3PUQA

Cekdm7a from c.elegans, complex with alpha-kg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
516
structure length
472
Chain Sequence
TPKESDRCGGCGKFTNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7 homolog
total genus 148
structure length 472
sequence length 516
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3puqA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3puqA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3puqA01
1WEVA 4HONA 2F6NA 3LDBA 2VP7A 4GNFA 5IWFA 3N9OA 3DQVR 2NAAA 4AVXA 5TBNA 5F32A 5FZ0A 3M63A 2YBSA 4WZ3B 5FP9A 4C8DA 2OXQC 2VJEB 2RI7A 3KV6A 5FYZA 2HDPA 3OPWA 4N4FA 5LCWB 5F5AA 3PURA 4CA1A 5FY1A 2P5BA 1BORA 4UP5A 5FEYA 2OX0A 2M3HA 2YREA 3SOUA 2K16A 3N9LA 2LV9A 3KNVA 5LKTA 5FZIA 4FK5A 5E6HA 5A7WB 4QX8A 1DVPA 2EODA 5LKZA 2W2IA 5FZ1A 5IVEA 2C2LA 2QJ0A 5LWBA 4WZ0A 3VK6A 2KYUA 5LY1A 3O37A 3KV9A 4DIQA 3N9PA 2JRJA 5H9MA 4UP0A 5FZOA 5FWJA 3PUQA 3ZVZB 4BBQA 5FZMA 4WA6A 2G45A 4PPEA 5FY0A 5G04B 4A0CD 2DX8A 5FZCA 3ASLA 2GP5A 2YUCA 3C5KA 4V3KC 2MT5A 4S3OC 1MM3A 2ECTA 4P5OB 2VJFB 2YHOA 2ECGA 2KWKA 3M99A 5D1LB 2M85A 5A7WA 2YSMA 3EB6A 2VPEA 3N9NA 5FY5A 1WENA 1F62A 5FP8A 4LADB 3KV5A 5C13A 3O33A 5A80A 4X3GA 5B8DA 4QXCA 3N9MA 3GL6A 2FUUA 2L5UA 3O70A 2L0BA 4V3LC 4CCMA 4LXLA 4XDOA 5F3EA 5FYVA 5ANQA 3NG2A 2M6MA 4BU2A 4IGPA 5FZ6A 4B86C 4YATA 5FZAA 4IC3A 4Y3OA 5A7PA 4XI1A 3U5PA 3GV4A 5F39A 2EGPA 2VPGA 3PU3A 5IW0A 5JG6A 3IHPA 1WEMA 1Z2QA 2KFTA 2I50A 5FY4A 1N87A 3HCTA 4GNDA 2MD8C 2CSZA 2H0DB 2YU2A 5FZDA 2Q8EA 1X4UA 3V43A 5F5CA 1WGMA 2CKLA 2YURA 3T6RA 2VD7A 4A4BA 3DXTA 2FSAA 1G25A 4QWNA 4AP4A 2WWUA 5IVYA 5B75A 1Z6UA 5ISLA 2PXJA 3RPGC 5FYIA 2QICA 3SHBA 5FXXA 1X4JA 3O7AA 4AUQB 3LD8A 5B77A 4R7EA 2K1JA 2HYED 1JM7A 3DXUA 4AYCB 4EZ4A 2F42A 4CCGX 1JOCA 1WEPA 2IDAA 4YBMA 2YYRA 5KH9A 5FY9A 4LITA 2CKLB 2KWJA 3MHHA 3K3OA 5FZ9A 5A7NA 5KR7A 2L43A 2XMLA 5FP7A 5IVJA 3PDQA 5D1MB 5FZ4A 2MA6A 5FZEA 4R2YA 5FB1A 2UZGA 4BXFA 5B79A 2LGKA 5A7OA 5J3XA 5FXZA 4E4HA 5FZ7A 5F3CA 1CHCA 3ZPVE 4URAA 2ECNA 3M62A 4QF3A 1FBVA 2YU1A 2JMDA 4GNEA 4V2WA 3ZPOA 5DKAA 4CSWA 4I7DA 2XUEA 3LQIA 2MA5A 1WFKA 5FUPA 3ZLIA 5F5IA 3PU8A 4YABA 4ZDTA 3KVBA 2GP3A 5A3TA 1K2FA 5A1LA 5FB0A 2M1RA 4NN2A 2MIQA 2G43A 3LQJA 5AITA 4QXBA 4FJCA 4WZ2A 5FZOB 3U4SA 2KGGA 5TABA 3ZPV1 3RTRB 2YPDA 5A3NA 2LGVA 1IYMA 1WEEA 3AL6A 5FPUA 2ECVA 4W4UA 4LIUA 5FYBA 2EA6A 4GB0A 4UF0B 2XEUA 2XXZA 5FZKA 2YBPA 4BHWA 5FP3A 4DO0A 4F52B 3U78A 4ZUXU 3FL2A 1WEOA 1XWHA 5F3GA 4L58A 4A49A 4GJYA 4XDPA 3U5MA 1X4IA 4GNGA 2KIZA 2G6QA 3L1XA 2YBKA 2MNZA 5TRBA 1WESA 5K4LA 4CCNA 5TDWA 2Q8DA 1Z60A 1RMDA 4I7BA 2VJEA 3O35A 4D6SA 2VPBA 4C9ZA 5FYYA 5H1VA 2E6RA 3U5OA 2QIZA 2OT7A 2VJFA 5AIUA 3O36A 4AAPA 3QZVA 2F6JA 4B7YC 4QX7A 2L80A 4FIPA 4UI9B 4YC9A 2YU4A 5H1TA 5LKXA 3ZYQA 5KH3A 2KWOA 2RSDA 5FWEA 2CT2A 4HOOA 4LLBA 4GJZA 2BAYA 4S3OB 2JMIA 3DPLR 2KR4A 3I2DA 5FYCA 4Y33A 1HYIA 3SOXA 2Q8CA 2E6SA 2Y1NA 4IGQA 1MM2A 1VYXA 5A7QA 4FO9A 3L1ZB 3HCUA 2C2VS 5A3PA 3LRQA 4GD4A 5H1UA 5CEHA 3MHSA 5FJKA 4LK9A 4CCKA 4EZHA 3AVRA 1VRBA 4V2VA 3OPTA 5FZLA 2VNFA 3ZNIA 2YQLA 2WWJA 4LIVA 1WIMA 2ECWA 2YQMA 5IVBA 2LXHC 3AVSA 4BISA 2JMJA 5FPAA 5G05B 5FY8A 5B76A 2KU3A 2OQ6A 5FZBA 2FUIA 5IVVA 5IVFA 2PUYA 5D1KB 3LQHA 5F2WA 5A1FA 4O64A 1V87A 3O34A 4YBSA 2XDVA 1VD4A 4LKAA 2LDRA 2LXPC 5LKUA 1JM7B 5FY7A 2Y43A 5LW9A 2L75A 5FPLA 3KV4A 2AN6A 2VPDA 4CCJA 5FXWA 3UYJA 5C11A 5FZFA 4TN7A 2LQ6A 3EB5A 5FZHA 1ZBDB 5FYHA 1E4UA 3NJYA 2ECJA 4NUBA 5FPBA 3PUAA 5FXVA 4GAZA 4YADA 2LRIC 2XB1A 4CCOA 1WEWA 5FP4A 2MUMA 2KREA 2MNYA 5TDRA 2KWNA 2ZETC 4IGOA 4PTBA 5KH7A 3C6WA 5FYSA 2PNXA 4ZQLA 2Y1MA 2H0DA 5FPVA 4R8PK 1T1HA 4MVTA 3HCSA 4Y4RA 2K17A 5LY2A 5FYTA 1LDJB 3ZVYA 4AI9A 3N9QA 5FYUA 2D8SA 4YBTA 3RVHA 2MD7B 1HYJA 3RPGB 5FZ3A 1WEQA 4QXHA 2YSJA 5FYMA 4L7XA 5B78A 4Q6FA 5FV3A 4MSXA 3T7LA 3PTRB 2YHNA 3PUSA 2LN0A 5F3IA 3L11A 3U5NA 5EYAF 4AYCA 3AL5A 4YAXA 4UF0A 3KQIA 5FZ8A 5FJHA 1FP0A 4EYUA 5G0FA 3K2OA 3PHDA 3SOWA 3KVAA 1U6GB 4I7CA 1WEUA 5F2SA 4CUGA 1WE9A 2K4DA 1VFYA 2OS2A 5FZGA 2KGIA 5A3WA 2KE1A 4TKPB 2ECIA 5DINA 2CSYA 3ZTGA 5FERA 4CCLA 4LJNA 1LDKC 4IC2A 5FUNA 5IVCA 4QF2A 5F37A 3K3NA 2YT5A 5A7SA 1WILA 2LGGA 4N3WA 4ASKA 4A4CA 2LGLA 3HTKC 5I3LA 4D6QA 2YW8A 4QU1A 5FBJA 4D6RA 2OQ7A
