3PUQA

Cekdm7a from c.elegans, complex with alpha-kg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
516
structure length
472
Chain Sequence
TPKESDRCGGCGKFTNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7 homolog
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 148
structure length 472
sequence length 516
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3puqA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3puqA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3puqA01
4MVTA 4GNFA 4UI9B 4Y33A 3GL6A 5TABA 2LXPC 3ZVZB 5B79A 1VRBA 2LXHC 1RMDA 4YBSA 4LK9A 2F6JA 3HCSA 3T7LA 3KNVA 3LD8A 5FYSA 2YSMA 5LKXA 3LRQA 1WESA 4R8PK 5A3NA 5DINA 4IGPA 1E4UA 5FY7A 1FP0A 5B78A 5FP9A 2KYUA 4I7CA 4BXFA 2YQLA 5G04B 2VNFA 1ZBDB 5F3GA 5A1FA 4BU2A 3O36A 5IVBA 2PNXA 4DIQA 4EZ4A 1MM2A 2YU1A 4O64A 2XEUA 1Z2QA 3L1ZB 2YQMA 5FZEA 5ANQA 5FPBA 5FYIA 2KWNA 1VFYA 3T6RA 2VPBA 4HOOA 4A0CD 2CKLA 2YPDA 2G6QA 5FWJA 1X4UA 3DPLR 5FYBA 2ECNA 2VJFA 3PTRB 1VD4A 5IVCA 3PURA 2K16A 2OXQC 4QX7A 5AIUA 2LGLA 4EYUA 4CCJA 1MM3A 5EYAF 5IVEA 2YSJA 2YYRA 5FYTA 1WEWA 4UP0A 1WENA 4YAXA 1JM7A 5FXVA 5FY5A 2AN6A 2JMIA 5FP4A 4ASKA 2E6SA 1JOCA 5B76A 3DXUA 1T1HA 2FUUA 5FEYA 2KGIA 3IHPA 2Q8DA 2JMJA 5E6HA 5A7PA 2ZETC 1K2FA 2CSYA 2K4DA 3M63A 5LKZA 2OT7A 5D1MB 4LJNA 2ECWA 4GAZA 3N9MA 5FY4A 2BAYA 5B75A 2G45A 3KV4A 2PUYA 2YBSA 3U5MA 4LIVA 5FZBA 2KIZA 2LGGA 2FSAA 5FB0A 5LKUA 3SOXA 4MSXA 3AL5A 5F5AA 1HYIA 2YW8A 4GJYA 4X3GA 4AVXA 2XMLA 4D6RA 3O37A 2KWJA 5F5IA 5FY0A 4AP4A 4GD4A 2W2IA 3K3OA 5F37A 3ZTGA 5FY8A 1FBVA 2CSZA 4UF0B 3U5NA 3RPGB 3KVBA 3N9OA 2KWKA 3UYJA 2L5UA 3N9PA 2FUIA 2JMDA 4YATA 5H9MA 4CCNA 4QXBA 2XB1A 1HYJA 3KV9A 5FBJA 5KR7A 4V3LC 5FV3A 4FO9A 2VJEA 2HDPA 3DQVR 4E4HA 5FP3A 5FWEA 2LN0A 5FXXA 3M62A 4IGOA 3RPGC 5FJHA 3U4SA 5FERA 5F3CA 5TDWA 4PPEA 4D6QA 4B7YC 2XXZA 4AYCA 1WEVA 2YU4A 4AUQB 5FZHA 2IDAA 4AAPA 5KH3A 1X4IA 4ZDTA 3O34A 2C2LA 4S3OB 4C9ZA 5FP7A 2QIZA 1DVPA 5C13A 5H1TA 2ECTA 2LV9A 4V2WA 1IYMA 2E6RA 4GNDA 3PUSA 2EA6A 1WEEA 2KR4A 3HTKC 2MD8C 4Y3OA 3AVSA 4S3OC 2OQ6A 2YHNA 3EB5A 5B77A 2KU3A 5F32A 3MHHA 2LGVA 4YBMA 4L58A 4L7XA 1WEQA 5CEHA 4NUBA 5A80A 2MA6A 5TDRA 4QX8A 5FZ4A 5IW0A 5TBNA 2KGGA 5F39A 5FZOA 2CKLB 4LITA 4XDPA 2LGKA 3K2OA 2VJFB 5FPAA 4YC9A 5FXZA 4NN2A 2RI7A 2QICA 4PTBA 4QF2A 2EODA 4EZHA 4P5OB 1WEMA 5LWBA 2ECVA 3LQJA 3O70A 4V2VA 3SOUA 3ZVYA 5FZAA 3U5PA 1X4JA 2M1RA 4QXHA 2VD7A 4V3KC 3PUAA 4TN7A 5FB1A 1JM7B 4BBQA 4FIPA 4ZQLA 4Y4RA 4A49A 1WFKA 5A3TA 5FYHA 5LCWB 5F3EA 2F42A 1WEPA 4DO0A 3V43A 5H1UA 5FYYA 4LIUA 2VP7A 5FUNA 2KREA 5F2WA 3PDQA 1WEUA 4GJZA 2PXJA 3K3NA 4BHWA 3LQHA 5B8DA 1XWHA 2YBKA 3ZPVE 5D1LB 3NJYA 3QZVA 4AI9A 1LDJB 5IVJA 2MNYA 2F6NA 5FZ0A 4B86C 4HONA 2EGPA 2M3HA 2YURA 1WIMA 5FUPA 3N9LA 5A7WA 3ZYQA 5FYUA 5KH7A 4TKPB 4CSWA 4IC3A 3N9QA 4N3WA 3PU8A 4XI1A 2WWJA 2XDVA 4LXLA 2VPDA 4YABA 5FZCA 4I7DA 2D8SA 2MUMA 2KE1A 5FJKA 5D1KB 5F3IA 1CHCA 4LKAA 4R2YA 2MIQA 2VJEB 4ZUXU 2CT2A 5IVFA 4GNGA 5H1VA 4IGQA 3KV6A 5FPLA 1WILA 2OX0A 4CA1A 2I50A 2YT5A 5A7NA 2VPEA 5FZ7A 2H0DA 3FL2A 5AITA 4IC2A 3AVRA 2KFTA 5TRBA 4QXCA 2HYED 3O7AA 4QWNA 5FZDA 4AYCB 4F52B 5A3PA 1LDKC 2M85A 3HCUA 3RVHA 2XUEA 2MNZA 4QU1A 4Q6FA 3MHSA 2GP3A 5FYMA 2JRJA 3ZNIA 4CCMA 3GV4A 2ECIA 3PUQA 4C8DA 4WZ3B 5FZ3A 5FZ6A 2K17A 4QF3A 5FYVA 3VK6A 5FZ8A 5DKAA 3O35A 4WZ0A 3C6WA 5IVVA 2OQ7A 4YADA 5FZ9A 1F62A 3NG2A 2QJ0A 1Z6UA 2LRIC 1WGMA 3DXTA 5FZOB 1Z60A 2G43A 2YREA 3EB6A 2K1JA 2L75A 2M6MA 4LADB 3O33A 5FY1A 3LDBA 3OPTA 5FPVA 3HCTA 5F2SA 4W4UA 4YBTA 5G05B 5J3XA 2GP5A 1WEOA 5FZFA 4N4FA 4A4CA 4WZ2A 2ECGA 3SOWA 2YUCA 5ISLA 1VYXA 4GNEA 4LLBA 2Y43A 2YBPA 1U6GB 2Y1MA 1G25A 3KQIA 2L0BA 5LY1A 4A4BA 3ZLIA 5LKTA 3PU3A 3L11A 3N9NA 5FY9A 5F5CA 1N87A 4CCOA 2KWOA 4CCLA 5FZ1A 5FZKA 3KVAA 2MD7B 5G0FA 4URAA 3L1XA 3AL6A 4FK5A 5FZIA 5FZGA 4CCKA 2WWUA 5LY2A 5A3WA 5I3LA 5K4LA 3KV5A 3ASLA 3OPWA 2RSDA 2L80A 5C11A 3ZPOA 3C5KA 5A7SA 5FYZA 2ECJA 4BISA 2OS2A 2L43A 3RTRB 1BORA 2P5BA 4R7EA 5FP8A 4GB0A 3U78A 2MA5A 3M99A 2VPGA 4UP5A 2Y1NA 2LDRA 5KH9A 3SHBA 5A7WB 2MT5A 2Q8CA 5JG6A 1WE9A 5LW9A 2NAAA 2Q8EA 4WA6A 2YU2A 5A7QA 3ZPV1 4FJCA 5FXWA 4D6SA 2C2VS 5IWFA 3I2DA 5FYCA 5A1LA 5A7OA 1V87A 2LQ6A 2DX8A 4I7BA 3LQIA 4UF0A 5IVYA 5FZLA 4XDOA 4CCGX 2YHOA 3U5OA 3PHDA 5FZMA 4CUGA 2UZGA 5FPUA 2H0DB
chains in the Genus database with same CATH superfamily
