E0RA 2RNYA 3AADA 4NRAA 4CUTA 1E6IA 5JG6A 5D7XA 5DFDA 5C4QA 5HCLA 5H9MA 2RI7A 4R7EA 4AYCA 2EA6A 2KYUA 4HXMA 3ZYQA 3AQAA 4CCGX 2FUIA 4N3WA 2F42A 4MR5A 5B75A 4RVRA 3KNVA 1RMDA 5CUCA 3DAIA 5EYAF 5D1MB 4KV4A 4QEWA 5BT5A 1ZS5A 5L8UA 3P1FA 4O78A 2QIZA 1N87A 2LDRA 4YYIA 4UYHA 1WEUA 4L7XA 3MULA 2KGIA 5F5ZA 4MEOA 2RO1A 5AMFA 4QYLA 4R2YA 3HCUA 3O34A 1JOCA 1WGMA 3I3JA 5HFQA 4CLBA 4XY8A 3C6WA 3T7LA 3VK6A 4HXSA 5CP5A 4HBXA 4WIVA 5ENFA 5LCWB 2YSJA 3EB6A 5L8TA 4N4FA 1XWHA 3SHBA 4O75A 5EWHA 3MQMA 3HCSA 5ENJA 2DKWA 5D26A 1WEVA 5C87A 1F68A 4O7FA 5A81A 1WEMA 2KGGA 5D3JA 5ENIA 2MD8C 2NAAA 3N9NA 4WZ2A 3MB4A 4I7BA 5A83A 2L43A 3LRQA 2VNFA 3SOUA 3ZTGA 5DKHA 3LQIA 4A9NA 5G04B 5TABA 3U5LA 5LVQA 3P1CA 5DY7A 1VFYA 2YSMA 5E9MA 4GB0A 4J0SA 5D3HA 2XEUA 4YC9A 2CT2A 3D7CA 5CUAA 3N9MA 2K17A 3QZTA 5HQ7A 3U5NA 3RTRB 5FH7A 5HQ6A 2YU4A 3L1XA 5FFYA 4ZDTA 4HXNA 5IGMA 2F6NA 3T6RA 4CUQA 5EQ1A 5DYAA 2XB1A 2L5EA 4A9MA 5FG6A 4UYEA 3PURA 2DATA 3DWYA 5CS8A 4QF2A 3EB5A 3N9OA 4MR6A 5H1UA 4MEQA 2KWJA 5A5QA 4O77A 5CPEA 2NXBA 5KH7A 5G4SA 5EISA 3O35A 4YH4A 5I83A 2CSZA 2VJFB 4XUBA 1MM2A 4FIPA 4TT6A 3SVHA 2YYNA 2WP1A 5FE3A 3TLPA 5EM3A 2K4DA 4HXRA 4Z1SA 4TS8A 4O70A 5H1VA 5EPSA 2Y43A 5E7DA 5E74A 1WE9A 5TCMA 5CUEA 2MUMA 3SOWA 5HJCA 2VPDA 5D1KB 4YY6A 2LQ6A 1DVPA 2MA6A 1FP0A 4J0RA 1V87A 4CL9A 1FBVA 3O33A 4QR5A 3ZYUA 5KHMA 4NN2A 4LK9A 3P1DA 1VD4A 3O37A 5D3PA 2ZETC 4V3LC 5L96A 5I29A 3DPLR 2KWOA 4IC3A 2ECGA 4QUTA 2MNZA 4FJCA 5CRZA 3IU5A 3ZNIA 4NRBA 5II1A 3M99A 5LJ1A 4TZ2A 2R0SA 2QICA 5DX4A 1ZBDB 3MHSA 4QZSA 5DKDA 4QC1A 3MUKA 4A4CA 1X4JA 4QR3A 5ENGA 5LUUA 1MM3A 5FE5A 3G0JA 2YYRA 1VYXA 4CFLA 5I80A 5I7XA 5COIA 4L58A 5HEMA 4P5OB 4HBWA 4HXLA 4LRGA 4O7AA 2KWKA 4LLBA 4X3GA 4NR4A 2L5UA 2Y1NA 5B78A 4UIUA 4NR8A 3SVGA 4O64A 5FB1A 5DW2A 3N9QA 4UITA 4X2IA 5F61A 3UVWA 4CUSA 2K1JA 5FEYA 2RNWA 2LSPB 5D25A 2Y1MA 1IYMA 5F63A 2DVSA 3NXBA 4QBMA 2MD7B 3JVMA 1Z2QA 5F1LA 2G43A 1X0JA 2L85A 3P1EA 5D3TA 5ENCA 5LJ2A 5B8DA 2YURA 2KIZA 2RS9B 5ACYA 5FE8A 3QZSA 4CURA 3DQVR 5E9KA 5EGUA 4UI9B 2CSYA 4IORA 2RFJA 3MB3A 5HENA 2YQDA 4O7CA 5EPRA 4BW4A 4A9HA 1WEQA 4AVXA 5D0CA 3PUQA 5LVRA 2IDAA 5FBXA 1HYJA 2ECNA 5D3SA 5E9VA 2KREA 2LXPC 2YEKA 4MR4A 5FH6A 5I86A 4Y03A 2MNYA 4OGIA 2YQLA 3MHHA 2D9EA 5AIUA 2L84A 5CZGA 5FB0A 4HXPA 4CA1A 4MVTA 3K2JA 4YBTA 4QSVA 4YYJA 5J0DA 5EK9A 3HMFA 5FG4A 5EI4A 2BAYA 5I7YA 2VPBA 1EQFA 4AP4A 3MXFA 4TT2A 2E3KA 3ZVYA 4J3IA 4AYCB 2DVRA 4NUDA 2H0DB 5KH3A 3U5OA 5A85A 3SVFA 5KTXA 4ZUXU 2L75A 4WZ0A 4QSRA 4A9IA 4LJNA 2MA5A 2ECJA 4QSWA 3C5KA 4MR3A 4IR5A 4TQNA 4NUCA 4NRCA 5IGLA 5FE7A 4HXOA 5A7CA 2G45A 4LYWA 2I50A 2VPEA 2YELA 5FE6A 5D3LA 4LZ2A 2YDWA 2MJVB 4LDFA 4XUAA 4UIZA 4A9OA 4CUUA 2PUYA 5TDRA 4NR7A 3U5KA 1X4IA 5E3GA 4NR6A 1G25A 5A5RA 5B77A 3ONIA 4S3OC 5A5PA 4TKPB 2ECVA 5FE0A 2LXHC 1WUMA 2R0YA 1CHCA 4O71A 5FH8A 4YY4A 4PS5A 5A5OA 2LN0A 4UIYA 2QJ0A 5DFCA 5LKTA 3N9LA 4GPJA 4NYWA 2FUUA 5EV9A 5EWDA 4DONA 1Z6UA 5BT4A 3QZVA 2WP2A 4Z6IA 2MT5A 4AKNA 4PCEA 5F62A 4MEPA 4O7EA 4GNFA 5AD3A 4UP5A 5DYUA 1WEEA 2M6MA 2RSDA 3HTKC 4BJXA 3O70A 2LGLA 4LZSA 4NUEA 3HMHA 5HLSA 5CFWA 4O74A 2E6SA 4UIWA 5IBNA 5FDZA 1WFKA 3ASLA 3GV4A 3RCWA 4BW2A 3JVJA 3IHPA 4PTBA 5L99A 4OGJA 4QSXA 4C67A 5G05B 3LXJA 4TTEA 5IIDA 4O76A 2RNXA 4N4GA 5CQ5A 2E7NA 1WENA 3HCTA 4ALGA 4LZRA 4TZ8A 3LQHA 5FG5A 1T1HA 2OSSA 4A9JA 3N9PA 5KU3A 5B76A 4FLPA 5A5SA 2DX8A 2ECIA 5C85A 4UYDA 4XI1A 4F3IA 1N72A 5F60A 4WA6A 5ENBA 3U5MA 2DVQA 3GG3A 5DYXA 4XYAA 4YK0A 3U5JA 4NQMA 4C66A 3KQIA 5FE2A 5E9LA 4QSSA 2G6QA 4YYDA 4QEUA 5CUGA 1BORA 4QYDA 5H1TA 3I2DA 5L97A 5TRBA 4TYLA 5CQAA 5EWCA 3UV5A 5EP7A 4NR5A 4O7BA 4UYFA 4QF3A 5D3RA 5FERA 2YQMA 5K29A 4LR6A 4OUFA 4BW1A 4R8PK 4IR3A 2M85A 2H0DA 4YABA 4WZ3B 2YT5A 5E73A 2DWWA 4GNEA 2I7KA 4QB3A 5BT3A 3JVLA 5F36A 3UVXA 5FFWA 3L1ZB 5HM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4B