chains in the Genus database with same CATH superfamily
4HFVA 4QH4A 5CB4E 1YYNA 2CXLA 3AA7B 1UU5A 5JSOA 2O0OA 3MI8A 1U4QA 3KQ4B 3M3IA 1S2EA 2F6BA 3CZJA 5JIUA 5FEYA 3C8XA 5FAXA 5EV7A 3T3YA 3K3QC 1UQXA 5K9YA 2K46A 2GNMA 3E0ZA 3F57A 1VBE2 4Z07A 2C2LA 4MGKE 4A3ZA 2KYUA 1HXS3 2WFF1 3WCRA 4ZXLA 1Q8QA 2E32A 2CV6A 3D0JA 3OF1A 4BJMA 2MOZA 3WUCA 2GP5A 2SBAA 5F9TA 3SCGA 1SBDA 4I02A 2WS3A 4XCAA 2W0XA 2FJAA 4S2GA 4JVAA 4DPNA 5BMVE 1RUI1 1O4ZA 1Y4WA 2JG8B 2PHUA 1MVEA 4RR3B 4O2BE 1W04A 2ES3A 2P3KA 4A4AA 1HX8A 4CCDA 1MZFA 5A32A 5JMOA 2M6MA 5FOBB 2ZHNA 4HZFA 1SPPA 3KDSE 1ULEA 5HI0A 3T30A 4LFBT 5GALA 2BDRA 4Q4V3 2RR12 1CZSA 1KDKA 4LO7A 3J7LA 2BQPA 3D8CA 4URTA 3IKWA 2W1QA 3LKJA 5FZDA 1X4UA 3GN5B 1LHOA 3CZUA 3ZN6A 5IVYA 1VCSA 4S2FA 5KHHA 2A9UA 4TWHA 2NWBA 2MYSA 1C8M2 5B77A 5HXHA 5JZGB 2CRRA 1H2MA 2K1JA 2VOWA 3M70A 3OYWA 1JZ7A 3P4RA 1BZWA 4UFHA 4QPIB 2WS92 1E57A 2V1DB 1S2BA 5HXVA 2KWJA 2C0ZA 2GC1A 4XDQA 3PDQA 4DMWA 2NPIA 5FZ4A 2FMDA 2XAQB 2J22A 4TWFA 1DQ5A 5F3CA 2CLYB 4UW5A 4TV9E 4JX0A 4K0UA 5IYZE 4XETA 2CXFA 3BYWA 2W67A 4CSWA 5JQGE 4B3ST 2DF7A 1SA0E 5C9AA 2D6NA 4RQPC 5F5IA 4ZDTA 2R1BA 2C9AA 2XQAA 4FAHA 3RZLA 2UUAT 5I0UA 2MIQA 3BQIA 4QKDA 5FZOB 2JB8A 2YPDA 5L3BB 2JD4A 4COVA 3CQOA 5FPUA 2ECVA 4LIUA 4EE2A 1Y43B 1U5XA 2XEUA 3HJRA 1QUUA 4DO0A 3I2FA 4M1PA 3ZXKA 5F3GA 3LG7A 3VKNA 3IIAA 2R073 3ZXGA 2PELA 4XHBA 2W39A 1WESA 2CPTA 3G7DA 4AEDA 1XRUA 3MIBA 2HYKA 2XQ8A 5T55A 2RR13 4R8HA 1S0EA 4FPEA 4YHHT 4FQZA 2BU9A 3DUIA 3FBLA 2JICA 1KGYA 5D1IA 4YSZA 2R072 1NYWA 2XR4A 4L2NA 2IMLA 4O4IE 1MEC3 1CHUA 2J1TA 3SEEA 5HXEA 4NAOA 2WT2A 2V7MA 4KBBA 3VDBA 5AQRB 2IAKA 5JTGA 5FMOL 2FDKA 4MFRA 4KNCA 2ECWA 1RXGA 1LESA 2LXHC 3JB4C 2JMJA 3K4DA 3MYXA 5AQMB 4LF5T 4PDWC 3E6CC 2FD4A 2BFUL 1F31A 3SCFA 3DL3A 1V9DA 3EAMA 5FXWA 4GWNA 2DCKA 3AMQA 1ZBDB 5FTTC 1BBT1 3TOJA 3LBXB 1BR4A 4CCOA 3PUIA 3GMIA 3FBZA 4YTNA 2ZETC 2XUMA 2RDRA 3ZOIA 3NV4A 3VKMA 3C6WA 2GC2A 2WQ8A 4Z91A 2HWB2 4Y4RA 1A78A 2K17A 1LDJB 5L4HA 3RPGB 4RGGA 5FZ3A 2DU0A 3MDPA 3ILFA 4NIHA 1UXXX 3I0OA 3O9XA 4ZZ8A 5BXXA 3ZMZB 1SE7A 3HKEE 3RGLA 4YZ1A 3QACA 1JMUB 1X36A 4L97A 4HWFA 4CUGA 5HYAA 3N3HA 2ZM8A 3ACFA 4NHXA 5EWSA 2RJ2A 1POV0 5ABFB 4AKIA 2H88A 1W8FA 2VL4A 5AQPB 2D43A 2W3JA 4HPKB 4Q0QA 5DDJ2 4LT5A 2XG3A 5FIXA 4E9KA 4IL7A 3DKQA 3UUBA 4QU1A 1GFF2 1QJX2 2D0TA 3V65A 3FHAA 1WLCA 1YD8G 3NRXA 2LKGA 2NAAA 4XAXB 3M63A 4AXPA 2XQ3A 4C8DA 4HETA 4AOCA 1S0FA 3UETA 2C0SA 5LCWB 4CA1A 2WU5A 2WRAA 2J1RA 1LTEA 2X5IC 2C5JA 3A23A 3KNVA 4DOUA 5DQVA 3ZMTB 3FX3A 1QNYA 1RUH3 3NVCA 1O3SA 1OA2A 1CJDA 5LWBA 2VW1A 3O37A 1UOJA 1EUTA 5F3JA 4B1LA 4ISSA 1LEDA 3ZXFA 2I2SA 2DX8A 4OHFA 4AHWA 1R091 3I3EA 1UNBA 4JI4T 4X20E 4P9JA 5DAVA 3EABA 4HFIA 4YZ3A 3GDBA 4B3NA 1QWRA 2Y26A 3C7OA 1OQEA 1WGPA 1Y9GA 5JDQA 1DLCA 2HEVF 1GICA 2W0GA 2ATFA 3ESLA 1KD7A 4JEUB 4GB31 2VOVA 3LGRA 5DAXA 1JYXA 3H8OA 2A6WA 4B6XA 1TZOA 2C5DA 1UY0A 4CRQA 4ASMB 2M67A 4YW5A 1YQ8A 2KLQA 4META 2LM3A 5CGMA 5FMOS 1WEMA 3PJQA 2X09A 3KBTA 5JOYA 4UEMA 4AHZA 2VD7A 4PIXA 2BWCA 4AFDA 5J1XA 3Q8BA 4A45A 1T98A 1GNZA 3S6PA 3APBA 4AQYT 1UZWA 2R041 4MGQA 2GALA 4KMQA 2VNOA 4UYBA 2VVDA 3RKGA 4XF9A 4YBMA 1V70A 4MADA 4FI5A 1TVGA 4YFSA 3RX6A 3OYWB 4LITA 2V4VA 1JZ5A 2X10A 