5KHGA 2VBDA 3NKGA 3D82A 3ALQA 2XLGA 1I1EA 3TN92 1QF3A 1QGLA 4CCCA 3D0SA 1YFWA 5A6QA 3KNVA 4UVBB 4RA0A 4IGPA 3TNQA 3C4XA 4HBNA 1PIV1 3H7HA 2Z6EA 2VMDA 4O62A 1PGL2 1ZRDA 2AC1A 4XURA 2WU2A 2QNKA 3L1ZB 2ZM2A 3L8RA 3DDTA 3U37A 4EQVA 3V5UA 2Y6FA 4GKKT 2RHPA 4AFCA 4Y22B 4RQPB 1YXRA 1RUH3 2K2SA 3IAPA 5EK3A 1RJ8A 2E32A 4HSJA 2D93A 3KLSA 4BQ3A 5L3CB 1WYBA 1PO23 4HFHA 1PK6A 3B9IA 3ZXEA 1HJGA 2WDBA 2JD4A 1UNBA 1QJZA 5HXEA 2DI4A 4JQTA 2FSAA 4JGYC 3VBUB 1GQGA 4XFCA 2WP9A 4YXDA 5F5IA 5A6XA 1JXNA 3RIUC 4Z82A 3N9OA 3NAPA 1RVF2 4CZSA 1CZSA 4D7YA 3KV9A 1UYPA 3UT5E 2ARCA 2HH7A 4E4HA 4H63V 3KGLA 5FJHA 3N35A 2BRTA 3FFQA 4LLOA 2P6HA 1WCUA 4AYCA 1X8MA 2JX9A 4LMKA 3NJXA 4OMDA 1WLCA 4YT0A 4BE3A 3MHZA 2C2LA 1O3SA 2LHRA 2XHEB 3WLUA 5JTGA 2E53A 1TMF3 1B09A 3AVSA 1J3PA 2RS13 2LGVA 4FPGA 4NPRA 2BVVA 3EXUA 5CEHA 1WEQA 3FBZA 5TBNA 1ZYBA 1AR63 1W2NA 5J98B 3MIEA 4L0PA 2BBAA 5LG4A 3ZYKA 2Y0OA 4DNDA 3QB5K 2XJVA 4HN1A 1WD3A 2ZTNA 4CDXB 3U5PA 5FO9B 2JDZA 4KI5M 5KHKA 4GIQA 5HV0A 5FB1A 3O7OA 2VQUA 1OKQA 1CAXA 2CSVA 1V00A 2E8IA 4NUUA 1L3JA 1XWMA 4YSFA 2WA3A 2HWB3 3ZSMA 1QOTA 1CZVA 3K3NA 5LEJA 5JR7B 5E1RA 2ZGNA 4RYDA 1LDJB 3ILRA 5IVJA 4JDOA 4IE4A 4L9IA 4IEQA 5HXVA 2VULA 2J1SA 3N7JA 3ZC1A 1FMVA 4GYRA 3P4WA 5CKMA 1HRI2 4LKDA 2VZTA 5DPNA 3ON7A 3N9QA 4XUPA 1MMAA 4YZ2A 5FZCA 4AFMA 4YARA 5AQSB 3NSTA 1W90A 3ZFGA 5FJKA 4GK5E 2W1SA 2DUOA 2QQIA 1WCSA 3FHAA 3ZYFA 3RJ2X 5H1VA 3KV6A 1EV12 2D3SA 4JC1A 1JI6A 4MGYE 4QMAA 1RUG2 5A3PA 2QZ3A 3O12A 3MI8A 2I07B 3NWKA 3ILNA 1AL23 4DEQA 1JUHA 2XBO3 1U5ZA 1VPHA 4C0HA 2XQ5A 2WDVA 5FYVA 4FFFA 3W5NA 4XAEA 4XABA 3HI2A 1L7RA 2QZ2A 3IDCB 5I93A 5K8SA 2BNMA 4UEMA 4GWMA 2CLYC 3AM2A 2X53S 4QU2A 3ONXA 1VLNA 3LQCA 1Z8UA 2H0VA 2Y6GA 5FY1A 2DFBA 3HCTA 4P08A 5G05B 1GOHA 2YUCA 1VYXA 2VZ3A 3AP6A 4MO3M 1VBB2 3FEHA 4YFZA 2RM23 4CCOA 1OVSA 1XRUA 1RINA 4ILAA 4ZEYA 4CCDA 5FZGA 2MNGA 5EV7A 4O7XA 3AKTA 4LUMA 3OPWA 2VUAA 4IEXA 4FI5A 1F2NA 2VCAA 2MA5A 2W91A 1C1LA 1W2AX 1YXWA 3BU0A 5JZGC 2D2SA 2CDPA 2QVAA 1R8IA 1JZ2A 1NXMA 1UY4A 3UK9A 1MS0A 2V5CA 4CN6A 2B76A 2IFRA 2C2VS 5FKBA 2JE9A 1V87A 4HPKA 3D8CA 3SFEA 4A7YA 5JSOA 1LCLA 2IC6A 3VBOB 1ZM1A 1FV3A 4DV7T 3LDKA 1C8M3 4JGZA 4H2AA 2B1EA 2A72A 2PTMA 2JECA 3IN9A 2WYSA 4QH1A 3R6SA 5KHIA 1V6LA 2D98A 1JOJA 1XMQT 2YSMA 3LRQA 2UXCT 3AE8A 4PK5A 4RHV3 1XYOA 4LHSA 4W8JA 3AECA 2DCJA 3RYPA 3WG4A 4P9LA 1SLCA 1VBC1 2X66A 2RDRA 3RLFF 5EJ1B 2YU1A 5LEKA 3ACFA 4DUVA 2YQMA 1XB9A 1VFYA 4YZ5A 3AE3A 4FFGA 5FWJA 2VOWA 1LRHA 5IVCA 4Q4Y3 4AK3A 4GMP1 1AUYA 1W8TA 1C57A 1X82A 1YQ6A 4LR4A 1ZRRA 1QXRA 2X9YA 2C5IT 4ZU4A 3PUVF 2HPJA 2JMIA 4ASKA 2NQYA 2BPA2 1OOPC 3T4HB 2VB6A 2O1QA 1ZBE2 2B46X 1YNAA 4YVSC 2ZGUA 3DTOA 5AFBA 1DGRA 5LK5A 1JYXA 3RI9A 3ZYGA 4NOTA 3AEGA 1RUJ2 4OYUA 4X65T 1RB8G 2XGXA 2ZLYA 5LKUA 3O0VA 5F7UA 1ND2C 2Z4FA 4HKOA 5JH7E 4BQXA 2V26A 4AVXA 4P0BA 5JXIA 1ASJ3 3P3NA 3CZJA 3F2EA 3LF7A 3U4XA 4LO5B 2V8SV 1HX1B 4GH4C 3U5NA 2IQJA 3RPGB 1BEV3 1U5YA 5D8AA 3POGA 1FXZA 4AIUA 4GK0E 2NWBA 4TLGA 1NX9A 4E2QA 2GNMA 3NNLA 2WT2A 4SBVA 3NKTA 4DMIA 1YJKA 3TBDA 1CGPA 4CDQB 4QH4A 4IERA 3DPRC 5JDGA 3WHTA 2YU4A 3EHZA 5FMNA 4LMFA 5CA1E 3WW3A 4ZI3C 5KH3A 4IHJE 3T08A 2VBBA 4AEMA 5SV5A 1R083 2RS32 3PVNA 3O1PA 3ZSSA 2JB4A 2LOPA 1QXJA 3BTYA 3PUSA 2ET1A 2ZGRA 3SNMA 4YM1A 2JDNA 2VCMA 2IXLA 3AYCA 4M00A 2D5FA 5F39A 4O4HE 4R9CA 4Z2AA 1RUH1 1D0YA 1RUOA 5HCHA 5J2UE 2Q5TA 2QQNA 2F4PA 2Z2SB 5H9QA 5DUXA 1UX7A 2OPKA 1WLDA 3QD6A 1PO21 4TZ4C 4XFGA 4MGZE 4KQ7A 3ZEFB 3VLBB 2C5KT 4FIPA 4MGTA 5FYHA 4XPVA 5JXHA 2LM9A 1OFNA 2JB8A 3ZXKA 1OEDB 4DIDB 1PM4A 2RJKA 4X62T 5I8SA 3R05A 2KKXA 2YC2A 3B02A 3T1LA 1DQ5A 3QZVA 4AI9A 5FLJA 3R4SA 3FZFB 1LGCA 5HCFA 3N9LA 3ZXAC 3PUWF 2KSRA 5JCTA 5IYZE 2JE7A 4Y1ZA 4EV6A 1MEC2 1KFYA 3EB7A 1VBD2 4BWOA 1CJDA 4FP3A 1UPIA 2JDYA 3EAMA 3PVEA 2WQ4A 3PJAA 2M6BA 1WILA 2J7MA 4AEJA 1M62A 1WCQA 3KDEC 2D7FA 2ZACA 4ERRA 1TMF1 3HD8B 3HBZA 3WSOA 4HWCA 1SDDB 1RUE1 2B0OE 3GJBA 3Q5DA 4CEWC 2A7AA 3ONLC 1XQNA 5J0ZA 5DJQC 1XXNA 4P9XA 3SEPA 1AR61 3AP5A 2CYFA 3DV8A 4KWJA 2UY8A 3NNMA 3KM5A 3ZFFA 4XEZA 2QJ0A 5LCYA 3R0RA 4XUTA 1HB3A 1H1IA 2HWD2 3DXTA 3WW1A 3I3MA 5J36A 4P14A 4LADB 5J48A 4IDZA 1URXA 1W06A 5HEJA 3OUJA 4WM7B 2J62A 4A4CA 1CAWB 5ISLA 2LS6A 5FMOS 1MBMA 2WO1A 4XJZA 1J1TA 4AI6A 4XFFA 3WF1A 4AHXA 2ZAAA 4QXHB 3E22E 5L9RA 2HWB1 1XU1A 1PNFA 2DCZA 3M3CA 2JDPA 3K75B 4IEVA 4JI6T 3J7NA 3ANWB 1GWMA 4PLOA 2JG8A 2WN2A 5FLIA 3MLJA 4XF4A 2L80A 4O9GA 1LOFC 2C1FA 1AYM2 4CDWA 3WCRA 2PAKA 3LPFA 1AR93 2V7JA 3RZKA 3AXJB 4NAMA 3GZUC 1G86A 3M3ZB 1UF2C 4OI2A 3O0XA 3WOGA 1FOD2 4DR6T 1KJLA 3TB0A 3DJBA 3DECA 1H2KA 4UF0A 3TLSA 3I2KA 4A3ZA 3AAIA 3TN93 1GZCA 4CCGX 4ZXKA 2IFWA 2ZEYA 3AE2A 1LGBA 3P6BA 2Y26A 2XBO1 4PDWB 5TABA 3WDWA 4DUWA 1FMD2 4Y5SA 5B79A 5AFUL 1RMDA 3BPZA 4NJ4A 3HCSA 4B1MA 4XIOA 3O1HA 5KXJA 2WSSV 4HFBA 1SLBA 2BS4A 1LB2A 2B8MA 4JHZA 5J1XA 2DJAA 1TG7A 4XBFB 3JCFA 1MMNA 3AEBA 3GCXA 1K5MB 1SEFA 3CJXA 2XEUA 2VC9A 3OEAA 5FPBA 4UFIA 2PHTA 4CCEA 3BIWE 3WHUA 3KQ4B 1UMHA 2WBKA 2RM21 3IZOA 5J1GA 2E7TA 1BXHA 2BFUL 3SH3A 2FD8A 3MACA 1XNTA 4Z2WA 3HPNA 2WNVB 5C5TA 4IE6A 4K1YA 2D6LX 3VBFB 2E6SA 5B76A 2FUPA 4PK4A 5CB4E 3AEDA 1LKNA 1G8XA 5A3LA 5CG8A 3LB9A 2VW0A 4JGYA 4WYVA 2SPCA 5BMVE 3O1IA 5HCBA 3VBSC 3I97A 4CEYB 3N2GE 4NPPA 1QH6A 5A3MA 4TTGA 1CX4A 3OYWB 2OUHA 4CP2A 2IXIA 1W6MA 1LOEA 4YW4A 3RIUA 1MQTC 4D6RA 2FZ1A 1LVFA 3Q8EA 1C8M1 3FZKB 4N8MA 4OLLA 3IT8A 3V0BB 4LBQB 3LK2B 2PLV1 1I6ZA 1N3OA 1KDMA 1IBLT 4RHV1 1KF6A 3Q8BA 1OQDA 1GWLA 3I3BA 2K9AA 4B7YC 3NVOA 4AUQB 3LA7A 4AAPA 1GMMA 2MPKA 1DYOA 1ENQA 5EYXA 4C9ZA 2XY8B 4OYKA 4JI0T 1IYMA 2RG4A 3ITQA 1W9WA 3N5LA 2YHNA 4J1XA 3AEAA 5KXEA 4Q4Y1 4C90A 2I59A 3IBPA 3JQWA 5KXCA 4MLKA 2NP0A 4BXSV 2Y8DA 1DDLA 1DZRA 2C9AA 1UYZA 2E26A 4QF2A 2Y64A 4ORFA 1CAVA 3VHOA 5JQGE 4MBQA 4BYYA 1JM7B 1E5SA 1BR1A 3M7KA 3H42B 1ZNPA 4BJ0A 5LCWB 2BVBA 3TEWA 1OPMA 