A;  5C11 A;  3S91 A;  1WEW A;  4Z93 A;  1WEP A;  4KV1 A;  1LDJ B;  5DW1 A;  5CQT A;  1WIL A;  2LRI C;  2OO1 A;  4FO9 A;  5CQ6 A;  5HRX A;  2EGP A;  4E96 A;  5CQ4 A;  2KU3 A;  3P5O A;  4HBY A;  4QSQ A;  5G4R A;  3HME A;  4YAD A;  2F6J A;  5HRV A;  4LC2 A;  5IG6 A;  5AIT A;  3GL6 A;  2MIQ A;  3ZPV 1;  5H85 A;  4Q0O A;  2I8N A;  2KE1 A;  5ETD A;  3IU6 A;  3UV4 A;  1JSP B;  3SOX A;  5LJ0 A;  2DVV A;  1E4U A;  3LQJ A;  2YUC A;  4IR6 A;  1WIM A;  4YAT A;  5I1Q A;  4IC2 A;  3KV6 A;  2LV9 A;  2G4A A;  4NR9 A;  4QUU A;  1JM4 B;  1JM7 B;  2JMJ A;  5AD2 A;  1X4U A;  4N4H A;  2E6R A;  4Q0N A;  5EWW A;  5CY9 A;  2L0B A;  3FL2 A;  4MSX A;  4HXK A;  2CKL B;  5J3X A;  5HRW A;  2KTB B;  5C8G A;  3S92 A;  1WEO A;  3ZVZ B;  3RPG C;  2AN6 A;  4QNS A;  2OUO A;  3UVY A;  2JMI A;  3O7A A;  5JWM A;  4YBS A;  4PPE A;  4YH3 A;  2D8S A;  4TT4 A;  4UP0 A;  3UV2 A;  5B79 A;  5F2P A;  3Q2E A;  5EWV A;  2VP7 A;  2L80 A;  4NS5 A;  4LYS A;  5ETB A;  2ECW A;  2VJF A;  5DYC A;  4ZC9 A;  4YYG A;  5A82 A;  3FKM X;  4WHU A;  4B86 C;  4A9F A;  2VPG A;  5TB6 A;  5JI8 A;  5EPB A;  5KTU A;  2YW8 A;  1HYI A;  5DLX A;  4ZW1 A;  2PNX A;  4HBV A;  5FFV A;  3Q2F A;  4BW3 A;  2EOD A;  4PKL A;  5CRM A;  4YBM A;  3G0L A;  5HFR A;  2H60 A;  2YW5 A;  4BHW A;  2C2L A;  3O36 A;  3NG2 A;  5C89 A;  5DKC A;  2R0V A;  4UYG A;  2M1R A;  1K2F A;  4IOO A;  4NQN A;  4UYF B;  5F25 A;  4TU4 A;  5CQ8 A;  1WES A;  4S3O B;  2OXQ C;  5A5N A;  3L11 A;  2YHO A;  4C9Z A;  4PY6 A;  4NYX A;  5ENE A;  5KH9 A;  2N9G A;  5FE1 A;  4LYI A;  2M3H A;  4Z6H A;  2KWN A;  4F52 B;  5EIC A;  4WHW A;  2VJE A;  3KV5 A;  2C2V S;  4A9L A;  5C13 A;  4PCI A;  4NYV A;  5LKZ A;  2D82 A;  5I3L A;  4YYK A;  1Z60 A;  2YHN A;  1LDK C;  4W4U A;  2KFT A;  4MEN A;  2R10 A;  4IR4 A;  1F62 A;  4YYM A;  4N4I A;  5KO4 A;  4B7Y C;  4Q6F A;  5E9Y A;  2JRJ A;  5AME A;  3JVK A;  4NXJ A;  5HQ5 A;  5D24 A;  4QSP A;  5F1H A;  5CGP A;  5DIN A;  5HEL A;  5I89 A;  4AUQ B;  5DLZ A;  1U6G B;  4QST A;  2VJE B;  2UZG A;  5I88 A;  4Z1Q A;  3RPG B;  4YYH A;  3M62 A;  2YRE A;  5ENH A;  4IOQ A;  5FE9 A;  4FK5 A;  5E9I A;  4YAX A;  4QC3 A;  5IGK A;  4V3K C;  5CQ3 A;  2CKL A;  5DFB A;  1JM7 A;  3UW9 A;  2GRC A;  3LJW A;  4QEV A;  5TDW A;  5TBN A;  4UIV A;  4A9E A;  5E3D A;  5DBM A;  2FSA A;  4LKA A;  5D3N A;  4XY9 A;  2HDP A;  2HYE D;  5LKU A;  2LGV A;  4I7C A;  5CTL A;  5DKA A;  4QSU A;  3ZPV E;  3V43 A;  5IGN A;  4A49 A;  4CFK A;  4YYN A;  5CU8 A;  5CQ7 A;  4QY4 A;  5EA1 A;  4BBQ A;  5CUD A;  5I40 A;  3PHD A;  4O72 A;  4QR4 A;  3M63 A;  4KCX A;  2E7O A;  3U5P A;  4CUP A;  2JMD A;  4TU6 A;  5FE4 A;  4GNG A;  5D1L B;  2KR4 A;  4I7D A;  5CUB A;  5C7N A;  4A9K A;  4UIX A;  5KTW A;  5II2 A;  5EU1 A;  5LKX A;  2K16 A;  1WUG A;  4ZQL A;  4J1P A;  2LGG A;  4ALH A;  2LGK A;  5EVA A;  2YEM A;  4A0C D;  5L98 A;  4LAD B;  5G0F A;  4GND A;  2ECT A;  5F3A A;  3UVD A;  5E0R A;  2RNY A;  3AAD A;  4NRA A;  4CUT A;  1E6I A;  5JG6 A;  5D7X A;  5DFD A;  5C4Q A;  5HCL A;  5H9M A;  2RI7 A;  4R7E A;  4AYC A;  2EA6 A;  2KYU A;  4HXM A;  3ZYQ A;  3AQA A;  4CCG X;  2FUI A;  4N3W A;  2F42 A;  4MR5 A;  5B75 A;  4RVR A;  3KNV A;  1RMD A;  5CUC A;  3DAI A;  5EYA F;  5D1M B;  4KV4 A;  4QEW A;  5BT5 A;  1ZS5 A;  5L8U A;  3P1F A;  4O78 A;  2QIZ A;  1N87 A;  2LDR A;  4YYI A;  4UYH A;  1WEU A;  4L7X A;  3MUL A;  2KGI A;  5F5Z A;  4MEO A;  2RO1 A;  5AMF A;  4QYL A;  4R2Y A;  3HCU A;  3O34 A;  1JOC A;  1WGM A;  3I3J A;  5HFQ A;  4CLB A;  4XY8 A;  3C6W A;  3T7L A;  3VK6 A;  4HXS A;  5CP5 A;  4HBX A;  4WIV A;  5ENF A;  5LCW B;  2YSJ A;  3EB6 A;  5L8T A;  4N4F A;  1XWH A;  3SHB A;  4O75 A;  5EWH A;  3MQM A;  3HCS A;  5ENJ A;  2DKW A;  5D26 A;  1WEV A;  5C87 A;  1F68 A;  4O7F A;  5A81 A;  1WEM A;  2KGG A;  