5I8YA 2BVMA 3H42B 2MPKA 1HNZT 3A4UA 1XNBA 5FZEA 5FB1A 2JWPA 2P3JA 5J3XA 2IXCA 2BG9B 3BTYA 5LRRA 3T2QA 4DINB 4LHLA 1YFYA 3MDBC 3OUIA 1POV3 2E5VA 4Y5Z0 2YB7A 2G0UA 4KX6A 4AQGA 1HR0T 3RI8A 1HS7A 1K2FA 1WCQA 3AMPA 4YW7A 3VBUA 2ERFA 4B7EA 2M1RA 4YVWA 2KGGA 2K9ZA 2WA3A 5CG9A 3LK42 2ID4A 3S7EA 4LBQB 2I74A 4QKNA 5L73A 4FTBA 5FZKA 2XAFB 1OXZA 3WW2A 2WFF2 4ZI3C 4QB2A 2FFWA 1VBA3 3LOBA 1UCUA 3AKQA 5J7MA 3E6DA 4Q8KA 4UFIA 3VBOC 2KT9A 2YK0A 1UO9A 2UYBA 1SEFA 2GMMA 2ET7A 3FANA 1LKXA 3ZFFC 2JG9A 4LKDA 1MMNA 3RC3A 2RM21 4XACA 2QIZA 1PO11 5CNAA 4F83A 5SVYA 1B09A 4XPVA 2HWD2 4ILCA 3RH3A 4YZ4A 2FD8A 3NAPC 3TBDA 3EYPA 1KNRA 2IDOB 5FYCA 3LK3B 4ITCA 4IV1B 4CN4A 2Y1NA 1JZ2A 1BEV1 2VBBA 5CYYA 5DZEA 3O0WA 1BXHA 4GD4A 3RIUC 4MZUA 4XJUA 4KP3C 4WM8C 1PNFA 5CFCA 2A6XA 5F6KA 1IKQA 1CAVA 3JD71 3S7IA 2A75A 2YUEA 2W91A 1RMU1 5FFOC 1J1JA 3VHOA 1FPN2 2HWE1 1Q8SA 5A1FA 1GZWB 1GOHA 2ZZJA 4YSYA 3ZYIB 2VL0A 5J0ZA 1BK0A 3HR9A 2J1SA 4BK4A 1QJZA 4QPIA 4GZ9A 4KG0A 4LBQD 2CGNA 1V00A 1FOD2 4AGGA 5FYHA 1XYPA 4QHBA 4YVSA 4NUBA 2XJSA 5FXVA 4NWWA 1VAKA 2MUMA 1ZP0A 1UAIA 4LA3A 3GA8A 3RS6A 1MS0A 5JXHA 2VXRA 4FPJA 4XFCA 5A32B 5JZGC 2ZKNA 2X53S 3BTZA 1JN2P 2HWE2 2XBO2 2ZMKA 4OHWA 1H8TA 2OW4A 5C8YE 4AI3A 1UGOA 5DG2A 4BAYB 3ITQA 3VZMA 2HLEA 3AE6A 1CD3G 4DR4T 4P9LA 1W6NB 5C8CA 1JU4A 4XTMA 3RRWA 4IEZA 4CTEA 2CWYA 2AE9A 5A6YA 1AR71 4RA0A 4PW8A 1VFYA 1H2LA 1W9YA 3N36A 4Q0PA 3U37A 3LPGA 2O1QA 4HT1T 4TKPB 2VCAA 2P9BA 1ZRDA 3PJYA 4XJ8A 1BCXA 3IA3A 3JCFA 3RDIA 5ABJA 5I3LA 3LIGA 5ACA1 2UWCA 1Y3TA 4Q4Y2 3FBMA 3NW4A 4AQFA 4GNFA 4E8DA 3AECA 1XB9A 1UX6A 2YBSA 3LSVA 4JEHB 3FLPA 3LSEA 1K42A 1U5IA 2XLAA 1DIWA 3OOXA 2YGLA 4Z92B 3KBUA 4AYUA 2PHLA 4XMIA 3VBRB 3TLSA 5FY1A 1W9SA 5CA0E 3LDQB 2P5BA 5D8AA 1RUNA 2OX0A 2M3HA 3POSA 1AZDA 2LHNA 4FK5A 4YW2A 3JBG1 2W63A 4FCAA 1ZBA1 2JRJA 5B4XA 1R081 2FDHA 1UXZA 3CLPA 5T50A 3HWJA 2VECA 5FZCA 2D3RA 4S3OC 3NNGA 2SLIA 2PAKA 4IEUA 2VBPA 1K12A 1D0GA 2RMU2 3NAPB 4WVWA 1MQTA 2ZBJA 3VBSC 1UK5A 3S30A 4LADB 3O33A 3AA1B 5EYXA 4ADZA 4W65A 4W8JA 3ZYJB 4Q4Y3 3JC6D 2ZGLA 3GL6A 3N5LA 4CUBA 1AR73 1G73A 2B46X 4ZZBA 3WSOA 3VD3A 5CFDC 3AP7A 3MW2A 4IGPA 1JYWA 1QDCA 1REEA 3ZN4A 4D7YA 5BPXA 4LF7T 3LZZA 4QT6A 4NHYA 4XILA 1DLLA 4YZ5A 4HWDA 3IHPA 4XHXA 3GWHA 1BR0A 3V5SA 1PGW2 3UQ7A 3WV6A 4NPPA 1VB2A 5ABJC 2KFTA 3ES1A 1PZ8A 1N87A 1PVC1 3JU9A 3TN91 2HEWF 3ZYFA 3AYCA 2DHRA 2OXBA 3KB5A 1Z6UA 2WP9A 2F4PA 2ZJCA 4KHPT 3ES4A 1MIYA 2I59A 4Q1RA 4F8HA 5FY9A 4BIOA 2VR4A 1O3RA 5LA1A 5IVJA 1D4VB 4KUMB 4XUQA 1YO8A 3RC8A 1YFUA 1CAXA 3LVRE 1AYM3 4IEXA 4URAA 1Y64B 1MNEA 3M7KA 4OQ9A 2VULA 2WS91 4YGEA 4HK9A 4AI6A 1KNZA 3VD5A 2O8QA 4OULA 1RUOA 5L3EB 5FLIA 3VHRA 5FB0A 2FDJA 1OI6A 2VPVA 5BNOA 4QXBA 3LCPA 2I07B 2EIEA 1CIYA 3LEIA 3CWZB 5T5OA 4KI5M 3L3PA 1UZVA 4AVVA 5CKQA 3AL6A 4GB0A 2NW7A 1W0PA 2XXZA 5AQFB 1R082 1E5HA 4YLHA 2JE9A 4CP9B 3OCPA 3DPRB 4GJYA 3RZMA 1X4IA 1XNTA 3RSJA 1CQ9A 3CPZA 1OOPC 5HEJA 5HAXA 1W0BA 1UZZA 5FUIA 4PI2A 1JBCA 1BK1A 1MNDA 4LULA 2OZ6A 3BTXA 3TNQA 2VJFA 2JDYA 2A6VA 2JJ6A 5HCAA 5A3MA 3ZJ2A 1O8PA 5G04L 4E4ZA 2Z2SB 2QQMA 2V73A 3QOPA 5JREA 2KR4A 3I2DA 4AK3A 2Q8CA 2IFWA 3IM0A 3BK9A 1UU6A 2CSVA 5JSPA 1W3VA 4E27A 2YFUA 4HBNA 4NPMA 2UWAA 3AEBA 1GQEA 1Z0PA 2HPLA 3AVSA 1OUXA 4UXNB 5GONE 2OQ6A 2VQAA 4Q5OA 5D1KB 3B5LB 4XF3A 1DGRA 4AISA 2RV9A 3NSTA 4O4HE 3R4DB 3THDA 4IE5A 3UU3A 2XOYA 3VZKA 2VKJA 4K8FA 4GOUA 1I6ZA 2LQ6A 2J47A 2D6OX 3QD6A 3MHZA 4PJNA 3AE9A 5I93A 3MIHA 3MW3A 4ZU4A 2Y34A 5D8AC 3LJCA 2IZWA 1AF9A 4FFGA 4MX3A 4ZQLA 2A3YA 4PQQA 5DPNA 4BA9A 2W00A 4LBMA 1YQ2A 4BB3A 1US7B 2ADDA 3C98B 4XIOA 1WW7A 1FATA 1WEQA 2YC2A 3EVYA 5FPXA 5D21A 3MPBA 3MF9A 2WO2A 5FV3A 3WDXA 3I0QA 1NZCA 5EYAF 3AL5A 4YAXA 2E9XD 3SOWA 4TX5A 4DR3T 2Z4FA 1OLMA 