1NUKA 4CDXC 4BOWA 4L92A 3RYFE 5LBBA 4COFA 3FLRA 1AX1A 4IEYA 3VN4A 2XQ8A 2XQ3A 4J25A 3ZX7A 3OEBA 2W94A 3ZPVE 5GLWA 2K0GA 3L2YA 2GH8A 4NWVA 1ASJ1 1E57A 1HRI3 1KEXA 2IVJA 4F6RC 5FUPA 5HEUA 1BEV1 3PE0A 5L2LA 4G4FA 2Y33A 5IHRA 3L3PA 1H0BA 1SBFA 3AKSA 3ZYLA 2XDVA 3ZT6A 1ONAA 2GNTA 1EV13 4QXBB 5FOJB 5AQQB 5BNOB 2VJEB 2Q1ZB 1RUG3 2FDGA 4CA1A 3NL1A 4PQ9A 2FJBA 2WN3A 4QX1A 2EHOC 1R081 5IK4A 2HWE3 1H1AA 2E9XC 4QU1A 3ABVA 2TBVA 1LOBA 4UW5A 3GV4A 2HEVF 4C8DA 3ZN1B 1HX6A 2QQWA 4M0HA 3HKCE 5CA6A 5AQTB 4GKYA 1TEIA 3ACGA 3JU9A 3RRDA 1O6UA 2W1QA 4HKWA 4U2ZA 2WSUA 1UU6A 5BNPB 5DUWA 5FPVA 5BV6A 2YKSA 4XJUA 5C3QA 1WCDJ 1RMU1 5IFTA 3B5LB 5L7OC 5JI7A 4JKLA 1YQ8A 1OPOA 3OD0A 1X36A 3J8F2 4JV4A 3T1MA 2E33A 4L99A 1NKGA 3WT3A 4CCLA 3CIRA 1PMJX 4AFDA 2SLIA 1UU4A 2Q1FA 4EJRA 1D7PM 5JZGA 5JDMA 1LU2A 1UOBA 3SCHA 4KBZA 4CVUA 1IAPA 4CUBA 3VZMA 1PGSA 4Q8LA 3WG2A 5C9AC 4M3CF 4GOUA 1UZVA 4HVOA 2D0TA 5BPXA 2NAAA 4I55E 5AC93 4LOSA 4JAAA 5ACA1 2YU2A 3AX4A 4YM2A 4DXTA 1UL9A 3MK7C 5CJ5A 3LJCA 2HJIA 3ZJ2A 1JZ7A 1RGSA 4E2SA 3NJVA 5FZ0A 3MJXA 2LSIA 1WCRA 3RSJA 5IFPA 4DBRA 3U11A 3FHIB 1OBNA 4IV3B 3QC9A 1ZP0A 1Q8OA 4FFHA 1WESA 4R52A 1REDA 5KBFA 1FNZA 2OUJA 5ANNA 1OVPA 1Z78A 5IVBA 4YG6A 2CXLA 4LT5A 5LNKA 2LUWA 1Z2QA 4ILUA 3MW2A 1IPKA 4LA2A 5I91A 2XPJA 2KLQA 1FI2A 2XJ7A 4PLMA 5LBQB 1VBE2 4KGQA 1OOPA 2XP0A 4H63H 2VZ1A 3BGAA 2V4VA 2AEZA 4YVSA 3E5XA 4XE9A 1ZBE3 4IDOA 1BR4A 3DXUA 1AR91 4F7ZA 2MHFA 5A7PA 1ND2A 3W15B 3FBLA 3SEEA 4BPZA 3FHQA 5L73A 4WW0A 3B57A 1G9AA 4GH4A 3O0WA 3ACHA 3RS6A 2ZHKA 3TN91 3JB4C 2KWJA 3CX8B 4AP4A 3WP6A 3DKQA 4LKFA 1DU2A 4JI3T 4F8HA 3PUHA 2VOVA 4PJJA 1WBLA 3PL0A 3O1RA 3DPRA 1V9U2 1FIOA 3AAEB 1OQ1A 1C4RA 3ASIA 1J84A 4OHWA 3RPGC 4UW4A 3KWVA 5HCAA 5GLZA 3I8TA 1QEXA 4LHLA 2VZQA 3P7IA 2RMU2 4MSVA 2ZMNA 4CDQC 3QH6A 3PIJA 3PJYA 4BA6A 4L97A 1H2MA 2KR2A 4Q4W2 5DXDA 4NIAA 1HQLA 3P4PA 5JPMB 2XM1A 2PQSA 2D43A 2WLPA 5T3NA 5EZYE 2LTNA 4M0NA 5FCCA 4CXXA 3ZSEA 3ZVXA 4XF1A 5LA1A 4HFIA 3UETA 1PIV2 3URFA 2XVGA 1X4JA 1MZ6A 2VD7A 1S0DA 2VZUA 1RXGA 3ZN6A 3MIBA 5A3TA 5F3EA 4DO0A 3P1IA 2WZPP 3U1XA 2G0UA 5CB7A 2ZMKA 4K6BA 4KBBA 1OEDC 3QUJA 3LFMA 1A78A 5HYAA 1MEC3 3W59A 3SISA 3C2UA 3NV2A 3T30A 3H8OA 3ZYQA 2JG9B 3W58A 4FTBA 3VR9A 1POQA 2FD4A 3O1JA 2WYFA 2A6WA 3ZSJA 4Q0VA 3NV1A 2W4XA 3BB6A 1T7SA 1KS5A 2WM9A 3VHRA 4CEWA 1HJFA 2XR4A 4A4AA 4F52B 2HYED 3WINE 2GNDA 2XUEA 4U74A 4B6XA 1LHWA 2KZ7B 2KM2A 3VU7H 4E27A 4LMLA 4QF3A 1T6BX 5GZCA 3OOXA 5FFOC 3A0KA 2WQYA 3GJAA 2HWD3 4NRQA 2BGOA 3UFEA 1M06G 4YADA 2IXCA 3FMGA 2YREA 5K9YA 1Q43A 4O4LE 3TLUA 2PHRA 1QNYA 3AZXA 1VAVA 1BMV2 1VOMA 3O1SA 2YBPA 1U6GB 2EAKA 3KD4A 5EWSA 2CXFA 4TN7B 2Y6JA 1JYVA 1LKXA 1JZ6A 2H6BA 2BZBA 5CGMA 5JOYA 3RG0A 3WF0A 4S2DA 2YGLA 4RFT0 2BDEA 3LE0A 1BJQA 4MOAA 1LOFA 1JMUB 3HT2A 1HRI1 2UXNB 2RJ2A 1AYM3 4DR5T 2BU9A 4WBBA 3S5QA 1XU2A 4ZZBA 4MZUA 5FYZA 5JDQA 1AR72 1YQ4A 3ZN4A 4HWHA 2YN6A 1N47A 3BIEA 1V6NA 5EXOA 1EV11 3HVDA 3ZKRA 1WE9A 4GQ7A 1LHNA 3AKQA 1RUG1 3ZFEB 2JDAA 5AFEA 1UGOA 3LDQB 3LVRE 2WZHA 4RSUA 2HWE1 2D40A 2ZM0A 5L3EB 3ZO0B 5AQMB 5FZLA 1FMD3 2WY2A 2VMCA 1UCUA 4XFIA 4DV3T 4K20A 1GZWB 3ZVZB 3SS1A 2JJ6A 2OZ6A 1GNZA 2Y60A 2HYKA 4H9QC 1UU5A 5KX5E 2X5IC 3DCQA 4PDWC 3PMEA 1Q5OA 3WEZA 1HRV3 5KMGP 1H4HA 3KBUA 4LA3A 4KMCA 3I3EA 2EALA 5A1FA 4AQ2A 5CBLA 3C8XA 4X8NA 4EZ4A 1S0FA 1ULFA 2WS92 4W65A 5FYIA 2XB6C 2LHNA 2PA7A 3UU3A 4ZU5A 4W6WA 4NHXA 2AACA 5FYBA 2VJFA 1UIKA 3PTRB 3UKTA 3BU7A 2CGPA 5JR9C 1KFXL 1EPZA 2CBIA 2E5LT 1NQJA 4KU8A 5EYYA 4QXKA 4PJNA 1POV0 3GALA 2PQQA 4CP1A 3VBSA 2FDFA 4N43B 5FXVA 5ERLA 5FEYA 2JMJA 4AW7A 4IV1C 4Y20A 4W6XA 1OQEA 2A75A 4YW6A 1MQTA 4LJNA 2WT1A 3I9YA 5AC91 5HBAA 4MALA 4TNVA 4Q1RA 4AOCA 5LGNB 2WJSA 4Q2FA 4JHTA 3SOXA 4CEYC 3IDEA 1AR81 4X3GA 3POSA 4RR3C 1OKOA 3ETQA 2ZGPA 3VDDB 4LF4T 1H6XA 1Q8QA 2B39A 2ARXA 5L36A 1YKEB 3DL3A 1POV3 4AHZA 1GP6A 2XB1A 3Q8CA 4DVDA 3A23A 5I0TA 2XL7A 3NKZA 3DQVR 5AQLB 4M1PA 5FTTC 4EN0A 3WG3A 5FERA 2IVIB 1XNBA 4DV4T 2CE7A 5C70A 2XQ4A 3PDYA 3D0TA 4XBNA 5I8YA 1WW7A 1JU4A 2W87A 4AGGA 1W8FA 2BOJA 3EBRA 4CYDA 2NPIA 1FYUA 2OQ6A 1OFSA 4AFAA 2D0UA 2BGCA 4Q4X2 1G6NA 4NUBA 5A80A 1PX4A 4H7MA 1W2UA 3EDUA 2DWRA 2R062 4CDUB 4OHZA 1ZA7A 4AVAA 1ZBE1 4DINB 5LBCA 3M3EA 4QDSA 2OPWA 3ZR6A 4IETA 3O70A 4CDXA 1N33T 3E08A 1O59A 2DHRA 2WWSA 4ZQLA 1US2A 3T2OA 1VBC2 4A49A 2VBPA 3EYPA 5GZDA 4KL1A 2F42A 4PI0A 1FEWA 2LM2A 4JUYA 3H8UA 4BHWA 3UKVA 2Y34A 4XZUG 2BYVE 2V7IA 1XWHA 4CUCA 5D1LB 2ET7A 4YRDA 2WABA 3P4QA 4WZXA 2C6SA 3UKNA 4FAHA 3WNNA 1MS4A 4B4QA 2LKHA 4Y5Z0 3LIGA 2OWAA 4U31A 1UQXA 3BQIA 2H0BA 2XJSA 4XMIA 3CX7B 3H1MA 3M3IA 5HXSA 4AEDB 2EHOA 3K48A 3QLQA 4LKAA 4R2YA 2E9XA 1TQ5A 5IVFA 3MIFA 2YGMA 3AXEA 1PZ7A 3FL2A 4LKEA 4QWNA 4XFHA 4Q0PA 4RD7A 2P2KA 1UX5A 3LA3A 1GQPA 1SLAA 3ONJA 2IXHA 3BUCA 4FTSA 4P9IA 3HNMA 4XUOA 3FWEA 2XQRA 2C26A 3VHLA 5L7OA 2G43A 2UUAT 3EB6A 4IL4A 2L75A 1BCXA 2JDMA 2GP5A 1QOOA 1FNYA 4U2YA 1LECA 3G6JB 4X64T 3J8F3 2RDNA 1LJ7A 2Y1MA 2J1UA 5FY9A 2VQAA 4L5GA 1S0GA 4AXPA 1ZRCA 4ITCA 3NRUA 2ODVA 2UURA 5FZKA 1CONA 3MEPA 1TE1B 4QQPA 3BALA 1IS6A 5C9AA 3L1XA 3AL6A 3WDYA 4FK5A 4PI2A 1OA2A 