5D3J A;  5ENI A;  2MD8 C;  2NAA A;  3N9N A;  4WZ2 A;  3MB4 A;  4I7B A;  5A83 A;  2L43 A;  3LRQ A;  2VNF A;  3SOU A;  3ZTG A;  5DKH A;  3LQI A;  4A9N A;  5G04 B;  5TAB A;  3U5L A;  5LVQ A;  3P1C A;  5DY7 A;  1VFY A;  2YSM A;  5E9M A;  4GB0 A;  4J0S A;  5D3H A;  2XEU A;  4YC9 A;  2CT2 A;  3D7C A;  5CUA A;  3N9M A;  2K17 A;  3QZT A;  5HQ7 A;  3U5N A;  3RTR B;  5FH7 A;  5HQ6 A;  2YU4 A;  3L1X A;  5FFY A;  4ZDT A;  4HXN A;  5IGM A;  2F6N A;  3T6R A;  4CUQ A;  5EQ1 A;  5DYA A;  2XB1 A;  2L5E A;  4A9M A;  5FG6 A;  4UYE A;  3PUR A;  2DAT A;  3DWY A;  5CS8 A;  4QF2 A;  3EB5 A;  3N9O A;  4MR6 A;  5H1U A;  4MEQ A;  2KWJ A;  5A5Q A;  4O77 A;  5CPE A;  2NXB A;  5KH7 A;  5G4S A;  5EIS A;  3O35 A;  4YH4 A;  5I83 A;  2CSZ A;  2VJF B;  4XUB A;  1MM2 A;  4FIP A;  4TT6 A;  3SVH A;  2YYN A;  2WP1 A;  5FE3 A;  3TLP A;  5EM3 A;  2K4D A;  4HXR A;  4Z1S A;  4TS8 A;  4O70 A;  5H1V A;  5EPS A;  2Y43 A;  5E7D A;  5E74 A;  1WE9 A;  5TCM A;  5CUE A;  2MUM A;  3SOW A;  5HJC A;  2VPD A;  5D1K B;  4YY6 A;  2LQ6 A;  1DVP A;  2MA6 A;  1FP0 A;  4J0R A;  1V87 A;  4CL9 A;  1FBV A;  3O33 A;  4QR5 A;  3ZYU A;  5KHM A;  4NN2 A;  4LK9 A;  3P1D A;  1VD4 A;  3O37 A;  5D3P A;  2ZET C;  4V3L C;  5L96 A;  5I29 A;  3DPL R;  2KWO A;  4IC3 A;  2ECG A;  4QUT A;  2MNZ A;  4FJC A;  5CRZ A;  3IU5 A;  3ZNI A;  4NRB A;  5II1 A;  3M99 A;  5LJ1 A;  4TZ2 A;  2R0S A;  2QIC A;  5DX4 A;  1ZBD B;  3MHS A;  4QZS A;  5DKD A;  4QC1 A;  3MUK A;  4A4C A;  1X4J A;  4QR3 A;  5ENG A;  5LUU A;  1MM3 A;  5FE5 A;  3G0J A;  2YYR A;  1VYX A;  4CFL A;  5I80 A;  5I7X A;  5COI A;  4L58 A;  5HEM A;  4P5O B;  4HBW A;  4HXL A;  4LRG A;  4O7A A;  2KWK A;  4LLB A;  4X3G A;  4NR4 A;  2L5U A;  2Y1N A;  5B78 A;  4UIU A;  4NR8 A;  3SVG A;  4O64 A;  5FB1 A;  5DW2 A;  3N9Q A;  4UIT A;  4X2I A;  5F61 A;  3UVW A;  4CUS A;  2K1J A;  5FEY A;  2RNW A;  2LSP B;  5D25 A;  2Y1M A;  1IYM A;  5F63 A;  2DVS A;  3NXB A;  4QBM A;  2MD7 B;  3JVM A;  1Z2Q A;  5F1L A;  2G43 A;  1X0J A;  2L85 A;  3P1E A;  5D3T A;  5ENC A;  5LJ2 A;  5B8D A;  2YUR A;  2KIZ A;  2RS9 B;  5ACY A;  5FE8 A;  3QZS A;  4CUR A;  3DQV R;  5E9K A;  5EGU A;  4UI9 B;  2CSY A;  4IOR A;  2RFJ A;  3MB3 A;  5HEN A;  2YQD A;  4O7C A;  5EPR A;  4BW4 A;  4A9H A;  1WEQ A;  4AVX A;  5D0C A;  3PUQ A;  5LVR A;  2IDA A;  5FBX A;  1HYJ A;  2ECN A;  5D3S A;  5E9V A;  2KRE A;  2LXP C;  2YEK A;  4MR4 A;  5FH6 A;  5I86 A;  4Y03 A;  2MNY A;  4OGI A;  2YQL A;  3MHH A;  2D9E A;  5AIU A;  2L84 A;  5CZG A;  5FB0 A;  4HXP A;  4CA1 A;  4MVT A;  3K2J A;  4YBT A;  4QSV A;  4YYJ A;  5J0D A;  5EK9 A;  3HMF A;  5FG4 A;  5EI4 A;  2BAY A;  5I7Y A;  2VPB A;  1EQF A;  4AP4 A;  3MXF A;  4TT2 A;  2E3K A;  3ZVY A;  4J3I A;  4AYC B;  2DVR A;  4NUD A;  2H0D B;  5KH3 A;  3U5O A;  5A85 A;  3SVF A;  5KTX A;  4ZUX U;  2L75 A;  4WZ0 A;  4QSR A;  4A9I A;  4LJN A;  2MA5 A;  2ECJ A;  4QSW A;  3C5K A;  4MR3 A;  4IR5 A;  4TQN A;  4NUC A;  4NRC A;  5IGL A;  5FE7 A;  4HXO A;  5A7C A;  2G45 A;  4LYW A;  2I50 A;  2VPE A;  2YEL A;  5FE6 A;  5D3L A;  4LZ2 A;  2YDW A;  2MJV B;  4LDF A;  4XUA A;  4UIZ A;  4A9O A;  4CUU A;  2PUY A;  5TDR A;  4NR7 A;  3U5K A;  1X4I A;  5E3G A;  4NR6 A;  1G25 A;  5A5R A;  5B77 A;  3ONI A;  4S3O C;  5A5P A;  4TKP B;  2ECV A;  5FE0 A;  2LXH C;  1WUM A;  2R0Y A;  1CHC A;  4O71 A;  5FH8 A;  4YY4 A;  4PS5 A;  5A5O A;  2LN0 A;  4UIY A;  2QJ0 A;  5DFC A;  5LKT A;  3N9L A;  4GPJ A;  4NYW A;  2FUU A;  5EV9 A;  5EWD A;  4DON A;  1Z6U A;  5BT4 A;  3QZV A;  2WP2 A;  4Z6I A;  2MT5 A;  4AKN A;  4PCE A;  5F62 A;  4MEP A;  4O7E A;  4GNF A;  5AD3 A;  4UP5 A;  5DYU A;  1WEE A;  2M6M A;  2RSD A;  3HTK C;  4BJX A;  3O70 A;  2LGL A;  4LZS A;  4NUE A;  3HMH A;  5HLS A;  5CFW A;  4O74 A;  2E6S A;  4UIW A;  5IBN A;  5FDZ A;  1WFK A;  3ASL