3B13A 5I0TA 4EN0A 2OLTA 2J1AA 4YGDA 4X8NA 2ZM6T 2ADEA 4LJNA 1GZ9A 4YNIA 1NG0A 2BGPA 3HA4A 2DWRA 3E97A 3WLUA 3BQKA 2W46A 3T1YT 4ASKA 2VOTA 4BPZA 4A98A 5IJRA 5FOJB 3KF5A 4WW0A 3MXZA 2E53A 4C1WA 3NKGA 2J7MA 3RMXA 1KXGA 2VU9A 1WLWA 2K16A 4OYJA 2FCUA 4MG2A 3AE5A 2ET1A 4YYOA 1LHWA 2XLFA 1UY3A 4XFFA 5DN2A 1VBD3 1WR0A 3ZIXA 3EDUA 4DV7T 1CWPA 2QFEA 3THPA 2UUBT 5C4WA 1UYZA 3WG3A 5H9SA 3CIHA 1X50A 4NJ4A 3WVJA 3WG1A 1IQAA 4CXXA 2ECTA 1CZTA 3AE4A 1JHJA 4AEKA 4EEBA 3B94A 4JBWF 4OUSA 2DUQA 4AFBA 2VJFB 2YHOA 3M99A 2M85A 1JZ3A 4R52A 4BMEA 5C6CA 4UVCB 1EUUA 2A3DA 3RZJA 1DF0A 1W28A 2XQ6A 3CX7B 3TEYA 4INDA 1VMFA 5JPMB 2W87A 4E2QA 1UX7A 1LNSA 4V3LC 2X0YA 1G6NA 3WNOA 3R0RA 2J1EA 4LF9T 2A73B 3ZSTA 3ZMSB 2EGPA 3J7MA 4LJHA 4UI9L 5JXJA 2GMPA 3BQLA 5A6XA 4IGUA 5FLJA 1NOVA 3VU7H 4AEDB 3V43A 5F5CA 1HLCA 4DR7T 3B01A 3KFWX 1SBFA 3B3QE 1SLBA 4XYXA 3SS1A 5LGNB 4DMVA 2R061 1SLIA 4Q2FA 5KXCA 1OT5A 2WBLA 2IDAA 2CHNA 4M3CE 3RYRA 3NJZA 4CDUC 5LNKA 5HCMA 3VDDA 5KR7A 4YSFA 2YDQA 1C28A 5LJMA 2BOJA 3DDTA 4XUNA 3AXEA 2LGKA 5A7OA 5LOVE 3NJVA 5C33A 1GUIA 4A44A 5K8SA 1W6PB 4DVDA 1WW6A 1U5PA 2LOSA 2G9GA 1OLQA 5I0SA 3IIIA 2XQYA 4YABA 5IAVA 1SCRA 3AYEA 4Q4X1 1PVXA 1R083 4QQOA 4OK0A 2HEYF 4Y1YA 3ZCIA 1GZCA 3SISA 1EV12 5BNPC 4E8CA 3AC0A 1SFPA 5SVIA 4DNDA 2YBPA 4K0KT 5FP3A 2E9XA 5AQKB 1IGOA 4CP2A 4J2CA 2N2NA 2GN7A 2CAVA 2IUBA 1US3A 1C3HA 1DZQA 1HB2A 2MNZA 1UURA 1D0XA 1IS3A 3S4UA 5L7OC 1U0AA 4FTSA 4XW3A 4W50A 3E2DA 1HJGA 4XUTA 2W47A 4A6SA 4JI7T 4LLOA 1ZX5A 2C24A 4JCKA 1WYCA 3NAPA 1JW6A 3AKRA 1QJY2 4GYRA 1QJU1 4PK6A 1ULOA 3FM8C 4IGQA 1VYXA 1X33A 3L1ZB 3ETQA 3I54A 3AKPA 3IAPA 3JBG3 3V0AA 5CEHA 3N4MA 4AI8A 4LK9A 4CDQB 2QQOA 1QU0A 2H0VA 2WNVC 3M3QA 2YQMA 1ND3C 4B4PA 5IVBA 1KK7A 1J3PA 5A33B 3UU6A 5JR2A 4QX5A 2JDZA 2GK9A 2KZ7B 5JR9B 4LKAA 4LHNA 2JG9C 4FXKB 5LKUA 2OUHA 2Y43A 5LBFA 3U0ZA 1WLDA 3K48A 3VBHA 1SQ4A 4CCJA 1QDOA 1CVNA 4D0QA 2WBKA 1CN1A 4IE6A 2RMU1 1IBLT 5F6LB 3RQ0A 4GAZA 4P1NA 3SMHA 2K3WA 2FDIA 3OSDA 5L4EA 5M4YA 5KH7A 4TYSA 5AQIB 4QHOA 4P0BA 4PI0A 1JYCA 1S0JA 2HWC2 3HCSA 4K9SA 3LF7A 3USSA 2VJXA 2CRBA 4JGYB 3D0TA 4OYUA 5AQLB 3WZ1A 2DTYA 3IZOA 3CX6B 3IDCB 4XJ9A 3ZFGA 5FVKA 3KMHA 2ZLYA 1G7YA 5CKNA 1A3KA 1MS1A 4YZ2A 5APAA 5K0UA 1MPXA 1UMIA 5LASA 5DQWA 4QPWA 1XE8A 1YQ4A 5EQUA 5DJQC 1RJ8A 1X9BA 3BB6A 4HVOA 4ZU5A 1ZRRA 1NEKA 1ZZCA 3HVDA 4FFHA 1S55A 1UZ0A 3IEEA 5ANNA 5LA6E 2WCAA 5F1RA 4WVZA 3GALA 4ORFA 4N3WA 1VOMA 1TNFA 2YW8A 2JM3A 3AEAA 1O8SA 1NE6A 1R1A1 1MMAA 4XCBA 2CMRA 2VH9A 3IBMA 2NP9A 1COV3 2A1XA 1T2XA 3MZKB 3N9OA 4AVXA 4XZPA 1N1VA 2NQYA 1W9FA 1UX4A 4AKLA 2OXQC 1J58A 3KV6A 1DU2A 3FHQA 4I0WB 2HDPA 3AP6A 4IETA 4U33A 1N47A 1US2A 2X0LB 1GR3A 2RA1A 2VOXA 5SVIB 4MXWA 4XQ4A 1NY71 2BYVE 2EODA 2WDRA 1HJFA 1WLXA 5IVEA 1HX6A 4KL1A 4UP0A 1UL9A 5D2AA 1VE0A 5JPNB 2DUPA 2RVAA 1YXRA 2WWVA 1LHVA 1ZA7A 1PO22 4P9GA 3WDWA 1N34T 1QJY1 2Z79A 4U31A 2YSMA 4LOSA 1F62A 2MEV2 1MS8A 1RUH1 3MPPG 3UGGA 2HWD1 2JDKA 3J4UH 3EJKA 1ZBA3 1W2OA 4XFGA 2CRWA 4U74A 3FXDB 4WVMA 2QTWB 5T5JA 4DV1T 1W8OA 2VZOA 4CDQA 2DJAA 2VCBA 4B86C 5FKYA 4FPYA 5FL0A 2PQSA 4YARA 4CEWB 3CX8B 2ZGQA 2BNOA 3AMHA 4YW3A 3V0BB 3HN3A 2I50A 4WVVA 1ASJ1 2MD8C 4PCRA 2VC9A 3FBYA 1S4CA 1WMXA 2RS53 1G8WA 3DPRC 2YINA 4QWNA 3NZPA 4XQDA 5B75A 3RPGC 2GU9A 4B3TT 1PVC3 5C2TA 1D2SA 3WUDA 4D3WA 1H9WA 5DUVA 1XMQT 4DUZT 3IAQA 4EZ4A 1QY4A 3PVOA 2DU1A 2LEHA 3OUJA 3L09A 3RZHA 3RQUA 2ZGPA 5FO8B 4YM0A 4QQPA 4U72A 2DVGA 2QBXA 3I3BA 1ZZ6A 1KITA 1ASJ2 3K4ZA 2JXAA 4LMKA 5JOWA 1S94A 2YU1A 4N43A 2ZS6B 3BOPA 3RNSA 4FPKA 3VKFC 4YW6A 4H63V 2QCSB 3WP3A 5JVDE 1XYNA 1HV0A 2RJLA 3WI3A 4YY3T 2E7AA 3HBZA 3PDYA 3PVNA 1C1LA 1ZYBA 3TN92 2BFUS 5BYNA 5TABA 1ODNA 1NQJA 4JYAT 2W08A 1URXA 4HFEA 5JI7A 5JDBA 4GK0E 