3TRSB 1RUH2 4YGBA 4QPYA 3GBFA 1MEC1 4UVCB 1F4HA 1B35C 2N7GA 4CUAA 5HEGA 3ZYMA 1AXKA 1SLIA 1Q8SA 3I2IA 2V6XA 1GR3A 2ZEWA 4UP5A 1PO22 1R1A2 5SVYA 3OTFA 3P4SA 3AZYA 4AQTA 2VOTA 2BG9B 1VALA 5EP9A 5K0UC 2Y6XA 2WFF3 3ZPV1 1LHOA 1HCIA 3CWZB 3VKMA 2EICA 4CN1A 2PFWA 5DUVA 2JQKA 3FJSA 4DXSA 3OCPA 4KG0A 2V73A 3ORJA 1SUMB 1WMEA 4Y1VA 4IE0A 2WBLA 4UI9B 4DRRA 3MLLA 3VUOA 1HQNA 2LXHC 3CU7A 2HWD1 2KT9A 1UPSA 4NUVA 2GAUA 5JMCA 2FDKA 2BVLA 3IA3A 3WG1A 1CHUA 3C51A 2YY1A 2CONA 4Q8KA 1SA0E 3GHMA 5JIUA 2XJUA 5G04B 5LRSA 1US3A 2VW1A 2GN7A 5CFCB 5JAXA 4RN5A 3IKWA 4A56A 2MEV3 5LA6E 2W95A 2XAGB 3LK42 4FI9A 2VTXA 2YC0A 4WM8B 5ABJC 1XNCA 1O5UA 4YGCA 1VBE3 3MUY1 1H8VA 5A6ZA 1RUE2 2XQXA 2V7MA 3VZKA 1COV2 4AF9A 2GN3A 1EZ3A 1AYM1 2QYWA 2YYRA 4DRVA 1NCQB 4YLHA 5FP4A 3BOPA 1RJ7A 2W92A 2XAHB 4YGDA 1DLCA 2R0FA 2CWMA 4E4SA 2FJEA 3ZXDA 4LF8T 3PUXF 3NMBA 3ES1A 4C1WA 2VH9A 5FZBA 2HWB2 5AQIB 2YG0A 2W47A 2R0HA 4I0BA 4AZZA 4O4JE 2XMLA 4NROA 4Z07A 4ZI2D 3OYXA 1FMD1 5FY0A 4MGKE 3O1UA 1HIXA 1OLMA 3SITA 2B5HA 2VKHA 5J96B 1DYKA 2UY9A 5GZFA 1VJ2A 3K4AA 3EABA 3CO2A 4KWUA 1YQ2A 4TYSA 1WMXA 4BMBA 4AVBA 5FKYA 1HRV1 1DQ2A 1N1VA 4NAOA 4CDQA 4JEUB 2RMU3 4DOUA 1NXD1 2G19A 2LRPA 1X4IA 1CPNA 1WMFA 1W6PA 4WZCA 2H3RA 4PK6A 5LA0A 1MPXA 4Q4W3 4MGQA 3RC8A 1H7CA 4ILBA 1B7TA 4QGNA 2EA6A 5F8PA 2Y6LA 4OFGA 4YPJA 1W9FA 3PHMA 1UOJA 2XBO2 3UQ4A 3ILFA 2PFVA 2KGGA 1JUIA 4A7KA 3OG2A 1JNZA 3ZMNA 4ZZCA 5L9VA 3APBA 2VVDA 4LBKA 4M3CA 3N2KE 1QNWA 2HBTA 3ZKYA 3PLQA 5DDJ2 2V09A 3SOUA 2P9BA 2WL1A 5ABEA 2ZX2A 4FPKA 1V70A 4XXPA 3VGIA 2XONA 1IPJA 1FV2A 2DVDA 5C71A 1IS5A 4QDRA 3MBWA 1N1TA 1PK6B 1OEDA 1DIWA 1SHZC 1UY3A 4PQQA 1UZ0A 3E5QA 2GH2A 3L39A 4YY3T 5JMOA 3S0MA 1LESA 1KNPA 5DN2A 1Y01A 3OY8B 2BKNA 3AMPA 1POV1 4YW3A 5A7WA 2RP4A 4YW5A 1KGYA 3OJAA 4M4RA 4XI1A 2PN5A 3J9SA 1ZZ6A 1QH7A 2UWAA 4WV8A 5H6RB 4BIOA 3LDRA 3VDAA 4B29A 4HFSA 3OGRA 1Q3EA 3VDBA 3Q5XA 4X1IE 3KHBA 3NV3A 1QWRA 5LGUB 4AYCB 3NNGA 2AH2A 4QXCA 1D1BA 3P4RA 2F4LA 5DG2A 5LBFA 3MHSA 5E8AA 1HX8A 2K17A 2QQPA 4OHFA 1UXXX 2OLTA 1QY4A 2GMEA 5TSWA 4XUQA 2PLV2 3LPGA 1IG3A 2G1MA 3WI3A 4H9RC 1F62A 2D9DA 4H7LA 1Z60A 1W6NA 5ABGA 2ZX4A 1SHWB 2X0YA 4RGAA 1SMVA 2WZIA 1WRDA 3FBMA 5JDHA 5E16A 4XOGA 3WAKA 2C4XA 2QE3A 3GYDA 3AC0A 3POJA 1WW6A 4P9JA 3H7JA 4HFVA 2WQ8A 1CAXB 3P5BA 3ZM8A 4B4PA 4AKIA 5A33A 1W0NA 1AR73 4HWFA 3SKVA 1TVGA 3CPZA 3UUXB 2PHLA 2J1RA 2EHOD 2LRKA 1J59A 2ES0A 3VD3A 2QFEA 2E9XD 1O5LA 1Q8PA 2VQTA 2VL0A 2Y1NA 4AR2A 4BM8A 3AXJA 2ATFA 2JM3A 3SHBA 1BKZA 2Q8CA 1F35A 2ID4A 5LW9A 3ZCJA 4QD2A 5I0RA 3ZMUB 2DWGA 2Q8EA 2VXRA 5FMOL 3TLWA 3ZMOA 3ZFGB 4S2FA 4FJCA 4X20E 5FMBA 5LB6A 4ZI7E 3RWKX 2DX8A 2E7QA 1XJAA 1ULPA 2P17A 5IAXA 3FZMB 1GZTA 4DY5A 2X5IA 4LQRA 2WAAA 1ASJ2 4XHXA 4YTPA 4PDWA 2E5VA 4TXWA 5E88A 1ZBA2 4OQ9A 3OGVA 2F6JA 2JKBA 4LORA 1NLSA 2I0MA 2ZGSA 1MS1A 5EHDA 3ZYBA 1UUSA 2WZ8A 4MADA 3H1YA 2WS93 2YQLA 3AYAA 1ZBDB 4I0AA 3LSEA 5B4NA 4DIQA 4COVA 5IJRA 3C7OA 5BNNC 3K4ZA 3J8F1 2D3RA 4UWDA 4WVZA 5JR9A 3J7HA 5FZEA 3THDA 1XDPA 3C64A 3DUIA 3Q5WA 3T6RA 1R082 3B3QE 5DG1A 4R4XA 5LBMA 2DBNA 1D4VB 2CKLA 3LCPA 4AI2A 4PFPA 3RQ0A 1H4GA 4XDQA 4NHLA 2Q30A 1D2SA 1MIYA 4QPGC 5C4WC 5AIUA 5A32A 1PVC2 5JOWA 3KB5A 4FVVA 4IV1A 3O1OA 5IVEA 2YSJA 4DR7T 2FMDA 5LHHB 4U7IA 4NXNT 3GZEA 2XH6A 1FMWA 2PAEA 5LB7B 4K0UA 5E6HA 1E1HB 4LO8A 2K4DA 1RMU2 4CEYA 4N43C 1W9RA 4QX2A 1HLCA 1RHI2 4RR3A 5FY4A 3OYWA 3E6CC 3RKGA 2WFF1 5TAOA 2C0SA 5SVXA 4OHVA 4NVPA 4BCUA 2YW8A 2HPLA 4GXLA 4AQFC 2M6IA 2BQPA 3T0AA 1QLBA 2W2IA 3K3OA 4NHYA 2GSYA 4AFBA 3HNYM 3N7LA 4HPKB 5JWPA 4QH5A 4XETA 5E89A 4LBQA 2YDQA 1CQ9A 4YATA 1NA1C 2QDRA 4JGZB 5CG9A 2V5DA 1E7PA 4YG3A 4S2GA 3U4SA 2XOZA 1MZFA 1GV9A 1CWPA 3VZOA 1V6OA 2OV9A 1JOPA 5FZHA 2MEV1 2CPTA 5FPZA 5ACA2 1YQCA 4S3OB 2BBJA 5FP7A 1D1AA 2W00A 2RS53 4QM8A 4ZHNA 2NYYA 1DVPA 5HPOA 4DBQA 4XCAA 1M7KA 1VBE1 4Q4X3 3P50A 4UFHA 4QPWA 1MZEA 2YINA 2ZAHA 4LF6T 1BVVA 3MHHA 2R063 5FQ0B 5TDRA 3USUA 4OZOA 5FZOA 5F6LB 2CRRA 1H9WA 3LAGA 2WNOA 4I0WB 5DZGA 3IHRA 1ODNA 2WKKA 5CFDC 1F9KA 1YKHB 2LM3A 2BVMA 3NV4A 1E5RA 3Q1DA 2XL9A 5I0DA 1LEDA 4FPEA 1X7NA 2OZJA 3K3QC 5IYYA 5H1UA 3ETVA 2R043 3R6NA 1K3IA 4GJZA 3KGZA 5B8DA 5LA9A 3D3AA 1QJX2 3NZQA 3OBTA 4A97A 2ZX3A 3OPZA 3K4DA 2ILMA 4K8FA 3AJZA 3Q9OA 3VL8A 3UU8A 3K51A 2AZ5A 2ZS6B 3SQOA 4BMEA 2W52A 4N3WA 3L2HA 1W2OA 4MGIE 4XF3A 2MOZA 5D8AB 1QKQA 2RMU1 1PX3A 2A73B 2Z5WA 2QQMA 5AQKB 4Q4W1 2W63A 4IC2A 1OT5A 4L8QA 3CQGB 4MXVA 2RA1A 3A21A 2BS2A 3PUQA 2IXKA 4J1WA 4IEZA 3VK6A 4B3RT 5FZ8A 1HW5A 5GJ6A 1RUF2 3IIAA 3VDCA 4TV9E 1GU3A 4QAWA 4IT4A 1WGMA 5IWAT 5IT6A 1XMOT 2P6CA 1YI9A 1G9CA 2YHJA 4YBTA 3OPTA 1KS4A 3I2FA 4CPBD 1YQ3A 2ZABA 2CMRA 3BK9A 3FC0A 2XM2A 4HN0A 5LJNA 3LJUX 4CU8A 4LO7A 2WFPA 1QQP1 3GCWA 3B01A 3T2QA 3GN5A 3M4FA 1B35A 2LSYA 1PO11 4O4IE 3FAOA 2H89A 4IDQA 3WX5A 2VZOA 3IBMA 1R1A3 3D4KA 2Q9QD 2QQOA 1HV0A 3C5KA 4PFOA 4UYBA 1S0CA 4I02A 5I0UA 3RTRB 4Z0OA 4BLIA 5K0UA 4TLFA 1QMJA 1Y7BA 4JI8T 1BVP1 1UK5A 3EUHA 1AF9A 4YVWC 2YUEA 2WUHA 1OWAA 4EN7B 2B7YA 5L3GB 4YGEA 4YSYA 3RKOA 1W2TA 5LK7B 4UVAB 1EAH3 2FDIA 3R4DB 3FXEB 4PIYA 5H6QB 2XJPA 4HKAA 2JDKA 