A;  3GV4 A;  3RCW A;  4BW2 A;  3JVJ A;  3IHP A;  4PTB A;  5L99 A;  4OGJ A;  4QSX A;  4C67 A;  5G05 B;  3LXJ A;  4TTE A;  5IID A;  4O76 A;  2RNX A;  4N4G A;  5CQ5 A;  2E7N A;  1WEN A;  3HCT A;  4ALG A;  4LZR A;  4TZ8 A;  3LQH A;  5FG5 A;  1T1H A;  2OSS A;  4A9J A;  3N9P A;  5KU3 A;  5B76 A;  4FLP A;  5A5S A;  2DX8 A;  2ECI A;  5C85 A;  4UYD A;  4XI1 A;  4F3I A;  1N72 A;  5F60 A;  4WA6 A;  5ENB A;  3U5M A;  2DVQ A;  3GG3 A;  5DYX A;  4XYA A;  4YK0 A;  3U5J A;  4NQM A;  4C66 A;  3KQI A;  5FE2 A;  5E9L A;  4QSS A;  2G6Q A;  4YYD A;  4QEU A;  5CUG A;  1BOR A;  4QYD A;  5H1T A;  3I2D A;  5L97 A;  5TRB A;  4TYL A;  5CQA A;  5EWC A;  3UV5 A;  5EP7 A;  4NR5 A;  4O7B A;  4UYF A;  4QF3 A;  5D3R A;  5FER A;  2YQM A;  5K29 A;  4LR6 A;  4OUF A;  4BW1 A;  4R8P K;  4IR3 A;  2M85 A;  2H0D A;  4YAB A;  4WZ3 B;  2YT5 A;  5E73 A;  2DWW A;  4GNE A;  2I7K A;  4QB3 A;  5BT3 A;  3JVL A;  5F36 A;  3UVX A;  5FFW A;  3L1Z B;  5HM0 A; 
#chains in the Genus database with same CATH topology
 4A4B A;  4QQ4 A;  1DCQ A;  5C11 A;  3S91 A;  1WEW A;  2B0O E;  4Z93 A;  1WEP A;  4KV1 A;  1LDJ B;  3D1D A;  5DW1 A;  5CQT A;  1WIL A;  2LRI C;  2OO1 A;  4FO9 A;  5CQ6 A;  5HRX A;  2EGP A;  4E96 A;  5CQ4 A;  2KU3 A;  3P5O A;  4HBY A;  4QSQ A;  5G4R A;  3HME A;  4YAD A;  2F6J A;  5HRV A;  4LC2 A;  5IG6 A;  2XOY A;  3GL6 A;  2MIQ A;  5AIT A;  3ZPV 1;  5H85 A;  4Q0O A;  4F1P A;  2I8N A;  2KE1 A;  5ETD A;  3IU6 A;  3UV4 A;  1JSP B;  3SOX A;  5LJ0 A;  2DVV A;  1E4U A;  3LQJ A;  2YUC A;  4IR6 A;  1WIM A;  4YAT A;  5I1Q A;  4IC2 A;  3LVQ E;  3KV6 A;  2LV9 A;  2G4A A;  4NR9 A;  4QUU A;  1JM4 B;  1JM7 B;  2JMJ A;  5AD2 A;  1X4U A;  4N4H A;  2E6R A;  4Q0N A;  5EWW A;  5CY9 A;  2L0B A;  3FL2 A;  4MSX A;  4HXK A;  2CKL B;  5J3X A;  5HRW A;  2KTB B;  5C8G A;  3S92 A;  1WEO A;  4O62 A;  3ZVZ B;  3RPG C;  2AN6 A;  4QNS A;  2OUO A;  3UVY A;  2JMI A;  3O7A A;  2JUN A;  3O47 A;  5JWM A;  4YBS A;  4PPE A;  4YH3 A;  2D8S A;  4TT4 A;  4UP0 A;  3UV2 A;  5B79 A;  5F2P A;  3Q2E A;  5EWV A;  2VP7 A;  2L80 A;  4NS5 A;  4LYS A;  5ETB A;  2ECW A;  2VJF A;  5DYC A;  3JUE A;  4ZC9 A;  4YYG A;  5A82 A;  3FKM X;  4WHU A;  4B86 C;  4A9F A;  2VPG A;  5TB6 A;  5JI8 A;  5EPB A;  5KTU A;  2YW8 A;  1HYI A;  3H7H A;  5DLX A;  4ZW1 A;  2PNX A;  4HBV A;  5FFV A;  3Q2F A;  4BW3 A;  2EOD A;  4PKL A;  5CRM A;  3FAN A;  4YBM A;  3G0L A;  5HFR A;  2H60 A;  2YW5 A;  4BHW A;  2C2L A;  3O36 A;  3NG2 A;  5C89 A;  5DKC A;  2R0V A;  4UYG A;  2M1R A;  1K2F A;  4IOO A;  4NQN A;  4UYF B;  5F25 A;  4TU4 A;  5CQ8 A;  1WES A;  4S3O B;  2OXQ C;  5A5N A;  1MBM A;  2YHO A;  3L11 A;  4C9Z A;  4PY6 A;  4NYX A;  5ENE A;  5KH9 A;  5SVX A;  2N9G A;  5FE1 A;  4LYI A;  2M3H A;  4Z6H A;  2KWN A;  3T9K A;  4F52 B;  5EIC A;  4WHW A;  3LVR E;  4Z0R A;  2VJE A;  3KV5 A;  2C2V S;  4A9L A;  5C13 A;  4PCI A;  4Z0O A;  4NYV A;  5LKZ A;  2D82 A;  5I3L A;  4YYK A;  1Z60 A;  3LJU X;  2YHN A;  1LDK C;  4W4U A;  2KFT A;  4MEN A;  2R10 A;  3MDB C;  4IR4 A;  1F62 A;  4YYM A;  4N4I A;  5KO4 A;  4B7Y C;  4Q6F A;  5E9Y A;  2JRJ A;  5AME A;  3JVK A;  4NXJ A;  5SVI B;  5HQ5 A;  5D24 A;  4QSP A;  5F1H A;  5CGP A;  2RR4 A;  5HEL A;  5I89 A;  2IQJ A;  5DLZ A;  1U6G B;  5DIN A;  4QST A;  2VJE B;  2UZG A;  4AUQ B;  5I88 A;  4Z1Q A;  3RPG B;  4YYH A;  3VKG A;  3M62 A;  2YRE A;  5ENH A;  4IOQ A;  5FE9 A;  4FK5 A;  5E9I A;  4YAX A;  4QC3 A;  5IGK A;  4V3K C;  5CQ3 A;  2EJN A;  2CKL A;  5DFB A;  1JM7 A;  3UW9 A;  2GRC A;  3LJW A;  4QEV A;  5TDW A;  5TBN A;  4UIV A;  4A9E A;  5E3D A;  5DBM A;  2FSA A;  4LKA A;  5D3N A;  4XY9 A;  2HDP A;  2HYE D;  5LKU A;  2LGV A;  4I7C A;  5CTL A;  5DKA A;  4QSU A;  4H9D A;  3ZPV E;  3V43 A;  5IGN A;  4A49 A;  4CFK A;  4YYN A;  5CU8 A;  5CQ7 A;  4QY4 A;  5EA1 A;  