3QLQA 4UT5A 5KXEA 4R9BA 3MLLA 4ZZ5A 3H3UA 4A2UA 1BBT2 4HWIB 5IK5A 3FL2A 4YXDA 4LOTA 2VTXJ 3ZSKA 2ZXQA 4F7ZA 2UUCT 1L7LA 5IUQA 5KXBA 5TRBA 5LG4A 2AGSA 3ENRA 3O1SA 2ZTNA 3WOGA 1YXWA 1V6MA 3MFCA 4HSLA 4D6SA 4C9ZA 2IUWA 2LHRA 2JDMA 3OPCA 1NY72 4QX7A 1QEXA 1OPMA 3NV2A 2JMKA 4YGBA 3AZXA 2CT2A 2JG8A 4GJZA 1C1FA 3RIFA 4NUVA 4P0AA 3PUVF 1AR92 4V1Av 5AQQB 2Z5WA 5DAPA 2P6CA 1HTJF 1VCTA 5A3PA 3LRQA 4JUYA 4YFWA 2ZEWA 1XSQA 1W3XA 1W2AX 1LRZA 2V7IA 3VL9A 1XJAA 4V2VA 1CUNA 2VNFA 1GP5A 4DV0T 3ZNIA 3BIWE 1AR62 1X9PA 1YLLA 3MEPA 3IN9A 4BISA 2HWB1 5FZBA 1DYKA 4AI0A 4HMZA 1DP0A 2X05A 2BS3A 1V87A 3GM8A 3I4IA 4P9XA 2XJPA 1UYPA 4LF4T 1W6OB 4H9SE 3CIRA 4XURA 4P9IA 4AKRB 3P4SA 4AEJA 3F2ZA 1QH6A 5J2UE 4O9GA 4NRPA 3UYJA 3Q5DA 5FZFA 2Q1MA 5ACA3 4FFFA 4HVRA 3BPSA 4HSJA 1FOD1 3EO6A 1WFDA 5ETWA 5ABFA 2XJRA 2UU9T 1PMJX 2UURA 4Q4W3 1PGL2 3ZVYA 4OFGA 4NIDA 2HPJA 4EOZB 1HQWA 4IQPA 3I7DA 3MIGA 2XHKA 2DTWA 4ZZCA 2Y0OA 3OGGA 1OEDB 3ZFFA 2W5FA 4LO6B 3T7LA 3WW1A 3AE3A 4EEDA 4IDQA 5LEKA 3KQIA 2RJKA 4CDXA 3O5SA 3M4FA 4K8RB 4TNVA 3RWNA 3MV11 2A6YA 4PIZA 3OUHA 3W58A 5C70A 1GQHA 4H7LA 4NIAA 3DJBA 3DV8A 4R9CA 4KBMB 4K7JA 4XOGA 4M01A 2HN2A 5F37A 5LB6A 2V7KA 4JI2T 4XUPA 2MAWA 5F8PA 4QXHB 1M4WA 1WEVA 3E6BA 1KS5A 5IWFA 4G3YC 4HFBA 3C4XA 3KGZA 5FYZA 2AREA 5M0TA 5CU1A 2VOKA 2ZHLA 1CAWB 2W92A 1K45A 3KZ4C 3FZLB 1IJ5A 4TZDA 3RG0A 2LV9A 3BOWA 1Z7S1 4A56A 4U7YA 2ZKLA 1XPWA 3AAEB 1HIXA 4UELA 3LSDA 3FFZA 1W8TA 1HFAA 3SKJE 1PNGA 4CDUB 3D6EA 1ST8A 1RUG1 2WDQA 2XKPA 1DYOA 3POEA 4JGZC 1IZ3A 2JD9A 2VPEA 1R1A2 4NRMA 2ZEZA 2HBUA 4P02B 3ONLC 2VUCA 2D5UA 4YW4A 3ZFEC 4DZGA 1PHMA 2VTXA 3OD0A 4QQ4A 4QXKA 4UW3A 2NTXA 2L0BA 5ANQA 3WP5A 4IC3A 2G4IA 2BRTA 2AYHA 3ZT6A 2A71A 4ERRA 1PVC2 2WYFA 4AAXA 2FCVA 1W9TA 5SVXA 1MS5A 1H7CA 2CAUA 2UXCT 4GNDA 4LMLA 4DS0A 1LCLA 2SPCA 2DVAA 5CIRA 1K5MC 4AL9A 4QX0A 4UOJA 5FDBA 4AQTA 4WV8A 3ZCJA 1TEIA 2PA7A 3MIDA 3CK6A 3Q5XA 4AZZA 5FNVE 2W94A 1ULFA 4QPYA 1EPWA 1WZXA 1QJFA 3JQXA 5CA6A 3GZAA 4ET7A 1Q8VA 2DL1A 2HWF2 1IG0A 3J9X1 2ILMA 5KH9A 5GZEA 4L9IA 3PUYF 4AFCA 3I59A 2BTVC 3I97A 4PLNA 2Q8OA 2Y38A 3CBNA 4RQPB 2ECNA 1XC6A 4QKBA 2LW8A 4HFDA 2DLRA 1RTVA 2WYSA 2L8KA 3UU8A 1HDKA 3EMRA 4I55E 4JHTA 4CP0A 4QQHA 4TN7B 1OC1A 1R093 2Y0IA 4N7UA 2L9LA 2GP3A 3BUCA 3NWIA 2CL2A 3CQXC 1XNAA 1ZRFA 3GF6A 4ZHNA 1YUDA 3AEEA 5FYBA 4Q4V2 4UF0B 3C7GA 1W2TA 3OBTA 5DDJ3 1NCRC 5ABGA 4ZS3A 3U78A 1XMOT 4L92A 3U4XA 3OTOT 2KIZA 4XJWA 4P9YA 3WW3A 1H8TC 1ONAA 4KH9A 5K4LA 2EA7A 3HT1A 1LECA 5L19A 1FEWA 2VZRA 2H6BA 4B8EA 2VZQA 1UIKA 4OI4A 4HL0A 3WF2A 5AIUA 3OYXA 4B7YC 1VRH2 4M0NA 5LKXA 3GGLA 1PO21 4LLBA 3ZSLA 2ZPXA 2W1SA 3CJIC 2KR2A 3HQUA 1PZ7A 4YSXA 1VBD1 4YLZA 1AXYA 5ADXL 4IDZA 3H3ZA 5JXIA 3UQ4A 2R1DA 3J7NA 4EZHA 3FWEA 1J1TA 4YW1A 5JRCA 1W6MB 4PK5A 4LHKA 5BV6A 5AQJB 1BMV1 3POYA 2QQUA 2ZAHA 4Y1ZA 2PQQA 3FHIB 1F15A 1DHKB 3LQHA 4YBSA 2LDRA 4PHZA 1ND3A 4PJYA 3KT1A 1CZVA 2VBDA 1XDPA 2A2FX 5EYYA 3SITA 3NJYA 4BQ3A 4B3MT 3ZT7A 1I5PA 2CDOA 2WZR2 4CXWA 3O7OA 3E08A 5CVRA 4EN7B 3TLTA 4TUYE 5FYUA 4YBTA 3GHNA 2JQ9A 2XLGA 5C3RA 4JTOA 2BGOA 2ZEYA 3JQWA 3LEGA 1Y01A 4PFPA 3DGTA 4Z8BA 3PTRB 1NLQA 1ZBE2 1H6YA 5CFCB 4OGCA 5FJHA 4MO3M 1ENSA 3KF3A 4ILBA 3ANWB 1WEUA 3IDAA 3Q9DA 3UTKA 3ACLA 1XU2A 2K4DA 3DWDA 2C5IT 4AGRA 2UWBA 5FZGA 2V5DA 4CPBA 4N43B 3W21A 4BJ0A 3WHUA 2VZTA 4DFSA 1Z78A 2LSKA 1TMF1 5C4WC 4LPLA 4C90A 4IHJE 1KFYA 4YJ3E 4QXCB 1OHFA 2IQJA 4K3UA 5A7SA 5ERLA 1BMV2 1ULPA 5HPOA 4EV6A 1O4YA 5GZCA 3JAEA 2OYZA 4EROA 1MZ5A 3MKDA 4NE9A 2K5BB 3QH7A 5CFDB 3ZDVA 2FZ2A 4YT0A 1YIFA 2XOMA 4WZ3B 3OVUA 5FP9A 4P09A 1HRV2 4YRDA 1APNA 3PURA 1WBLA 3V0AB 2YHJA 5H9RA 2JENA 5FREA 4DUYT 4MBQA 2XB6C 2TNFA 1GKBA 4J6GA 3RYHE 5LKTA 4FPHA 4NAMA 4YVSC 4GQ7A 4EWEA 4O9EA 3TB0A 5LY1A 