3HQUA 2YC4A 3JUEA 1L0VA 4AVSA 1JS9A 5FREA 1ZZCA 4TWFA 4E7SA 3LD8A 4CTEA 2HN2A 1V6JA 5FP9A 1BMV1 5ABJA 5C8CC 3VHPA 2VNFA 2Z79A 5F3GA 3ZFFB 4QX5A 4UBHA 2KXLA 3OKQA 1GFF2 3RMXA 1RUE3 4MHUA 3U07A 4NHMA 2LLYA 4XTPA 4DMWA 3I59A 4XC9A 5LYJE 1OLQA 2HWC3 1COV3 1YRZA 5DAQA 5GALA 1HB2A 1SE7A 4Y24A 4HVQA 1BYHA 3KHCA 1BHGA 1C5IA 1AR71 2C9KA 2VMHA 3RRWA 1GKBA 2XJTA 4TWTA 5DMYA 2UUBT 4EN6B 1MACA 2WC2A 2ZZQA 5M0TA 2XOCA 3I7DA 2E9QA 1K5JA 3VZNA 4QB6A 1NG0A 4CU7A 3IHPA 1OH4A 1PZ8A 5CISA 1YCIA 3M63A 1NCQC 5LKZA 3PJQA 4CDWB 4PHZA 1HG2A 4A42A 4CN4A 2YBSA 3ZYJB 5A3OA 4Q26A 3H3MA 1QIQA 3F95A 4CI2B 1UX4A 5CIRA 4UELA 2WNUC 4U33A 4UFMA 1NCRC 3M65A 2DU1A 2WS3A 1W09A 2W5FA 4UF0B 1GBGA 3U10A 3BYWA 1I5ZA 3M1HA 4OZXA 1DQ4A 1L7QA 5FBJA 5KR7A 1GNHA 4AL9A 2KD7A 4TX5A 4OYJA 3TYJA 5JVVA 2LN0A 3FUQA 2DCKA 3VHNA 3O9XA 3M62A 2DCFA 1RUI2 1KXGA 1UD1A 2NW8A 1YFYA 2WS91 4G2AA 3VKGA 5C8YE 2NW9A 2X9WA 4QDQA 1BZWA 5H1TA 4V2WA 2JWPA 2HWE2 4GNDA 3RGBA 3CJIC 2KR4A 1V6IA 3TOJA 1WEEA 4Y3OA 2RR12 3HQXA 1O91A 2EAAA 3EB5A 4LTAA 2FJDA 3UUBA 3GM8A 1G9FA 4LE4A 2ORZA 5IK8A 1W0BA 3LOBA 3T2TA 3ZSTA 4LITA 2PHFA 4ZS3A 5C7GA 5FPAA 3EJKA 5DDJ3 4OHYA 4I3PA 2ECVA 1JHJA 2IW5B 5F6KA 5C3RA 3AKPA 1KNRA 3WW4A 1A3KA 4FPFA 1O7FA 4ES9A 1WR0A 1WEPA 1YC61 4PBPA 3BVCA 4Y26A 5EJZB 4JGYB 3BKZA 5FUNA 4N53B 4MHCA 4CU9A 3AJYA 2YBKA 3ECQA 2ZHLA 4YHJA 4AI3A 4DV5T 4X66T 4FOYA 1GNYA 4E7ZA 1SBEA 2XASB 3VV1A 2DNXA 1N36T 4RGKA 1A8MA 5J09A 1SFPA 3MZHA 3S7IA 4I50E 2MUMA 1NZIA 3Q8AA 3SKJE 5AC92 3H9AA 3J7MA 2ZOEB 5T5JA 2J4GA 2LEHA 1WUVA 2VKJA 2RS51 2N9DA 1AR82 1HN0A 3SCFA 3HCUA 3OBVE 3CLPA 4Q4X1 4AISA 2MNZA 2GP3A 4HFCA 4CCMA 2R061 3ZXGA 4OUSA 2PLV3 4JKMA 4AKLA 2ES3A 5IK5A 3ZDSA 3IF8B 3KT4A 3OD4A 1IQAA 1Z6UA 4UAPA 3OBAA 4MUVA 1W99A 4JX0A 5G05L 5JSRA 2M6MA 5J3XA 3RYHE 3P8CD 5LG3A 2WNEA 3OPCA 4M3CE 4WZ2A 4B7KA 4GNEA 1NLRA 3RPUA 1CAVB 1A6CA 1QOSA 4PIZA 4QQOA 2DSMA 1W0PA 3CDZB 4U3CA 3FE5A 2R041 3ZJ1A 1LAJA 1AYN2 3AA7B 4XF0A 4WNKA 3I2OA 2GC0A 4LFCT 5D2AA 1FJGT 1U4QA 1S4CA 2YXSA 4URAA 4A44A 2CL2A 2X68A 2WINB 3MW3A 2PHWA 1IQDC 3OBZA 4XZPA 5KHHA 2E7AA 1XBFA 3BQKA 3HBKA 4RS5C 2Q1MA 2AE9A 1MIVA 4OFZA 1LU1A 2UUCT 3I0OA 5FO8B 5T5LA 3R84B 3SH4A 2BGPA 1R64A 3WXPA 3QOFA 2HEYF 2XHKA 4G3YC 2BBHA 1JYNA 5A7QA 4XMAA 5LXTE 2GC3A 5IWFA 1RL3A 3CQXC 3TKLB 2L9QA 1ZBA3 5T5OA 1CJPA 4IXLA 2EIBA 3U0ZA 2XQAA 4LLFA 2DFCA 1GZWA 2FBEA 4HANA 4Z0RA 1W04A 4I0UA 4AGVA 3SCGA 4C1XA 3AZWA 4LK9A 3CQCB 2CLYB 4AXOA 4FFIA 3M7AA 3RC3A 5BNNA 5FY7A 1QJU2 1FP0A 3JAFA 5T52A 4I7CA 1LGNA 5C3SA 2VUDA 4OI0A 3DWDA 1F15A 5HWXA 3WP4A 2XPKA 2D44A 2UU9T 2K24A 4ZHQE 4QPGA 4DNYA 5C4WA 2X05A 1O4TA 2WSVA 4L2NA 4DUXA 1PVC3 3MKDA 4HMZA 5LMUT 3JXSA 1X8EA 3M70A 1DYPA 2BV4A 2Q8OA 5F5QA 5DZEA 4KG8A 1SACA 1R1A1 4N43A 3UU6A 4YAXA 1UZWA 1RMU3 1TNFA 1H1MA 2W39A 3HN1A 2FUUA 3LBXA 2KGIA 5JZGB 1RHI3 3VBHC 2JMKA 5JUVA 3QOPA 3I1AA 1K2FA 5EQUA 3RWNA 2PBIA 1I6XA 1AL0G 1HQWA 4D69A 4LHNA 4AQFA 3ZPYA 2PUYA 4LIVA 3I2HA 1XNDA 1JZ4A 1X79A 1ND3C 3TLVA 5AQFB 1NZCA 3IAQA 2VL8A 3C50A 3V0AA 4MXWB 1NA1A 4JKKA 2F17A 3S5AA 1EAH1 1LNSA 4GD4A 4Z1VA 3ZTGA 3M8LA 1O3XA 1VIWB 1K45A 3LZZA 4F83A 3I4IA 1SCSA 4A7ZA 1YWKA 5H9RA 3JZVA 5H9MA 4P9GA 1HYJA 2OYZA 3M3QA 5BY5A 5C6CA 2XHNA 5FWEA 2P4EA 3A7QA 5FXXA 5ACA3 4BQWA 5JLVA 2HYXA 1VRH2 4OUEA 4OGEA 5L3BB 3DN7A 4JRLA 1OURA 3CL1A 4MG2A 3QBQA 3VZJA 2ECTA 2UWBA 1XNAA 3HTKC 3MPPG 1V0AA 1F31A 2HWC1 1COV1 4S3OC 1VBA3 2KU3A 4GIWA 3NNFA 2XVKA 2YDEA 1P8JA 5FZ4A 3J7Yq 4E9KA 3O4XE 5CFDA 4XJ9A 2R6QA 2VCBA 2BWAA 2WRAA 4CU6A 3FZ3A 1IJ6A 2P3IA 1OOPB 3N36A 3HMYA 4XQDA 4YVSB 3H8XA 2GZWA 3VBRC 4V3KC 2NMOA 2QTWB 3DYMA 2DYCA 3BCWA 4PLNA 2CCQA 1J3QA 2VP7A 1ZREA 1QJX3 1ND2B 2F6BA 5F2WA 1MS8A 4N90A 5FMCA 1BR2A 3M2MA 4Q5OA 3RYIE 1O4YA 2M13A 1ULDA 4XYXA 4YWAA 2XKPA 4AVCA 2EA7A 4ONUA 5KH7A 2MAWA 3PU8A 3A4UA 4OI1A 2BG9E 3WQ1A 2VPDA 1HTJF 3T2PA 1SBDA 4I7DA 2LRLA 4XILA 1H8TC 5BXXA 4HK9A 1BBT2 4R8HA 5C33A 5APAA 4OULA 3VD9A 3H3ZA 3SFDA 3JC6D 1Z0PA 4A6OA 2X8KA 5HXMA 5FBZA 1ZHCA 2M85A 4MH0E 5AVAA 4QPIC 4AGRA 1ST8A 5FYMA 4YW7A 4CP9B 1RUF3 3ATGA 3RMYA 4A2UA 1GQHA 1TME1 5KC5A 4YG0A 3FL7A 3MYXA 3WVJA 4DFSA 1NY71 2XOYA 1M4WA 4H9NC 1SFNA 4O2BE 5DDJ1 4LO4B 1HRV2 3ACLA 2JD9A 2XJQA 2HN1A 2RDQA 4KHPT 1DFQA 1CIYA 3MUZ1 1XYNA 3AB3B 1WW5A 1F4AA 2Y6HA 1QJFA 2WR9A 1CESA 3DEMA 2KWOA 1SZBA 1AXYA 3PJAJ 4GWJA 1J5WA 2VASA 4RQPC 3TAYA 1HKDA 2RSDA 1WA4A 3ZYPA 1S0EA 4RGGA 2P5BA 2XTLA 5JRCA 3MF9A 5FP8A 2LE8A 4GB0A 1XZYA 4YVWA 1JOBA 3CX6B 2UXXB 5JG6A 4EAHA 5C2TA 1GLHA 3LEKA 4Z8BA 3J9X1 4Q29A 3VD4A 2XAQB 5T5PA 3KMHA 4V1Av 2VO5A 5A7OA 3VBUC 3LQIA 1OI6A 4B3ST 5IVYA 3WR0A 4Q0QA 5L4EA 5L47A 2BNOA 4XDOA 4DV1T 2YHOA 3LDBA 2VGDA 4GULA 4L11A 3O5SA 5A3UA 5C8CA 4GWNA 3FUOA 1OXZA 1IKQA 2W61A 3T7LA 1GP5A 2NM1A 3DKWA 2DCYA 1W3VA 1NQDA 3RZZA 4EOZB 1DZTA 5B78A 2KYUA 3PIGA 1W6QA 5F3JA 3E6DA 2H88A 5J2TE 1W9SA 2DVAA 2UWCA 2VQET 3EVYA 4O65A 4LFAT 2J22A 4A0CD 4Q0UA 1T8BA 4HZFA 3WD5A 1I5PA 4QX3A 3IEEA 3RH3A 4HG6B 1O3QA 1RIRA 4DXZA 3VKOA 3RNSA 3PURA 1R091 1W9YA 4QX7A 3OSDA 4EYUA 2GDFA 3PLWA 4F3JA 1NCQA 4AAXA 1Q56A 2W2UA 5FYTA 1WENA 2CM0A 