4BBQ A;  5CUD A;  5I40 A;  3PHD A;  4O72 A;  4QR4 A;  3M63 A;  4KCX A;  2E7O A;  3U5P A;  4CUP A;  2JMD A;  4TU6 A;  5FE4 A;  2M13 A;  4GNG A;  5D1L B;  2KR4 A;  4I7D A;  5CUB A;  5C7N A;  4A9K A;  4UIX A;  5KTW A;  5II2 A;  5EU1 A;  5LKX A;  2K16 A;  1WUG A;  4ZQL A;  4J1P A;  2LGG A;  4ALH A;  4AKI A;  2LGK A;  5EVA A;  2YEM A;  4A0C D;  5L98 A;  4LAD B;  3KDE C;  5G0F A;  4GND A;  2ECT A;  1ZKR A;  5F3A A;  3UVD A;  5E0R A;  2RNY A;  3AAD A;  4NRA A;  4CUT A;  1E6I A;  5JG6 A;  5D7X A;  5DFD A;  5C4Q A;  2FD4 A;  5HCL A;  5H9M A;  2RI7 A;  4R7E A;  4AYC A;  2EA6 A;  2KYU A;  4HXM A;  3ZYQ A;  3AQA A;  4CCG X;  2FUI A;  4N3W A;  2F42 A;  4MR5 A;  5B75 A;  4RVR A;  3KNV A;  1RMD A;  1PUO A;  5CUC A;  3DAI A;  5EYA F;  5D1M B;  4KV4 A;  4QEW A;  5BT5 A;  1ZS5 A;  5L8U A;  3P1F A;  4O78 A;  2QIZ A;  1N87 A;  2LDR A;  4YYI A;  4UYH A;  1WEU A;  4L7X A;  3MUL A;  2KGI A;  5F5Z A;  4MEO A;  2RO1 A;  5AMF A;  4QYL A;  4R2Y A;  3HCU A;  3O34 A;  1JOC A;  1WGM A;  3I3J A;  5HFQ A;  4CLB A;  4XY8 A;  3C6W A;  3T7L A;  3VK6 A;  4HXS A;  5CP5 A;  4HBX A;  4WIV A;  5ENF A;  5LCW B;  2EGM A;  2YSJ A;  3EB6 A;  5L8T A;  4N4F A;  1XWH A;  3SHB A;  4O75 A;  5EWH A;  3MQM A;  2KKX A;  3HCS A;  5ENJ A;  2DKW A;  5D26 A;  1WEV A;  3PLW A;  5C87 A;  1F68 A;  4O7F A;  5A81 A;  1WEM A;  2KGG A;  5D3J A;  5ENI A;  2MD8 C;  2NAA A;  3N9N A;  4WZ2 A;  2CRW A;  2L7P A;  3M7K A;  4AI6 A;  3MB4 A;  4I7B A;  5A83 A;  2L43 A;  3LRQ A;  2VNF A;  3SOU A;  3ZTG A;  5DKH A;  3ERR A;  3LQI A;  4A9N A;  2DSM A;  5G04 B;  3U5L A;  5TAB A;  5LVQ A;  3P1C A;  5DY7 A;  3VKH A;  1VFY A;  2YSM A;  5E9M A;  4GB0 A;  4J0S A;  5D3H A;  2XEU A;  4YC9 A;  2CT2 A;  3D7C A;  5CUA A;  2DJA A;  3D1B A;  3N9M A;  2OWA A;  2K17 A;  3QZT A;  5HQ7 A;  3U5N A;  3RTR B;  5FH7 A;  5HQ6 A;  2YU4 A;  3L1X A;  5FFY A;  4ZDT A;  4HXN A;  5IGM A;  2F6N A;  3T6R A;  4CUQ A;  3E2D A;  5EQ1 A;  5DYA A;  2XB1 A;  3DWD A;  2L5E A;  4A9M A;  5FG6 A;  4UYE A;  3PUR A;  2EXU A;  2DAT A;  3DWY A;  5CS8 A;  4QF2 A;  2XOZ A;  3EB5 A;  3N9O A;  4MR6 A;  5H1U A;  4MEQ A;  2KWJ A;  5A5Q A;  4O77 A;  5CPE A;  2NXB A;  5KH7 A;  5G4S A;  5EIS A;  3O35 A;  4YH4 A;  5I83 A;  2CSZ A;  2VJF B;  4XUB A;  1MM2 A;  4FIP A;  4TT6 A;  3SVH A;  2YYN A;  2WP1 A;  5FE3 A;  3TLP A;  2D8U A;  5EM3 A;  2K4D A;  4HXR A;  4Z1S A;  4TS8 A;  4O70 A;  5H1V A;  5EPS A;  2Y43 A;  5E7D A;  5E74 A;  1WE9 A;  5TCM A;  4AKG A;  5CUE A;  2MUM A;  3SOW A;  5HJC A;  2VPD A;  5D1K B;  4YY6 A;  2LQ6 A;  1DVP A;  2MA6 A;  1FP0 A;  4J0R A;  1V87 A;  4CL9 A;  2XP0 A;  1FBV A;  3O33 A;  4QR5 A;  3ZYU A;  5KHM A;  4NN2 A;  4LK9 A;  3P1D A;  1VD4 A;  3O37 A;  5D3P A;  2ZET C;  4V3L C;  5L96 A;  5I29 A;  3DPL R;  2P57 A;  2KWO A;  4IC3 A;  2ECG A;  4QUT A;  2MNZ A;  4FJC A;  5CRZ A;  3IU5 A;  3ZNI A;  4NRB A;  5II1 A;  3M99 A;  3FAO A;  5LJ1 A;  4TZ2 A;  2R0S A;  2QIC A;  5DX4 A;  1ZBD B;  3MHS A;  3FJU B;  4QZS A;  5DKD A;  4QC1 A;  3MUK A;  4A4C A;  1X4J A;  4QR3 A;  5ENG A;  5LUU A;  1MM3 A;  5FE5 A;  3G0J A;  2YYR A;  1VYX A;  4CFL A;  5I80 A;  5I7X A;  2E61 A;  5COI A;  4L58 A;  5HEM A;  4P5O B;  4HBW A;  4HXL A;  4LRG A;  4O7A A;  2KWK A;  4LLB A;  4X3G A;  4NR4 A;  2L5U A;  2Y1N A;  5B78 A;  3Q1D A;  4UIU A;  4NR8 A;  3SVG A;  4O64 A;  5FB1 A;  5DW2 A;  3N9Q A;  4UIT A;  4X2I A;  5F61 A;  3UVW A;  4CUS A;  4AKH A;  2K1J A;  2RNW A;  2LSP B;  5D25 A;  2Y1M A;  5FEY A;  1IYM A;  5F63 A;  2DVS A;  3NXB A;  4QBM A;  2MD7 B;  3JVM A;  1Z2Q A;  5F1L A;  2G43 A;  1X0J A;  2CSV A;  2L85 A;  3P1E A;  5D3T A;  5ENC A;  5LJ2 A;  5B8D A;  2YUR A;  2KIZ A;  3FM8 C;  2RS9 B;  5ACY A;  5FE8 A;  3QZS A;  4CUR A;  3DQV R;  5E9K A;  5EGU A;  4UI9 B;  2CSY A;  4IOR A;  2RFJ A;  3MB3 A;  