3P3NA 4BBQA 3T1LA 3WF1A 1MZ6A 4FPCA 1YJLA 3UT5E 1FMD3 2AENA 4XFIA 2VZ3A 4QB1A 3N7KA 4MGTA 3G6JB 2C26A 4YG6A 4ILAA 4Q1PA 1WD4A 2RS32 2D40A 2JB4A 2LALA 3WF3A 3WW4A 4PF5A 3M7AA 3NKZA 1DQ4A 2FUUA 4M3CA 2N7GA 3THCA 2L5UA 2R49A 3ATGA 1RHI3 3IDBB 3H8UA 1FMWA 2UY9A 4BU2A 2VXJA 1OF3A 1SCSA 4EWAA 3SNMA 3GV4A 3KM5A 1KQRA 2X9HA 1NLRA 2JX9A 1MS9A 1S2KA 2A6ZA 4U2AA 4O2AE 2CKLA 2FSAA 3OBZA 2R7EB 5LB7B 2QE3A 2RR11 2EIGA 3SH4A 1L3JA 2X51A 3P50A 4WM8A 4W4ZA 1ENXA 4AFMA 2L9QA 3ONJA 1L7RA 4ATFA 2DBNA 3VBHB 5DABA 3ANWA 2C5KT 1XNDA 2WL1A 2IVIB 4LFCT 3HNBM 4PK4A 1Q43A 5FXZA 1JI6A 4X1YE 2WNUB 1XSRA 2HWC3 4Q4Y1 5IK8A 2VMCA 3MO4A 1YWKA 3J7HA 2JMDA 4GNEA 3POGA 2Q9QC 5DKAA 3PJAA 3O0VA 3ZLIA 4UV8B 4SBVA 2VW0A 1BR1A 3ZYRA 1MR5A 4AI2A 2A72A 3TLVA 3N2OA 1ULDA 1YIPA 4UW4A 4NIGA 4IT4A 4X6QB 2XH6A 2UU8A 3ETPA 2LGVA 3JUEA 4F6RC 1E5RA 2GAUA 4JI0T 5I0DA 1Z8UA 3H3AA 3UL2A 3BGAA 3OPZA 2D2SA 4ZI7E 5J3UA 3WP4A 4DEVA 3U5MA 4IL4A 1WWYA 3HMYA 2G6QA 4A42A 2DVFA 5FKBA 2B4KA 3OD4A 3NWKA 1Z60A 2GDFA 4I7BA 3VD7A 1MBMA 4QDQA 1TG7A 3RYKA 1COV2 2E6RA 3LE0A 3CF6E 3BVCA 2LSGA 2YC4A 4FXGB 2WUHA 4FIPA 4YC9A 4XXAA 4BK5A 1H6XA 2LM9A 4LK6A 1GQGA 1ZZ8A 3ACHA 2JMIA 2CTVA 2EXJA 4DNYA 5A33A 3WP6A 4IEVA 2NW8A 2YOEA 1MM2A 4CEYB 2VUAA 4I4TE 4Q8LA 4OZXA 4Q4V1 1QJU3 1VMHA 3KSCA 1E2AA 1CR7A 5H9QA 5EIYB 2GNBA 1QGLA 3V0BA 2KA3A 2UY8A 2ACZA 3MF6A 3C4WA 1H2NA 4K6BA 2K0GA 2K2SA 1W99A 4UFKA 3DYMA 2R071 4NPRA 2LS6A 2AN6A 4LUMA 5LGUB 2BZBA 2DCFA 2GC0A 2WQ4A 2ARXA 1VBB1 2LRIC 2VK9A 2PG8A 1XNCA 1WEWA 2XL7A 5DG1A 4UBHA 2HWF1 1YFWA 3SOLA 2PNXA 2KINB 3H8RA 2E9XB 4A7ZA 2D0UA 3THTA 3UKVA 4FJOA 4IDPA 4NXNT 4BDVB 4CP9A 2XP0A 2Y6KA 1RUI3 3T08A 4XF4A 1KFXL 3RRCA 3U5NA 2J1VA 2OPWA 1GU3A 3VBHC 3RZGA 3RYIE 1NZIA 4EYUA 3GHMA 2HH7A 1JOBA 3AE7A 2PHTA 4K21A 2P2KA 3SUBA 1HRI2 3MIFA 5K3QA 5AQHB 1GBGA 2YYOA 2RDSA 3POBA 2E33A 2H89A 3N2KE 4ZI2D 3T2OA 4CN1A 4B3RT 2KM2A 4DV5T 5BNOC 4D6QA 3OJAA 3TYJA 1WMFA 1NQDA 5JDLA 4WZFA 4E4SA 4BQWA 2Y48B 5IATA 3O1HA 2WNUA 4OCTA 1HNXT 4AE2A 1SDWA 4HKOA 1OQ1A 3A0NA 5DDJ1 1C8M1 2LJLA 5JH7E 1RXFA 4MGZE 4WBNE 5A7WB 3FUOA 2JIGA 4QPGB 2XJUA 5LKZA 1XXNA 3ZO0B 2ZM2A 2LAUA 3VK6A 4CDXC 5AVAA 5FZOA 5DAQA 4WA6A 2G45A 2O8OA 4QDSA 3C51A 4CDWC 4Y5SA 1FPN3 4MGSA 3FZFB 2CY6A 5DMYA 3PMEA 2H6CA 1DU3D 2CONA 2X9YA 5EZWA 3N9NA 4Z8XA 3I2OA 3Q8CA 4BQ2A 2PHFA 1ULGA 4HANA 4F1PA 3I9WA 2EXKA 3AXDA 1S0BA 1FMD2 2JDUA 3Q5WA 4DY5A 1ZOYA 1AL0G 1F4HA 5LBEA 3TEWA 1G9FA 4YJ2E 4GULA 3NBXX 3U75A 4FP2A 4M3CB 5FCCA 5FZ6A 4LO8A 3ZMVB 1RVF2 5BNOB 4BM8A 1UU4A 3PU3A 5IW0A 3AA0B 3HKCE 1IS5A 1XU1A 2Q4SA 2XL9A 1JYTA 1IQDC 2E61A 4A4BA 4Q25A 3DXTA 3RMYA 3FHNA 3ZVXA 1H8TB 1GOGA 4I0UA 5LJNA 5FYIA 1ND2B 3L39A 1REFA 4CYDA 2H7VC 4YWAA 2HYED 2RM22 4KU7A 3WF4A 2BGCA 5E8AA 3FN9A 4CDXB 3RWKX 4RYDA 2CKLB 3O47A 2L43A 2BBJA 2XJVA 1GP6A 3TWIA 2UZGA 3J9SA 2WZHA 3VBUC 3L9JT 1R1ZA 4Y1UA 2J1UA 3I2IA 3B5MA 1OA3A 1LR5A 4DEQA 2E31A 5AFBA 1QOSA 2P3YA 2EHOB 2NW9A 3DP7A 1VBB3 3PV0F 4JLEA 2B0OE 3ZPV1 3AEGA 4NIIA 1AX0A 1LHNA 3V64A 2WDVA 1WCDJ 2D5HA 4W4UA 2JDAA 4PJLA 4XJZA 1UMHA 4NR1A 3CMGA 2RDNA 1VBE3 4HWHA 4UR9A 3UT0A 3LOIA 3KINB 1VPHA 3K77A 3M65A 5LCWL 1RJ7A 2Q8DA 1RMDA 5JXGA 2VJEA 3O35A 2VPBA 1OEDC 1EV13 1JTZX 4DR1T 2LSJA 3AJYA 4KQ7A 4DUVA 4WYVA 4I50E 1L7QA 1UY2A 5KC5A 5LBBA 2KNDA 5IK7A 2L80A 3RZZA 3OYZA 4DQAA 5FMDA 1POV1 1D0YA 1HYIA 2E6SA 1MMGA 1A6CA 5GZGA 1S35A 3VHLA 3FZHB 4GXLA 4R4XA 5CFBA 2VKDA 1YFXA 2ZEXA 2NMOA 4QDRA 4EXTA 3POWA 5LYJE 3RJRA 4LIVA 1V6NA 2P34A 3ROUA 4UAPA 2KU3A 2Y8DA 4KG8A 1GWMA 5LBQB 5IVFA 2ZMAA 1V9U2 5F2WA 3UNPA 4RR3A 4IEPA 1OKOA 2PHWA 5E88A 2XQ9A 1VD4A 4XBNA 3UKNA 1OVPA 2CBIA 1LOFC 4FAGA 4EN6B 3ZIWA 5KDMC 1HW5A 5HEHA 4XEZA 3FFQA 4IDNA 2V26A 1JZ8A 5H6QB 1AYN1 1MIWA 4E2SA 