1UMIA 5LMNT 3HR0A 4X1KE 2Y0IA 1JOCA 4P09A 2Q8DA 4IEPA 4IL7A 2J1EA 1BK0A 3RI5A 4NWWA 1UMZA 4ATFA 2WNUA 1S35A 4BQ4A 1NCRA 3RDIA 4JTNA 4QB1A 5JR2A 3C4ZA 3OGJA 5ABFA 1OXCA 2BP6A 1SPPA 1HYIA 5D21A 2YDRA 1CAUA 4ASLA 1ZBA1 4BHPA 3MO4A 3LK3B 2D6NA 3RJRA 3I0QA 2EGMA 3FLTA 1I94T 2XAFB 1UYXA 2YYOA 1RUI3 2WZR3 4JI1T 2R073 2HDPA 5FP3A 5A1AA 1GZ9A 1LOAA 3AA1B 1UOGA 3JAEA 4AWDA 1W3XA 3QCWA 2VL4A 3QH7A 2EXUA 1TZOA 4XIKA 1MIWA 4HVRA 4ISSA 3CJIA 5FIXA 4KHZF 4PJLA 4FCAA 4ZDTA 2P37A 2UYBA 2QCSB 3UV9A 4YSXA 4QHBA 4NPMA 1UW8A 2RR13 4DEVA 4YW1A 1LVKA 3OTOT 4NHKA 5FRAA 1W6OA 1PVC1 4JI5T 4UBGA 4CP0A 1XOYA 4QX8A 5CA0E 2JQHA 1X50A 2O8QA 4QKFA 3A0NA 3INAA 2WLQA 4C91A 4XDPA 1YEWA 2VJFB 4YC9A 5JPNB 4NN2A 3GBGA 4A6SA 2EODA 4L0RA 4EZHA 1NEKA 1U5PA 4Q0SA 1AJOA 5BR8T 5HCMA 4JTOA 2BEOA 2O0OA 1RHI1 2CRBA 3ETUA 3ZVYA 3AA6B 4G9SB 3VBSB 5HAXA 4K7JA 1WR6A 1X9BA 3E1F1 4N9HA 1DCQA 5LCWL 2ARBA 1UXZA 4PW8A 2BKOA 3GXUA 1ZV4X 4Y20B 1W03A 1D4M2 5DAPA 3B13A 1MQTB 1AX2A 5ADXL 1DGRN 4KGGA 3H37A 1N1SA 4ET7A 1LOCA 4N53C 2F6NA 3AMMA 1UX6A 3OY8A 2XSAA 5J7MA 4TV8E 2RR4A 3RZJA 1CX1A 3VRAA 2NTYA 5FYUA 2L3LA 4TKPB 3UU5A 2M67A 1H6YA 5M4YA 1MMDA 4HWDA 3WDVA 3UL2A 1J5ET 4K40A 3FZLB 5D1KB 1CHCA 3MV11 3FFZA 1GWKA 4GNGA 5FPLA 5AQUB 1AR83 4JDMA 2WFF2 5DQVA 2JICA 2GMMA 2BKPA 2CY6A 3F57A 2VE1A 3AVRA 5TRBA 3O7AA 3THPA 4Y1XA 3GGLA 5KHJA 4IREA 3LG7A 1VBA1 3RHWA 1IPSA 3VBOC 2ECIA 1JYCA 4QX0A 4QHOA 3ABZA 3CKHA 4OI4A 1O3TA 2HEWF 1ENRA 4O61A 4H9SE 4XAXB 2YK0A 1OF4A 2QQJA 2ZHMA 5FZ9A 2DURA 3RZGA 3ME2A 3AEFA 4J2CA 1JODA 4ADZA 1DQ0A 2IZWA 4CXWA 1ZX5A 4CA9A 3WNLA 2MEV2 2TUNA 1AYN3 1W39A 3W21A 1W05A 5B4XA 1FPN3 2DUQA 4GA9A 3USSA 1SDWA 2CHHA 2L0BA 5AQVB 1QJX1 3PU3A 3L11A 1MMGA 4F8AA 4FAGA 3PUGA 4RS5A 5FZ1A 5GLVA 2A3YA 2NTXA 1C8NA 2FHRA 4P02B 2H7VC 5FZIA 5A3WA 5K7PA 4AKHA 1EUUA 1VMHA 2V6YA 3PUIA 3CF6E 5LZ6A 2D5UA 4QM9A 1QJY3 3M99A 2JIJA 1IZNB 4SLIA 2WDRA 5CU1A 1OHFA 4HL0A 3UJOA 2JXAA 2DL1A 4JRAA 3OB8A 3CK6A 2K9ZA 5JVDE 3ZT7A 2Y38A 1UZZA 2EHOB 2ADDA 4NN0A 2E9XB 1RUNA 2BDRA 5D1IA 3PTYA 3VKHA 5C3JA 4Q4V3 3ES4A 1RUF1 1GQEA 4Y33A 4QWNB 4PNIA 2ZPXA 4V1PA 1QJU3 3WQ7A 1ZZ8A 5FYSA 1IGOA 3N7MA 3AE7A 1KNZA 1D0HA 2PG8A 2ORXA 1G9BA 3LA2A 1V6KA 3Q8FA 4BQ1A 3H0OA 4DUYT 4DY3A 3O36A 2J47A 5ABHA 1VCSA 4TNWA 2PNXA 1XNKA 2JQ9A 5FVKA 5L7OB 3TNPB 5ANQA 4B3MT 3T9KA 1BLZA 4YLZA 1NT0A 5FVLA 1X9TA 3SH5A 4JZRA 4FPJA 3AE6A 2BBVA 2FBWA 3UQ7A 3UUMA 4KWLA 2XKOA 4QGMA 3OUHA 2K16A 2OXQC 2ZKLA 1DHKB 3VBHA 3JBG2 1MM3A 3D0JA 1F8VA 4UP0A 4ZS2A 4H3WA 4HWIB 3RPQA 1OF3A 3U75A 5BNQA 2ZGTA 2KKYA 2Z69A 5C9AB 4K1ZA 4MLOA 3GZTB 1T72A 1ND3A 3POEA 3KCXA 3IPVB 1Y9GA 5AQGB 1JW6A 3WNKA 4GAZA 3N9MA 5CKNA 5FR3A 1OD5A 1KFUL 4OVEA 4XACA 4HKLA 3AE9A 4XW3A 4XZCA 4NE9A 4AEKA 1O3RA 1QQP2 3O1TA 5F5AA 2YEVC 3T09A 1PO12 1U5IA 1W0AA 2D6PA 2XLAA 2CAUA 4R9BA 3VL9A 2J1VA 1D1CA 1KK7A 3AMNA 4BJMA 5SVIA 2B42B 2KWKA 3UYJA 2FUIA 4CXYA 4KP3C 4YFWA 2WO2A 2H6CA 4Z91A 3ST7A 4MGSA 1AJ3A 1YQ5A 5T54A 3LGRA 1VRH3 2X09A 3U3IA 1D0XA 4TWHA 3B94A 4IQPA 1H30A 1S2EA 1ZRIA 1MNEA 1OMIA 2JIWA 5H9SA 2P3YA 2E31A 4XHBA 4BDVB 1WD4A 5JOXA 3HKEE 4UW6A 4IESA 1W0OA 5FQ0A 5HCJA 1J58A 2OXBA 2CRWA 3Q9DA 3LIHA 2MA6A 2VNRA 3RRCA 2CAVA 1QUUA 3VBRA 5FL1A 4WVMB 5EJ3A 4Z90A 2QICA 1HN1A 1W9TA 2VVEA 2YOEA 4LK7A 1WEMA 5LWBA 4K3UA 3CHXA 3DF0A 2G9FA 1ULEA 5JDLA 4Y4RA 1AZDA 4WM7C 2YVRA 1ENXA 3UTKA 3ESLA 1MS9A 2CWSA 4LIUA 5FNVE 3PDQA 1WEUA 1W8OA 3L09A 1W8HA 5HXRA 4HK8A 4M01A 4WVVA 4AQGA 3PNAA 5IK7A 3J26N 3J4UH 3NWIA 1H8TA 3LEIA 2CHNA 4IEWA 2XAJB 1HV1A 1RUI1 1AX0A 2WZR1 2UYAA 1WCKA 2VKOA 1JTZX 2R071 3TEYA 1BBT3 1H9PA 2LALA 3T1HT 4FPYA 4E8DA 3ZIWA 4AI0A 3AA0B 2ZCWA 4GALA 1YUDA 3AP9A 2MIQA 4QPIA 3AP4A 2I50A 2RR11 2H0DA 1SLTA 1YFUA 2VMIA 2WWVA 3ZN5A 3RVHA 5CKQA 2GMPA 4HEAA 3RQWA 1PGW1 1DQ6A 4ZKTB 1W6PB 2W1WA 2ZX0A 2ZM6T 4FOWA 3WF2A 1HXS2 4MHRA 2BERA 3WCSA 3MZKB 1OD3A 4XQ4A 3ACIA 4IEOA 5IVVA 1RUD2 3POYA 1ZZ9A 3OBRA 3EO6A 4Y1YA 3RYCE 3LFIA 1T98A 3O33A 2JKXA 4ATEA 4KU7A 4M3CB 4N4FA 2CGOA 3AYDA 2CEAA 2IUWA 3O1MA 3A7MA 1K5MC 4A4BA 3ZLIA 4Y22A 4RQPA 5F5CA 5CVRA 3E5UA 4MV2A 4IEUA 2MD7B 2QQVA 4LPLA 1RUC2 1O8PA 1V6MA 3KV5A 1GOGA 2JRKA 5CZKA 5LJMA 1JBCA 2ZGKA 5ETWA 2ETEA 3OVUA 2WNVC 3U78A 3POFA 5LHIB 3VBFC 2VK9A 3NW4A 5A7WB 3X1DA 3VBUA 4DV0T 4B3TT 4UFKA 2OA2A 2JPFA 2KMFA 3DYOA 4WA6A 1WZXA 3FHNA 5JREA 2Q9QB 1Y4WA 4LEJA 1WLWA 4LUKA 2MYSA 4LHKA 3JQXA 2AYHA 5FPUA 3WP5A 4NIGA 4GNFA 4QXCB 4GYSA 4LBNA 3A22A 1VRBA 1IKPA 2HLEA 2RS11 4TWDA 2KA3A 2F4VT 2ODUA 3BI3A 2ZMAA 1Z7S2 3E2DA 5C3OA 1GSLA 3POIA 1UY1A 3HJRA 4I30A 1UY2A 5EIYB 2XQ7A 1AYN1 2V1DB 1W6NB 1PZ9A 4O64A 1QDOA 1FPN1 1UKGA 1ZZBA 2RS52 1LTEA 2RJLA 4P0AA 4HOOA 4ZZ5A 3AZVA 1CD3G 5FL0A 1LHVA 2VECA 4Q25A 5AVPA 3ZMSB 1VP6A 4HXCA 4XCBA 3GHNA 3GF6A 5EYAF 4LE3A 1IJ5A 3WV6A 5JDFA 3WUCA 5A33B 5FY5A 1ZVFA 3AMHA 1QJY1 3HNBM 5KXDA 4OX9T 3O47A 2ZGLA 2CSYA 2D6OX 2A1XA 3CIHA 3WAJA 1JNRA 1ULGA 3KV4A 2GK9A 4P00B 3U5MA 2DWKA 2C5JA 2R042 1W8ZA 4ZI3D 4GWIA 4ES8A 3AL5A 4W50A 3ENRA 2AREA 3V5SA 4DR2T 2VMEA 4EWAA 3H8RA 4CE8A 3O37A 4LBJA 2JDHA 1ZEEA 1VB2A 3I2JA 4U72A 1WW4A 3SWHA 1XNRT 4Q4V1 2J1TA 