5HEN A;  2YQD A;  4O7C A;  5EPR A;  4BW4 A;  4A9H A;  1WEQ A;  4AVX A;  5D0C A;  3PUQ A;  5LVR A;  2IDA A;  5FBX A;  1HYJ A;  2ECN A;  5D3S A;  5E9V A;  2KRE A;  2LXP C;  2YEK A;  4MR4 A;  5FH6 A;  5I86 A;  4Y03 A;  2MNY A;  4OGI A;  2YQL A;  3MHH A;  2D9E A;  5AIU A;  2L84 A;  5CZG A;  5FB0 A;  4HXP A;  4CA1 A;  4MVT A;  3K2J A;  4YBT A;  4QSV A;  4YYJ A;  5J0D A;  5EK9 A;  3HMF A;  5FG4 A;  5EI4 A;  2BAY A;  5I7Y A;  2VPB A;  1EQF A;  4AP4 A;  3MXF A;  4TT2 A;  2E3K A;  3ZVY A;  4J3I A;  4AYC B;  2DVR A;  4NUD A;  2H0D B;  5KH3 A;  3U5O A;  5A85 A;  2XOC A;  3SVF A;  5KTX A;  2MKE A;  2L75 A;  4ZUX U;  4WZ0 A;  4QSR A;  4A9I A;  4LJN A;  5SVY A;  2MA5 A;  2ECJ A;  4QSW A;  3C5K A;  4MR3 A;  4IR5 A;  4TQN A;  4NUC A;  4NRC A;  5IGL A;  5FE7 A;  2YVR A;  4HXO A;  5A7C A;  2G45 A;  4LYW A;  2I50 A;  2VPE A;  2YEL A;  5FE6 A;  5SVI A;  5D3L A;  4LZ2 A;  2YDW A;  2MJV B;  4LDF A;  4XUA A;  4UIZ A;  4A9O A;  4CUU A;  2PUY A;  5TDR A;  4NR7 A;  3U5K A;  1X4I A;  5E3G A;  4NR6 A;  1G25 A;  5A5R A;  2CON A;  2JM3 A;  5K3Q A;  5B77 A;  3ONI A;  4S3O C;  5A5P A;  2CRR A;  2ECV A;  2KKY A;  4TKP B;  5FE0 A;  2LXH C;  1WUM A;  2R0Y A;  1CHC A;  4O71 A;  5FH8 A;  4YY4 A;  4PS5 A;  5A5O A;  2LN0 A;  4UIY A;  2QJ0 A;  5DFC A;  5LKT A;  3N9L A;  4GPJ A;  4NYW A;  2FUU A;  5EV9 A;  5EWD A;  4DON A;  1Z6U A;  5BT4 A;  3QZV A;  2WP2 A;  4Z6I A;  2MT5 A;  4AKN A;  4PCE A;  5F62 A;  4MEP A;  4O7E A;  4GNF A;  5AD3 A;  4UP5 A;  5DYU A;  1WEE A;  2M6M A;  2RSD A;  3HTK C;  4BJX A;  3O70 A;  2LGL A;  4LZS A;  4NUE A;  3SUB A;  3HMH A;  5HLS A;  4OGE A;  5CFW A;  4O74 A;  2E6S A;  3DDT A;  4UIW A;  5IBN A;  5FDZ A;  1WFK A;  3ASL A;  3GV4 A;  3RCW A;  4BW2 A;  3JVJ A;  3IHP A;  4PTB A;  5L99 A;  4OGJ A;  4QSX A;  4C67 A;  5G05 B;  3LXJ A;  4TTE A;  5IID A;  4O76 A;  2RNX A;  4N4G A;  5CQ5 A;  2E7N A;  1WEN A;  3HCT A;  4ALG A;  4LZR A;  4TZ8 A;  3LQH A;  5FG5 A;  1T1H A;  2OSS A;  4A9J A;  3N9P A;  5KU3 A;  5B76 A;  4FLP A;  5A5S A;  2DX8 A;  2ECI A;  5C85 A;  4UYD A;  4OGC A;  4XI1 A;  4F3I A;  1N72 A;  5F60 A;  4WA6 A;  5ENB A;  3U5M A;  2FFW A;  2DVQ A;  3GG3 A;  5DYX A;  4XYA A;  4YK0 A;  3U5J A;  4NQM A;  4C66 A;  3KQI A;  5FE2 A;  5E9L A;  4QSS A;  2G6Q A;  4YYD A;  2LAU A;  4QEU A;  5CUG A;  1BOR A;  4QYD A;  5H1T A;  3I2D A;  5L97 A;  5TRB A;  4TYL A;  5CQA A;  5EWC A;  3UV5 A;  5EP7 A;  4NR5 A;  4O7B A;  4UYF A;  4QF3 A;  5D3R A;  5FER A;  2YQM A;  5K29 A;  4LR6 A;  4OUF A;  4BW1 A;  4R8P K;  4IR3 A;  2M85 A;  2H0D A;  4YAB A;  4WZ3 B;  2YT5 A;  3FEH A;  5E73 A;  3LDY A;  2DWW A;  4GNE A;  2I7K A;  4QB3 A;  5BT3 A;  3JVL A;  5F36 A;  3UVX A;  5FFW A;  3L1Z B;  5HM0 A; 
#chains in the Genus database with same CATH homology
 4A4B A;  5C11 A;  3S91 A;  1WEW A;  4Z93 A;  1WEP A;  4KV1 A;  1LDJ B;  5DW1 A;  5CQT A;  1WIL A;  2LRI C;  2OO1 A;  4FO9 A;  5CQ6 A;  5HRX A;  2EGP A;  4E96 A;  5CQ4 A;  2KU3 A;  3P5O A;  4HBY A;  4QSQ A;  5G4R A;  3HME A;  4YAD A;  2F6J A;  5HRV A;  4LC2 A;  5IG6 A;  5AIT A;  3GL6 A;  2MIQ A;  3ZPV 1;  5H85 A;  4Q0O A;  2I8N A;  2KE1 A;  5ETD A;  3IU6 A;  3UV4 A;  1JSP B;  3SOX A;  5LJ0 A;  2DVV A;  1E4U A;  3LQJ A;  2YUC A;  4IR6 A;  1WIM A;  4YAT A;  5I1Q A;  4IC2 A;  3KV6 A;  2LV9 A;  2G4A A;  4NR9 A;  4QUU A;  1JM4 B;  1JM7 B;  2JMJ A;  5AD2 A;  1X4U A;  4N4H A;  2E6R A;  4Q0N A;  5EWW A;  5CY9 A;  2L0B A;  3FL2 A;  4MSX A;  4HXK A;  2CKL B;  5J3X A;  5HRW A;  2KTB B;  5C8G A;  3S92 A;  1WEO A;  3ZVZ B;  3RPG C;  2AN6 A;  4QNS A;  2OUO A;  3UVY A;  2JMI A;  3O7A A;  5JWM A;  4YBS A;  4PPE A;  4YH3 A;  2D8S A;  4TT4 A;  4UP0 A;  3UV2 A;  5B79 A;  5F2P A;  3Q2E A;  5EWV A;  2VP7 A;  2L80 A;  4NS5 A;  4LYS A;  5ETB A;  2ECW A;  2VJF A;  5DYC A;  4ZC9 