3W20A 4RGKA 3PUAA 4DV6T 2MNGA 1GYKA 1NLSA 3H37A 1AR82 4IV3C 1R092 1HRV3 2V6YA 2DBIA 3J26N 3OEBA 3WG4A 3T4HB 5JMCA 4CE8A 3KWVA 2Y33A 4AI9A 2QQNA 5HCFA 2RS13 2D8SA 2XWJB 1QJX3 2LE8A 1DCSA 5J1GA 4PLMA 3B69A 4BCUA 4BE3A 3ZDSA 4UVAB 4MSXA 2ZGRA 1W90A 1HN0A 1VBD2 4CDQC 1IS4A 4NVPA 1LODA 4IEWA 3VBOA 2FJBA 3ECQA 2RS11 4DV4T 3HEIA 2WZR3 1LAJA 5K0UB 4FOQA 2FZ1A 4YM3A 3EHZA 2ECIA 4QQLA 1LDKC 1ZEEA 3WEZA 3K3NA 1OVSA 1H4HA 1YRZA 4IIJE 1RUG3 3ZC0A 3K51A 4AF9A 5KXJA 3RI9A 4P00B 4QH5A 4JHZA 5BNPA 3UULA 4XMAA 3TN93 5HV4A 1RVF3 4GKYA 1VIWB 1NXMA 2VMIA 1J1LA 1YC61 4RS5B 3D3AA 3VR9A 1X9TA 2Y64A 4DBQA 5KC6A 3UJOA 2QYWA 4PBPA 4IE0A 3LPFA 2WT1A 1RINA 4E7ZA 4GWIA 1CONA 4AXOA 2QJ0A 3U07A 3NNFA 1WMEA 3I3DA 3I2GA 1JOPA 1YI9A 3X29B 4IV1C 2VVSA 4ES9A 2ECGA 5DUWA 5A7WA 4LKEA 1MZEA 4HN1A 2DI4A 1UZYA 4OLLA 2YZ4A 3V5UA 2V8SV 4MLKA 1J5ET 3OGJA 4LBQA 5I8TA 4CZSA 5EZYE 3EUHA 4FTEA 5JOXA 4HLTA 2ETEA 3NMBA 2VQFT 1NCRB 1FYUA 1K5JA 4J1XA 4Y3OA 5A7PA 2YVRA 4JQTA 2VPGA 1G9CA 1W8HA 3NNMA 1UY1A 2B9VA 3O1PA 1NE4A 1I1EA 2A7AA 1G8XA 3HCTA 4AVSA 1ZBA2 4Q29A 2YU2A 2Y6HA 1WGMA 1QNWA 5D8AB 1FI2A 1IPJA 4GH4B 3L8RA 3PUZF 3WNLA 2ZGUA 5AC93 1WCSA 4YVSB 4LKSA 1PMIA 1MS4A 1ND2A 5LHIB 4DUXA 1RUJ2 5DUUA 4XIKA 2V7JA 2F42A 1OKQA 3ME2A 1W05A 1IG3A 4GB33 5LATA 2W68A 5LA9A 3M3OA 3K3OA 5F5QA 1RUI2 4RR3C 3BKZA 5BNNB 2X67A 1ZZBA 5LHHB 2X8KA 4JGYC 3Q1DA 2BKPA 3UU5A 3FAOA 1OQDA 3VBFA 3S5AA 4V2WA 2D93A 1VBC3 5JR9A 4EV0A 3PU8A 4U2YA 3O12A 4CI3B 3HQRA 3E5XA 5A1LA 5L9BA 3AMNA 3MICA 3POJA 4JI6T 4QX8B 1G86A 1N1SA 1JXNA 3U4SA 3MGUA 4B29A 3BIEA 1AR72 2FJEA 1QXPA 1HCIA 1VBA1 3M2MA 4KWKA 4I0AA 4XF0A 2EAKA 3CQCB 2VVNA 4I43B 1I6XA 4RHV3 1XE0A 3Q2MA 2XZEA 2B39A 2Q1ZB 1AHSA 1RC6A 4IESA 3AYAA 4N8MA 1YKEB 1RVF1 4XTPA 3ZFFB 2M13A 5J36A 5FYYA 4H9OC 2KKXA 4XAEA 1D1CA 3QZVA 3MLKA 4UI9B 4CDWB 1NAFA 4FOWA 2B42B 2DVDA 2DNXA 3HKDE 3CJIA 1KS4A 1G9DA 1AJKA 1HXS1 4FO9A 3WR0A 4YGCA 2VQUA 2WKKA 3FLTA 1HNWT 2D9DA 1TMF2 4AKHA 5FZLA 2YQLA 1WIMA 3Q8AA 1QXRA 1SG3A 2ZX4A 2BG9A 5G05B 5FY8A 3SEPA 5B4NA 4NXMT 2XDVA 4QM9A 3BN6A 5FY7A 4CVUA 4Q4W1 4FT8A 2G9FA 3RLFF 1V0AA 5EPAA 3AA6B 2VNGA 4CEWC 1LGBA 2ECJA 1AX1A 3C3VA 4JI3T 4I0BA 3D82A 4G63A 2KREA 1QOOA 4PIYA 4HKAA 1ZREA 3VBFC 5JZGA 2ARAA 2XPJA 5L3FB 1J84A 2Q9QA 1V6JA 3HKBE 3ILRA 3SQOA 5EJ3A 1JNZA 2E26A 2WU2A 2AACA 2XM1A 2YSJA 5FYMA 5B78A 1MQTC 1IOAA 4NRQA 5F7UA 4DRRA 3T0DA 3DCQA 4BJNA 3JADA 2D6MA 4WVMB 3MLJA 4MUVA 1U6GB 4UV9B 1KF6A 3LDKA 3T0AA 4IUGA 3JBG2 2NLRA 2E5LT 5LK5A 4ZU7A 5A3UA 2CE7A 4QHZA 2KGIA 5AQTB 5A3WA 1FNZA 4FPLA 2KE1A 3NZQA 4PJJA 1N32T 4CCLA 3POFA 5EFUA 1YEWA 3KD4A 4GIWA 1M7KA 3W9AA 1UIJA 4P14A 4AVTA 4JQRA 2RM23 1HXS2 3ZM8A 2VP7A 1UPIA 5TBNA 3KCYA 1RMU3 2GSYA 2W52A 4M4PA 4FP3A 2RI7A 2XAJB 4NWVA 3OPWA 4N4FA 4GKJT 2MHFA 3CKDA 2V6XA 4X62T 1HRI3 2V5CA 5LA2A 1T7SA 3GBGA 1CPNA 3FMGA 2QQJA 4QX7B 1NA1A 2VZUA 2I0MA 2ZMNA 5E6HA 1BLZA 1YQ3A 5BNNA 1D4M3 2VZ1A 1NWMX 2RHPA 1VJ2A 4LF8T 3UUNA 4UBGA 4WZ0A 1RUE3 2R0HA 4KWLA 3LJUX 5A3OA 5G04B 2VQ0A 3ILNA 2CYFA 2OKXA 4EN8B 3ZKRA 5HEGA 2MT5A 3CU7A 2VGDA 1KRIA 3QNUA 1LKNA 1QJEA 5J98B 3H8XA 5AQSB 3J8F2 3AFGA 3ZN6B 1WENA 3KV5A 5AQVB 4BQXA 2QVSB 3AZZA 2DUOA 3RJ2X 1IS6A 5B8DA 2HN1A 3O1TA 3VN4A 2CEAA 3ZPYA 1RMU2 3GZTB 4Y22B 2NM1A 4Y20A 3ZXEA 3PHMA 1GNHA 2IXIA 4XI1A 3U5PA 1YQ6A 5FKCA 3RYPA 1GANA 1WKYA 2WM9A 1Z0HA 2Y60A 4NPLA 5EK4A 1BEV2 4Z2WA 2PHXA 5I8SA 1IKPA 5FY4A 2D97A 3ZR6A 2DV9A 3VKGA 1LOEA 5ABJB 5IAXA 1L0VA 2XSBA 1IJ6A 2PXJA 4UIGA 5JVVA 3OKQA 4PAGA 2CNAA 5JLVA 4ATEA 1UCXA 3N35A 4QB6A 4ARXA 1XYOA 1O3TA 4M3CF 4HEAA 3DXUA 4AYCB 1JOCA 5AVPA 1D1BA 3K4AA 2JQHA 4RS5A 3ZMOA 3ZC1A 1VLNA 2EXIA 1OD3A 4DXSA 3VZLA 3C7HA 3M62A 2ZABA 1DBNA 2XUEA 2WIIB 1ASJ3 2WAOA 5A3TA 4L0RA 1YQCA 2TEPA 