1ODMA 4D0QA 2W08A 4R9DA 5E0OA 1DGWX 5T55A 1MVQA 1QJU1 3EI0A 1AL21 1YYNA 2X5IB 3ZYHA 1APNA 3C3VA 4CI3B 1E5HA 1U12A 3IDBB 4UT5A 1HS7A 4IGOA 4PBOA 4QQ2A 2DVBA 4P1NA 2VUJA 3G7DA 4P9YA 3AB0A 5BNOC 4O8SA 3JD72 3SMHA 4ZI2C 4I09A 3CBNA 1XSQA 2BS3A 3ZCIA 4JI4T 1W8NA 3HIFA 2D6MA 4LBLA 5B77A 5JR9B 4AHWA 3KT7A 4XFAA 2LSKA 3T4VA 3ETPA 2BNNA 3MF6A 2CKLB 5LBEA 5A70A 4EEBA 1XE8A 5FXZA 1OSGA 2RI7A 4PTBA 1JHNA 2I6HA 3T0DA 4P5OB 4INDA 3GBWA 3HQRA 2EVXA 5A32B 3LQJA 4IV1B 4FJOA 1AJKA 3E0ZA 3V65A 3KZ4C 5BNPC 1N34T 4E2GA 1QJEA 5LP6E 1D4M3 4L9BA 1OLRA 1X33A 3RX6A 2R30A 3SHRA 4N53A 5JSPA 1VAMA 1F5JA 4IDNA 2G9GA 2PXJA 5HWYA 3ZKUA 4WBOA 4RR3B 4B8EA 3N3HA 1JZ8A 3LEMA 2QQLA 4Y5TA 5GKAC 2Y48B 4F1PA 4YM3A 1NWMX 5J3UA 5CADA 4AI8A 2XOMA 2GNBA 4ZPIA 1RVF3 5FUIA 3HWJA 3AP7A 3G06A 1U5XA 4N9IA 2CTVA 2WWJA 1VRH1 3KFWX 4UR9A 3MIGA 3PVOA 1CIWA 2IHR1 5AQNB 2D3PA 2YV8A 2RPAA 2J42A 3VBOA 3NJZA 3X29B 1MZ5A 2ZGMA 4LULA 4D7SA 3RGLA 1G9DA 5HI0A 2YDSA 4Q6FA 1WLXA 3AYEA 2YPJA 2JQQA 1EAH2 2R6GF 4NPLA 4PCRA 2W1UA 2P57A 5DQ0A 3UUNA 2HWF2 2W46A 1REFA 4P9WA 3DP7A 2XG3A 4A3XA 5DKAA 5LASA 4WZ0A 3C6WA 2YB7A 3NG2A 3NO8A 4IV3C 3IM0A 3USUB 5FZOB 4I4TE 4OUMA 3AFGA 1DP0A 2VWAA 4KBMB 5F2SA 4QQHA 2IC1A 3ZXLA 5FMDA 3Q5EA 4TZDA 5C5UA 4BK5A 3B69A 4TSVA 3A5XA 3VRBA 1DU3D 3HR9A 4AQYT 3BOWA 1T6GC 4I43B 1K42A 3N9NA 2HWC2 2I74A 1MS3A 4I2OA 4N7IA 4EE2A 3WDUA 4P5HA 3KVAA 5G0FA 4UV8B 2V72A 4CCKA 3B9CA 5I3LA 2A6VA 1QSDA 4ASMB 3WF3A 2CA5A 5A7SA 2ECJA 4AKRB 4BISA 2FCTA 1D0ZA 1BORA 1GP4A 2VPGA 3N7KA 4RFRB 1BBT1 1N3QA 3K46A 2LDRA 5KH9A 1PMHX 1IBKT 5FK7A 4KH9A 3S4UA 4A5XA 2PELA 3D5OA 4HTEA 2GALA 2CXDA 2W62A 3PUYF 4KI0F 2NR4A 1FAYA 4B1LA 3DGTA 4YTNA 3LOIA 2P3KA 2LQ6A 2QGSA 5GM0A 1WWYA 1Y3TA 3NRYA 1MNDA 4CUGA 4UI9L 3JB8A 3FZHB 2UZGA 2K46A 5LGTB 5HV4A 2LJLA 3TEXA 4E8CA 1VCTA 4YBSA 2PMWB 2ACXA 1ACCA 2EXKA 2I2SA 1CN1A 1WKYA 4KUMB 4AQ6A 1E4UA 2JEMA 5G04L 1LRZA 4H9PC 5CFBA 2P1BA 2ZJCA 4XF9A 2OW4A 2UXDT 1KDKA 1AXZA 2D5HA 5JOZA 1LOGA 4IIJE 4Z92B 1HB1A 1VBB3 4OCTA 3JBG3 4Z8XA 3ZMTB 1CUNA 2GU9A 1TME2 4DR1T 1NY72 2DV9A 1J83A 5L3DB 3D6EA 3ZC0A 4XJAA 2LGLA 1ZKEA 2FQPA 3GN5B 1B35B 3F2ZA 1WEWA 3ZMVB 4YM0A 1EY2A 3H3AA 4ZU7A 4W4ZA 2CDOA 1S0IA 1Z0HA 2QBXA 1S0JA 1VB4A 2JJ9A 2KWHA 1KQRA 3HKBE 2ZBJA 2OT7A 5D1MB 1QQP3 4GB32 4NRPA 5K0UB 4YJ2E 2VCCA 2QQUA 5HXHA 1Y64B 1UIJA 3GA8A 1PO13 4LF5T 1RC6A 1OUXA 4YSZA 5B2GB 2AR6A 2GC1A 5FB0A 3KCYA 1WBFA 4MXWA 4QQLA 1TNRA 3RZLA 2LOSA 1BK1A 2VTXJ 2X29A 4X5TA 5AQHB 4CCNA 3NAPB 2PHDA 3VKNA 2H7OA 2JG9C 4UIGA 4FO9A 1UO9A 3FJUB 1SCRA 4R4ZA 1DGLA 1IZ3A 2ZA9A 2XQYA 4D6QA 2VVNA 4K21A 4LF7T 3HAGA 5ABJB 1A34A 5C13A 3S7EA 5HXCA 1NYWA 2OA5A 5FO7B 3ZIXA 3N4MA 4DXRA 3GNEA 4DPNA 3I59B 4BJNA 4MFRA 3OF1A 1UWWA 4XBLA 4WM7A 2DCTA 3WNOA 1CAWA 4JV5T 1JZ3A 3NVCA 3UJQA 1YD8G 5IUXA 4FP2A 1REEA 4QXHA 1KEYA 2BTVC 3PUAA 3EHKA 4BBQA 1C1FA 3THCA 2VTFA 5EPAA 3ZDVA 2YMZA 3R4UA 3ANWA 1RUJ3 2VMGA 4J6GA 4A98A 4LF9T 2I45A 1UOFA 3GWHA 2W66A 1R092 4XVHA 3AK0A 4NRMA 2TNFA 4B86C 2EIGA 3MFAA 2VZPA 5C3PA 3BTZA 3FN9A 1K12A 4CSWA 4IC3A 1RITA 2W67A 2A6XA 2A2FX 3HKDE 4RL7A 4JLEA 2HH9A 1IS4A 1PGL1 3PVBB 2V4AA 3QACA 3ZFEC 4HN9A 1XDOA 2YT5A 5FZ7A 5DAVA 1HXS3 5GLTA 2RS33 4UOJA 2BW8A 1S94A 3NZPA 4CP9A 2JRJA 2WDQA 2VNVA 2K3WA 4YZ3A 5FZ3A 3UESA 2X51A 1RUD3 2NP9A 4CRQA 3IB3A 5KC6A 3TLTA 3H7YA 2DVGA 1J1JA 2IIUA 5HEOA 2G4IA 4XUNA 4COZA 4YZ4A 1K5MA 2ZEXA 4W4UA 4N78D 4LO6B 4D7TA 1D4M1 2NMNA 3FXDB 3RIFA 1N1YA 1NAEA 2VURA 2DTYA 3ZOIA 2ZM8A 4JDNA 5LKTA 2YZ4A 1N87A 3P3PA 1RUC3 1WYCA 2WNVA 2AENA 2A6ZA 2WO7A 4AVVA 4HGAA 3HOBA 1UKRA 3VBFA 5K4LA 2WZEA 2MTQA 3ZPOA 1PNGA 1RVF1 3WQ0A 2OS2A 2QDNA 4R7EA 4YZ1A 4PJMA 1ULCA 1VBD3 4R9AA 4DQAA 4KX6A 4MX3A 2MT5A 4URTA 2B9VA 2CNAA 2K5BB 1JYIA 1XPWA 2E51A 5CAZA 5FXWA 4D6SA 4AG4A 3C4WA 4XXAA 3H50A 4I7BA 4AE2A 3V0BA 4YJ3E 1ZA4A 4NIQA 4DZGA 5FZMA 4IL9A 2Q9QC 2VZRA 5L19A 3VDDC 4EEDA 2RV9A 5GLUA 3LVQE 2ENRA 2XJRA 1YIFA 1Z7S3 3KF3A 1D2QA 3DYPA 1NLQA 4R8PK 5A3NA 2QJVA 2XVLA 1QHDA 2C24A 2JDUA 5DABA 3I3DA 4BXFA 3HN3A 5LHGB 4BU2A 2PJQA 3KQRA 3WDXA 1C5HA 1SLLA 2PYTA 2YROA 4ISQA 4ZZ8A 4B3NA 4WBNE 1YW0A 1BR0A 2KWNA 3RYRA 1X4UA 1VBA2 4BQ2A 2X9XA 2GC2A 2MPFA 3CVRA 2W9XA 2P34A 4B7EA 2A3WA 1N32T 5GONE 3W5MA 3CMLA 4CDUC 1JM7A 1EP0A 3C7FA 4A45A 1VMFA 2CBJA 2VQFT 3FB2A 2ZGOA 4JBWF 5CNAA 2V7LA 5L9BA 3O1VA 2JIGA 2ECWA 4COYA 3V56A 1MR5A 3T8OA 3SXWA 1FOD3 4EN8B 2KIZA 1DLLA 2BUKA 3OGGA 3EMRA 4GJYA 2ZMLA 4U7YA 1YLLA 3AE1A 4OHXA 2R32A 4AHYA 3WNPA 1I3HA 5HEHA 2CSZA 3LSDA 2FZ2A 2WMOA 2L5UA 4QXBA 1UURA 4YW2A 4PT6A 4V3LC 5FV3A 1NOVA 5BNOA 3MLKA 1XSRA 2VJEA 3H1WA 3WUDA 2VY0A 3JD73 4DMVA 5F3CA 4GKJT 4AEDC 2VXJA 4NXMT 4H14A 4HE8A 5BNNB 3O34A 5KWRA 1XC6A 4X6RB 2LV9A 4E4DX 4UXNB 2E6RA 1YO8A 2MD8C 3H3UA 2CGNA 2XSBA 1VBB1 5CYYA 2WIIB 3JBG1 4S2HA 1IBMT 4QPGB 3RQUA 4L58A 1IOAA 5C4WB 5F5WA 2YFUA 1RXFA 4EV0A 3WQBA 3SUBA 5BNPA 2LGKA 3K2OA 3LDYA 1O8SA 2HKXA 2C5DA 4K8RB 3FLPA 4GZ9A 3RF1A 4AQSA 2OKXA 1J3RA 4V2VA 4PF5A 1LENA 2IAKA 3ZSLA 2VOKA 4ISRA 2ZXQA 1WFKA 5FOBB 3LBXB 2A71A 3AE5A 3WW2A 2HHHT 2HBUA 1JH5A 2VPVA 1ULOA 3EQEA 3MA9A 3NJYA 1OH3A 3LSVA 