A;  4YYG A;  5A82 A;  3FKM X;  4WHU A;  4B86 C;  4A9F A;  2VPG A;  5TB6 A;  5JI8 A;  5EPB A;  5KTU A;  2YW8 A;  1HYI A;  5DLX A;  4ZW1 A;  2PNX A;  4HBV A;  5FFV A;  3Q2F A;  4BW3 A;  2EOD A;  4PKL A;  5CRM A;  4YBM A;  3G0L A;  5HFR A;  2H60 A;  2YW5 A;  4BHW A;  2C2L A;  3O36 A;  3NG2 A;  5C89 A;  5DKC A;  2R0V A;  4UYG A;  2M1R A;  1K2F A;  4IOO A;  4NQN A;  4UYF B;  5F25 A;  4TU4 A;  5CQ8 A;  1WES A;  4S3O B;  2OXQ C;  5A5N A;  3L11 A;  2YHO A;  4C9Z A;  4PY6 A;  4NYX A;  5ENE A;  5KH9 A;  2N9G A;  5FE1 A;  4LYI A;  2M3H A;  4Z6H A;  2KWN A;  4F52 B;  5EIC A;  4WHW A;  2VJE A;  3KV5 A;  2C2V S;  4A9L A;  5C13 A;  4PCI A;  4NYV A;  5LKZ A;  2D82 A;  5I3L A;  4YYK A;  1Z60 A;  2YHN A;  1LDK C;  4W4U A;  2KFT A;  4MEN A;  2R10 A;  4IR4 A;  1F62 A;  4YYM A;  4N4I A;  5KO4 A;  4B7Y C;  4Q6F A;  5E9Y A;  2JRJ A;  5AME A;  3JVK A;  4NXJ A;  5HQ5 A;  5D24 A;  4QSP A;  5F1H A;  5CGP A;  5DIN A;  5HEL A;  5I89 A;  4AUQ B;  5DLZ A;  1U6G B;  4QST A;  2VJE B;  2UZG A;  5I88 A;  4Z1Q A;  3RPG B;  4YYH A;  3M62 A;  2YRE A;  5ENH A;  4IOQ A;  5FE9 A;  4FK5 A;  5E9I A;  4YAX A;  4QC3 A;  5IGK A;  4V3K C;  5CQ3 A;  2CKL A;  5DFB A;  1JM7 A;  3UW9 A;  2GRC A;  3LJW A;  4QEV A;  5TDW A;  5TBN A;  4UIV A;  4A9E A;  5E3D A;  5DBM A;  2FSA A;  4LKA A;  5D3N A;  4XY9 A;  2HDP A;  2HYE D;  5LKU A;  2LGV A;  4I7C A;  5CTL A;  5DKA A;  4QSU A;  3ZPV E;  3V43 A;  5IGN A;  4A49 A;  4CFK A;  4YYN A;  5CU8 A;  5CQ7 A;  4QY4 A;  5EA1 A;  4BBQ A;  5CUD A;  5I40 A;  3PHD A;  4O72 A;  4QR4 A;  3M63 A;  4KCX A;  2E7O A;  3U5P A;  4CUP A;  2JMD A;  4TU6 A;  5FE4 A;  4GNG A;  5D1L B;  2KR4 A;  4I7D A;  5CUB A;  5C7N A;  4A9K A;  4UIX A;  5KTW A;  5II2 A;  5EU1 A;  5LKX A;  2K16 A;  1WUG A;  4ZQL A;  4J1P A;  2LGG A;  4ALH A;  2LGK A;  5EVA A;  2YEM A;  4A0C D;  5L98 A;  4LAD B;  5G0F A;  4GND A;  2ECT A;  5F3A A;  3UVD A;  5E0R A;  2RNY A;  3AAD A;  4NRA A;  4CUT A;  1E6I A;  5JG6 A;  5D7X A;  5DFD A;  5C4Q A;  5HCL A;  5H9M A;  2RI7 A;  4R7E A;  4AYC A;  2EA6 A;  2KYU A;  4HXM A;  3ZYQ A;  3AQA A;  4CCG X;  2FUI A;  4N3W A;  2F42 A;  4MR5 A;  5B75 A;  4RVR A;  3KNV A;  1RMD A;  5CUC A;  3DAI A;  5EYA F;  5D1M B;  4KV4 A;  4QEW A;  5BT5 A;  1ZS5 A;  5L8U A;  3P1F A;  4O78 A;  2QIZ A;  1N87 A;  2LDR A;  4YYI A;  4UYH A;  1WEU A;  4L7X A;  3MUL A;  2KGI A;  5F5Z A;  4MEO A;  2RO1 A;  5AMF A;  4QYL A;  4R2Y A;  3HCU A;  3O34 A;  1JOC A;  1WGM A;  3I3J A;  5HFQ A;  4CLB A;  4XY8 A;  3C6W A;  3T7L A;  3VK6 A;  4HXS A;  5CP5 A;  4HBX A;  4WIV A;  5ENF A;  5LCW B;  2YSJ A;  3EB6 A;  5L8T A;  4N4F A;  1XWH A;  3SHB A;  4O75 A;  5EWH A;  3MQM A;  3HCS A;  5ENJ A;  2DKW A;  5D26 A;  1WEV A;  5C87 A;  1F68 A;  4O7F A;  5A81 A;  1WEM A;  2KGG A;  5D3J A;  5ENI A;  2MD8 C;  2NAA A;  3N9N A;  4WZ2 A;  3MB4 A;  4I7B A;  5A83 A;  2L43 A;  3LRQ A;  2VNF A;  3SOU A;  3ZTG A;  5DKH A;  3LQI A;  4A9N A;  5G04 B;  5TAB A;  3U5L A;  5LVQ A;  3P1C A;  5DY7 A;  1VFY A;  2YSM A;  5E9M A;  4GB0 A;  4J0S A;  5D3H A;  2XEU A;  4YC9 A;  2CT2 A;  3D7C A;  5CUA A;  3N9M A;  2K17 A;  3QZT A;  5HQ7 A;  3U5N A;  3RTR B;  5FH7 A;  5HQ6 A;  2YU4 A;  3L1X A;  5FFY A;  4ZDT A;  4HXN A;  5IGM A;  2F6N A;  3T6R A;  4CUQ A;  5EQ1 A;  5DYA A;  2XB1 A;  2L5E A;  4A9M A;  5FG6 A;  4UYE A;  3PUR A;  2DAT A;  3DWY A;  5CS8 A;  4QF2 A;  3EB5 A;  3N9O A;  4MR6 A;  5H1U A;  4MEQ A;  2KWJ A;  5A5Q A;  4O77 A;  5CPE A;  2NXB A;  5KH7 A;  5G4S A;  5EIS A;  3O35 A;  4YH4 A;  5I83 A;  2CSZ A;  2VJF B;  4XUB A;  1MM2 A;  4FIP A;  4TT6 A;  3SVH A;  2YYN A;  2WP1 A;  5FE3 A;  3TLP A;  5EM3 A;  2K4D A;  4HXR A;  4Z1S A;  4TS8 A;  4O70 A;  5H1V A;  5EPS A;  2Y43 A;  5E7D A;  5E74 A;  1WE9 A;  5TCM A;  5CUE A;  2MUM A;  3SOW A;  5HJC A;  2VPD A;  