4NIHA 2Z42A 3LEGA 4UV9B 2EGPA 2M3HA 2C0ZA 3V0AB 3RI8A 1NA1B 5J37A 1S1AA 1NENA 5JXGA 3KF5A 2W0XA 3RZMA 1HNWT 2WU5A 2Y8KA 2PHUA 2D8SA 4XQWA 4OMCA 1WMDA 4YYOA 2BJSA 1XE0A 4ZUXU 2CT2A 4JYAT 2OX0A 5JIAA 1CZTA 1F5FA 2CV6A 2BG9C 3UU4A 5JDNA 2E2AA 1KJRA 5A7NA 3I49A 1PMIA 2VPEA 4HFDA 2K48A 5LATA 4DV2T 3C98B 3CNAA 2NOXA 3FANA 2HWF3 4UFLA 2DLRA 4IV3A 4WZ3B 2FCUA 3JADA 2LSJA 3QNUA 4HETA 4QT6A 4IGUA 2NZ9A 4XTMA 5AQJB 3POBA 4W6YA 2D8UA 3ZYRA 4JI2T 3S30A 2OQ7A 1G73A 1Y9QA 3I54A 2EIDA 1O4ZA 5DUUA 2EIEA 5I0SA 4HT1T 5CFDB 2X67A 4LBOA 1WLTA 4H55A 5L3FB 1UZYA 1WEOA 5CFCC 2ECGA 3SOWA 3W9AA 3BODA 5H9PA 1OC1A 1RUJ1 3K8PC 4WM8C 4IUGA 5LY1A 2A3DA 4LBMA 3VD5A 4M4PA 4EXTA 1ENSA 3UFGA 5AQOB 4LOTA 2V7KA 4D8MA 3SLIA 2VM9A 1HFAA 1YFXA 2JG8B 4X6QB 5KXBA 2QRXA 1SG3A 3EDVA 3OJBA 3ASLA 3KBTA 4JI7T 5JDBA 3UULA 5FPXA 1NAFA 4O9EA 4QHZA 2DDUA 2R1BA 4JVAA 4PJYA 3BTXA 4JEHB 4EYYR 3MXZA 3NQHA 5A1LA 4BB3A 3KS7A 1HXS1 2RS31 4X8PA 2VR4A 2G9ZA 2BFUS 5DZFA 3UT0A 4MVTA 1RUD1 2VZSA 2J1DG 2IDOB 2VU9A 1KD7A 3C7EA 2WZR2 4XJ8A 3UGHA 1DCSA 3F31A 2R072 3VKFC 3S57A 2UXBT 2EF6A 3L9JT 3B5MA 1W8UA 4I01A 4HLTA 3H3LA 3C7HA 3VB9A 2OVUA 2LT3A 2CSGA 2IXJA 5KDMC 1IG0A 4NIDA 2VPBA 1YHFA 4D94A 1EPWA 1PGW2 1TME3 2YPDA 4LKSA 1LODA 1RUC1 3DPLR 2ECNA 4KWKA 1VD4A 2WQZC 3B7MA 4U36A 5IATA 1LR5A 1BQPA 2QKDA 4CCJA 1N3PA 3RYKA 1UAIA 4HSLA 2QVSB 4P5YA 3HT1A 1T1HA 2A6YA 1QDCA 4K0KT 3IPVA 4GB33 4JCKA 3POWA 1VBD1 3I9WA 2AEYA 3CZUA 4D3WA 3MIHA 3MIDA 5JRCB 4EWEA 2J1AA 2G45A 4YVWB 4ILCA 4LBQD 4Q1PA 4COWA 3T3YA 1YIPA 1DQ1A 1PK6C 1W6MB 3BPSA 4FTEA 4Q27A 1H2LA 4FBFA 2XZEA 2JG9A 1HNZT 1OLME 5FY8A 1FBVA 4TUYE 5LRRA 2ZKNA 4PF1A 3N9PA 1IS3A 1Z7S1 2WO3A 4ARXA 1UCXA 4LFBT 4BK4A 1XYPA 5AQRB 4FPLA 5C8CB 3OGSA 1XNQT 1JU3A 4Y1UA 3ELNA 1U0AA 3NAPC 4AVTA 5TDWA 1IHMA 4PPEA 2XXZA 3I2GA 3K77A 3HEIA 2DTWA 2FMYA 3GMIA 4FXKB 4UXAA 4E4ZA 2QIZA 4CZZB 4LNVA 1W6QB 1MVEA 4EN9B 3NBXX 2QQKA 1X9PA 1GICA 5F32A 1TMF2 4K9SA 2KWIB 3OUIA 2V5YA 2PTFA 2VJXA 5DAWA 5IW0A 3FX3A 3MDBC 1VE0A 3BN6A 2RS12 5LOVE 2EXJA 4WVMA 2MBGA 4LMJA 3ZSKA 1AR62 3W20A 4QB2A 4QX7B 3N2OA 3B93A 3MPBA 4OGCA 1HG5A 4TN7A 5JI9A 3QB5A 3WNMA 3M3OA 1ZRFA 2VVFA 2R49A 3NNJA 1FPN2 3V43A 1FOD1 3RIAA 1QU0A 5L4HA 3KSCA 1OEDE 3GZAA 1UY0A 1R1ZA 1R093 2X9HA 2WNUB 2B45X 2N1GA 1NCRB 2KXPB 1OA3A 4BQ5A 5BYNA 1L7LA 5ABFB 3V64A 4HONA 2XQ6A 1SPPB 2YURA 1CAUB 1G7YA 2RDSA 1Q8VA 3WP3A 4BAYB 2ARAA 1LULA 4H9DA 5EK2A 1V9U3 3AMQA 3VR8A 4N7UA 2P3JA 2WB5A 1QJY2 1XE7A 4UW3A 1FT9A 4LXLA 3ZFEA 3E97A 5F1RA 2E63A 4IE7A 2KE1A 2EXIA 3JD71 3SOLA 1RTVA 2Q0AA 1S55A 2IMLA 4QKBA 1AHSA 3ZFGC 5AITA 2KFTA 3CJIB 4U2AA 5FZDA 1LDKC 1FATA 2VOXA 3ZNIA 4Q4V2 1AVBA 4A41A 3WF4A 4OK0A 5FZ6A 4UFJA 2PAMA 3WDTA 1KRIA 3AFKA 4YHHT 1W6OB 1AL22 1LHUA 2ZEZA 4Y4YA 1ZZ7A 2VMFA 4QX8B 1I9RA 1PIV3 3AZZA 3SRZA 3LWCA 3JC6C 2KINB 1WFDA 2QA7A 2A9UA 1CPMA 5FZFA 2VG9A 3MV01 2Y43A 1RYYA 4I3GA 3ROUA 2XQ9A 3KT1A 4ZONA 5IHYA 3WY6A 1SQ4A 3QK6A 4FXGB 1PVXA 2CWYA 3ZN0B 2FDJA 2W68A 5EK4A 2NN8A 4CPBA 2RM22 2WWUA 2X0LB 4ZOLE 2FDHA 2NLRA 2L43A 3JUUA 1V9DA 5EZWA 1S2KA 1W28A 1DZQA 3C7GA 2B4KA 1DG6A 2Q9QA 3VDDA 3I2DA 4YNIA 5FYCA 2DF7A 5AQPB 1CR7A 2JUNA 3MDPA 2ZZJA 2IC9A 2HWF1 1GUIA 3PHDA 2BZDA 3ZT5A 4PAGA 2WAOA 3GL6A 3HL6A 4AI1A 2LXPC 4BIFA 4BA9A 1C8M2 2B9UA 5FK8A 3MW4A 1HB4A 5JXJA 3BQLA 1KITA 4FT8A 2MKEA 5LKXA 4JGZC 5DINA 2NW7A 2O8OA 3AEEA 2KNDA 3BTAA 4IDPA 1S2BA 4DS0A 4EWDA 5BUVA 4BH9A 2Y6KA 4RHV2 1GOFA 2DBIA 2XUMA 1OUSA 1MM2A 4IW3A 1UYYA 1S0BA 1EYBA 1SFYA 4CI1B 1EUTA 2G6QA 2UU8A 4CDUA 2R7EB 3TEZA 1OA4A 3CKDA 2DU0A 4FQ4A 1VR3A 3AAAB 2VNGA 4XJWA 2L8KA 4QGLA 5GZGA 2W3JA 4AYUA 5K3QA 4Q4Y2 1JYWA 4RS5B 3S6PA 2AXDS 1W8WA 2AN6A 4EIWA 4XFBA 1JYTA 2R1DA 3WNXA 3VD7A 2D97A 1Y43B 2ZETC 2V6YB 4ISTA 5DQWA 4C0BA 2VQ0A 5B75A 2BAYA 1NE4A 1G8WA 2O14A 1HNXT 4NR1A 1PM7A 3T0BA 3MGUA 2LGGA 1C28A 4KNCA 4WZFA 4MSXA 3OYZA 4GH4B 4QQ4A 4HFEA 2WCAA 5IAVA 4QKDA 2JE8A 5F37A 3UGFA 3KVBA 3NRXA 2JMDA 4AEDA 2X10A 4YFSA 3IIIA 2LROA 2QUOA 2L9LA 4EROA 3DPRB 4FPCA 5LA2A 2LAUA 1BEV2 1WA6X 3AE4A 3UNPA 5C8WA 2XLFA 5D8AC 4G63A 1STMA 2JMHA 1WEVA 5FAXA 2IDAA 2WAUA 1A8DA 3O14A 3PMSA 2XWJB 5A6YA 4FOVA 4LK6A 3VZLA 3PV0F 4H9OC 5SV8A 2OIIA 4NIIA 2R16A 5FLHA 4YBMA 1UN1A 3FM8C 2RVAA 4L7XA 4DV6T 2W0GA 4ZXLA 1FX5A 3Q2MA 3IMMA 5T50A 5F9TA 5DAXA 2DUPA 2LKGA 3RFRA 4KMQA 4ANJA 3VBHB 2VVSA 1E2AA 4GB31 2BWCA 1ALYA 5FZAA 2M1RA 2EXHA 2ZGQA 4XAAA 1ZOYA 3CMGA 2E6VA 4FQZA 4ZXEA 1JN2P 4JQRA 3ZN6B 1ND3B 3PUZF 1LEMA 1PHMA 5FYYA 1H2NA 2KREA 3LQHA 2BOIA 3JCIA 3KCCA 1JZ5A 2MNYA 4EGWA 4DUZT 1CVNA 3U14A 1WIMA 1GYKA 2CU5A 4BZ4A 2WMNA 2Q4SA 1YI7A 5IUQA 1WGPA 3TWIA 3THTA 1D0GA 3AKRA 5SVIB 2BG9A 5GZEA 5EFUA 2SBAA 4YABA 3FBYA 4O2AE 2IUBA 2AUYA 2LW8A 4FSJA 5F3IA 3WZ1A 4ARYA 1E5IA 2VW2A 3VKLA 2FFWA 2AGSA 4B4RA 2A70A 3K1SA 1VMJA 4IGQA 4CQIA 2PHXA 1DF0A 3RZHA 1C3HA 4DR3T 3AXDA 4ZY9A 4WVWA 1DBNA 1HR0T 2ACZA 4CEWB 1VAKA 4NMIA 1MS5A 3E6BA 1QXPA 3B00A 4X1YE 4GMP0 3IMNA 4GKXA 4COUA 3ZMZB 2ADEA 4XBQA 2VKDA 2VUCA 4DR4T 3O35A 1DGWA 3IWZA 5FDBA 5CFCA 2ZX1A 3CEWA 2RE9A 1HF8A 2LRIC 3ZXJA 2K1JA 3VBRB 4WM8A 2X0HA 1T2XA 2N2NA 1HDKA 3ZFFC