5D1K B;  4YY6 A;  2LQ6 A;  1DVP A;  2MA6 A;  1FP0 A;  4J0R A;  1V87 A;  4CL9 A;  1FBV A;  3O33 A;  4QR5 A;  3ZYU A;  5KHM A;  4NN2 A;  4LK9 A;  3P1D A;  1VD4 A;  3O37 A;  5D3P A;  2ZET C;  4V3L C;  5L96 A;  5I29 A;  3DPL R;  2KWO A;  4IC3 A;  2ECG A;  4QUT A;  2MNZ A;  4FJC A;  5CRZ A;  3IU5 A;  3ZNI A;  4NRB A;  5II1 A;  3M99 A;  5LJ1 A;  4TZ2 A;  2R0S A;  2QIC A;  5DX4 A;  1ZBD B;  3MHS A;  4QZS A;  5DKD A;  4QC1 A;  3MUK A;  4A4C A;  1X4J A;  4QR3 A;  5ENG A;  5LUU A;  1MM3 A;  5FE5 A;  3G0J A;  2YYR A;  1VYX A;  4CFL A;  5I80 A;  5I7X A;  5COI A;  4L58 A;  5HEM A;  4P5O B;  4HBW A;  4HXL A;  4LRG A;  4O7A A;  2KWK A;  4LLB A;  4X3G A;  4NR4 A;  2L5U A;  2Y1N A;  5B78 A;  4UIU A;  4NR8 A;  3SVG A;  4O64 A;  5FB1 A;  5DW2 A;  3N9Q A;  4UIT A;  4X2I A;  5F61 A;  3UVW A;  4CUS A;  2K1J A;  5FEY A;  2RNW A;  2LSP B;  5D25 A;  2Y1M A;  1IYM A;  5F63 A;  2DVS A;  3NXB A;  4QBM A;  2MD7 B;  3JVM A;  1Z2Q A;  5F1L A;  2G43 A;  1X0J A;  2L85 A;  3P1E A;  5D3T A;  5ENC A;  5LJ2 A;  5B8D A;  2YUR A;  2KIZ A;  2RS9 B;  5ACY A;  5FE8 A;  3QZS A;  4CUR A;  3DQV R;  5E9K A;  5EGU A;  4UI9 B;  2CSY A;  4IOR A;  2RFJ A;  3MB3 A;  5HEN A;  2YQD A;  4O7C A;  5EPR A;  4BW4 A;  4A9H A;  1WEQ A;  4AVX A;  5D0C A;  3PUQ A;  5LVR A;  2IDA A;  5FBX A;  1HYJ A;  2ECN A;  5D3S A;  5E9V A;  2KRE A;  2LXP C;  2YEK A;  4MR4 A;  5FH6 A;  5I86 A;  4Y03 A;  2MNY A;  4OGI A;  2YQL A;  3MHH A;  2D9E A;  5AIU A;  2L84 A;  5CZG A;  5FB0 A;  4HXP A;  4CA1 A;  4MVT A;  3K2J A;  4YBT A;  4QSV A;  4YYJ A;  5J0D A;  5EK9 A;  3HMF A;  5FG4 A;  5EI4 A;  2BAY A;  5I7Y A;  2VPB A;  1EQF A;  4AP4 A;  3MXF A;  4TT2 A;  2E3K A;  3ZVY A;  4J3I A;  4AYC B;  2DVR A;  4NUD A;  2H0D B;  5KH3 A;  3U5O A;  5A85 A;  3SVF A;  5KTX A;  4ZUX U;  2L75 A;  4WZ0 A;  4QSR A;  4A9I A;  4LJN A;  2MA5 A;  2ECJ A;  4QSW A;  3C5K A;  4MR3 A;  4IR5 A;  4TQN A;  4NUC A;  4NRC A;  5IGL A;  5FE7 A;  4HXO A;  5A7C A;  2G45 A;  4LYW A;  2I50 A;  2VPE A;  2YEL A;  5FE6 A;  5D3L A;  4LZ2 A;  2YDW A;  2MJV B;  4LDF A;  4XUA A;  4UIZ A;  4A9O A;  4CUU A;  2PUY A;  5TDR A;  4NR7 A;  3U5K A;  1X4I A;  5E3G A;  4NR6 A;  1G25 A;  5A5R A;  5B77 A;  3ONI A;  4S3O C;  5A5P A;  4TKP B;  2ECV A;  5FE0 A;  2LXH C;  1WUM A;  2R0Y A;  1CHC A;  4O71 A;  5FH8 A;  4YY4 A;  4PS5 A;  5A5O A;  2LN0 A;  4UIY A;  2QJ0 A;  5DFC A;  5LKT A;  3N9L A;  4GPJ A;  4NYW A;  2FUU A;  5EV9 A;  5EWD A;  4DON A;  1Z6U A;  5BT4 A;  3QZV A;  2WP2 A;  4Z6I A;  2MT5 A;  4AKN A;  4PCE A;  5F62 A;  4MEP A;  4O7E A;  4GNF A;  5AD3 A;  4UP5 A;  5DYU A;  1WEE A;  2M6M A;  2RSD A;  3HTK C;  4BJX A;  3O70 A;  2LGL A;  4LZS A;  4NUE A;  3HMH A;  5HLS A;  5CFW A;  4O74 A;  2E6S A;  4UIW A;  5IBN A;  5FDZ A;  1WFK A;  3ASL A;  3GV4 A;  3RCW A;  4BW2 A;  3JVJ A;  3IHP A;  4PTB A;  5L99 A;  4OGJ A;  4QSX A;  4C67 A;  5G05 B;  3LXJ A;  4TTE A;  5IID A;  4O76 A;  2RNX A;  4N4G A;  5CQ5 A;  2E7N A;  1WEN A;  3HCT A;  4ALG A;  4LZR A;  4TZ8 A;  3LQH A;  5FG5 A;  1T1H A;  2OSS A;  4A9J A;  3N9P A;  5KU3 A;  5B76 A;  4FLP A;  5A5S A;  2DX8 A;  2ECI A;  5C85 A;  4UYD A;  4XI1 A;  4F3I A;  1N72 A;  5F60 A;  4WA6 A;  5ENB A;  3U5M A;  2DVQ A;  3GG3 A;  5DYX A;  4XYA A;  4YK0 A;  3U5J A;  4NQM A;  4C66 A;  3KQI A;  5FE2 A;  5E9L A;  4QSS A;  2G6Q A;  4YYD A;  4QEU A;  5CUG A;  1BOR A;  4QYD A;  5H1T A;  3I2D A;  5L97 A;  5TRB A;  4TYL A;  5CQA A;  5EWC A;  3UV5 A;  5EP7 A;  4NR5 A;  4O7B A;  4UYF A;  4QF3 A;  5D3R A;  5FER A;  2YQM A;  5K29 A;  4LR6 A;  4OUF A;  4BW1 A;  4R8P K;  4IR3 A;  2M85 A;  2H0D A;  4YAB A;  4WZ3 B;  2YT5 A;  5E73 A;  2DWW A;  4GNE A;  2I7K A;  4QB3 A;  5BT3 A;  3JVL A;  5F36 A;  3UVX A;  5FFW A;  3L1Z B;  5HM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...