1D7PM 2ZACA 2YROA 4NN2A 4HTEA 1UY4A 2K48A 3DTOA 2K24A 4LHSA 4LQRA 2DYCA 5H9PA 2YFZA 3DF0A 2EXHA 4CI2B 1RUG2 3AXJA 2BBVA 4IV3A 4OHYA 4ZXKA 3VR8A 2RG4A 2RPAA 1HV1A 3GJBA 4F52B 1LENA 4HKWA 4ZUXU 4ZI3D 1UD1A 4OMDA 1U5ZA 1EAH2 4GNGA 3E5QA 4XQWA 1OOPB 1D4M2 2RS52 1GWLA 4XE9A 5EP9A 4KHZF 4CCNA 3SRZA 4MGYE 3AK0A 5H1VA 4X1KE 1UYYA 2OT7A 5HEUA 4AAPA 3VZJA 4XFBA 5I91A 2YU4A 1CPMA 5HWYA 4CA9A 1IZNB 2KWOA 3VHNA 5FWEA 3ZYHA 2BAYA 5T3NA 3ST7A 1EPZA 2YN6A 4KWUA 2ZGTA 3HCUA 2Y8KA 4EJRA 3MHSA 4RL7A 1AL21 4CCKA 2X66A 3UUMA 2IXJA 2YEVC 5JAXA 5IK4A 4F3JA 2N1GA 1GZTA 3I3QA 2EF6A 1TNRA 2MBGA 3RQWA 2AR6A 1W8UA 3HBKA 2PUYA 3T9KA 2NP0A 3H1YA 1QH7A 1QF3A 1JM7B 1QKQA 5CB7A 4XBFB 3GCWA 5LW9A 1OPOA 3FZKB 3GN5A 2XGXA 4BHPA 5C3OA 4Y22A 3JD73 2MPFA 5HXSA 3OGSA 1M62A 3SKVA 5GLVA 1MS3A 2WSUA 4ZOLE 5HCJA 4YADA 4MHRA 1LVFA 5FP4A 3LA3A 1BVP1 1PO12 5DZFA 3SLIA 5FPVA 4K1YA 2XTLA 1W8WA 4MVTA 4R9AA 1FMVA 3MUZ1 1AYM2 2MD7B 4X6RB 1W8NA 3BPZA 5IFPA 5JUVA 2BUKA 1MIVA 2XJQA 3RGBA 4Q6FA 2FJDA 1F35A 2PBIA 3PUSA 2LN0A 5F3IA 2W1UA 5L3CB 2JKBA 4JAAA 2HWF3 2EGMA 1HRV1 2BJSA 5F2SA 2XAGB 5TSWA 4DXTA 3VBSA 2G19A 4A3XA 1JZ6A 3GYDA 4Z0RA 1JUHA 5HEOA 3B00A 4HWCA 2QA7A 1X7NA 2V7LA 3ZTGA 1SZBA 2C6SA 1K3IA 3KCCA 4R4ZA 2BEOA 2CCQA 2YXSA 2YT5A 2KWIB 2GN3A 3HTKC 2RMU3 1SLLA 1W6OA 3E1F1 3KHCA 3FEHA 1RHI1 3A7QA 4PDWB 2F6NA 2EHOA 4FI9A 2UXDT 4X65T 3UGFA 1CAUA 5C3SA 2MEV3 4QM8A 2J1DG 1F5JA 3ONXA 5F5AA 4QH1A 4RHV2 1WA4A 1W09A 5LG3A 1OOPA 2BWAA 3QCWA 4XFHA 1MEC2 4WBBA 4EN9B 1LEMA 1LOFA 2D8UA 2JKXA 1ZBE3 3WCSA 3RYFE 4XJAA 2ZGOA 4D7TA 4C0BA 4DIQA 3O1OA 3HNMA 1A8DA 1OH4A 5FZMA 1HKDA 5L7OA 1UOBA 2NYYA 1W8ZA 4HFSA 2OZJA 2CBJA 3HAGA 1BQPA 1RUF3 4D7SA 4O4JE 4L8QA 5C13A 2QVAA 3LBXA 1RUC2 1OA4A 4Y4YA 1YQ5A 1PGSA 1XOYA 3RF1A 4GB32 3WDUA 2O14A 5BNQA 5F3EA 1CAVB 1Y7BA 4JKMA 2VW2A 4E2GA 3NNJA 4P9WA 1ZZ7A 3MA9A 2Q5TA 2MKEA 1UF2C 2XBO3 2VO5A 2I6HA 3MFAA 3VBRC 1UUSA 1HN1A 1PO13 1O7FA 2Q8EA 5IT6A 2YG0A 4GYSA 2Z69A 2YURA 1VBA2 1FIOA 5IHYA 4YFZA 1E7PA 4ZHQE 3SHBA 1X4JA 1X8EA 4A6OA 1HQNA 2ZHMA 1VAVA 3CVRA 2XJ7A 1WEPA 3UFEA 3GBWA 2E8IA 5DUXA 3JC6C 3KCXA 2VY0A 4WZCA 4GWJA 3AAAB 2B5HA 3KHBA 1UX5A 3GZUC 2ZGNA 1DQ2A 4R2YA 4BXFA 5B79A 3NKTA 5E0OA 3B57A 2PN5A 2JJ9A 2WLPA 1A8MA 1R64A 3O4XE 3O1JA 3RIUA 3SFDA 2QJVA 1SUMB 2VUJA 2GZWA 4BLJA 2ORXA 4N9IA 4CU6A 1S0GA 4I7DA 5BUVA 1W6QB 1GZWA 3LQIA 3GJAA 1GOFA 4OZOA 5FUPA 3AEDA 1NKGA 3AB0A 3FUQA 4YVWB 4C0HA 4C91A 5FL1A 1HB4A 1F8VA 1AR61 2G43A 3KT4A 4FJCA 3PLWA 2I45A 4ANJA 4CEWA 3DYOA 3QK6A 3CHXA 3VZOA 1WW5A 2ZX0A 3V56A 5BY5A 4BIFA 3ZSSA 4MALA 4A49A 1VBC2 3L1XA 1Y9MA 4IEQA 1T8BA 1LGCA 2LROA 2WZPP 2MTQA 2D44A 5J48A 4RHV1 4RFRB 1WR6A 4P08A 4Y26A 1JH5A 1Q8OA 2M6BA 2XM2A 2BDEA 3AAIA 1MQTB 4QPGA 4KI0F 1AYN2 2NN8A 2FBWA 1H0BA 2XVKA 2R0FA 2XOZA 3A22A 2WNUC 3DYPA 3LA2A 4DY3A 4LF6T 2FQPA 3T09A 3J8F3 4QGLA 4M4RA 4YM1A 2E9QA 2ZOEB 2BG9C 4JKKA 5FPAA 1LU2A 2BS4A 1BHGA 3M3ZB 3Q9OA 1OEDA 3ZXLA 4JRLA 3T1MA 4EIWA 2WT0A 1H1IA 5FQ0B 3CEWA 1E5IA 3KV4A 2VMEA 1XZYA 2DFCA 5C11A 4K40A 3OEAA 1O4TA 5FZHA 2JQKA 2HHHT 2FBEA 2JECA 2CXDA 2PTMA 4BZ4A 4YPJA 3CMLA 4O65A 4X64T 4Q4W2 4QPGC 2Y1MA 3T0BA 1VP6A 4H3WA 1OEDE 3N9QA 1H4GA 2HWC1 3DEMA 4ARYA 3PIJA 4PNIA 4ZS2A 1S0IA 3ZYBA 2LRLA 4YM2A 3HI2A 1AJ3A 3AM2A 1XNRT 3L11A 4QX3A 1B35C 3DN7A 5F5WA 2Y6FA 3PHDA 3ZEFB 3VKHA 2Z6EA 2VMDA 4XBLA 3BCWA 2RE9A 1S0CA 2UYAA 2ZMLA 4UWDA 3AYDA 1O91A 1EYBA 1NCQC 2WFF3 4DUWA 5J09A 5FUNA 4QF2A 1HF8A 1AL22 2IC6A 3O1VA 1YKHB 3H3MA 4OI0A 2LGLA 4AKGA 3WY6A 2AEYA 2P4EA 5FBJA 4LK7A 1W6QA 2JQQA 1RUE2 4N90A 4HONA 1FV2A 2YKSA 5CISA 3UV9A 3W5NA 4BQYA 4XVHA 4FSJA 3ZKYA 1WCKA 5LXTE 2WA4A 3SH5A 1Z7S3 4COWA 4CU9A 3GXUA 3S0MA 5L3DB 2LSIA 4M0HA 5GZDA 2LSYA 3EQEA 2YDEA 2BG9E 5ABEA 1AXZA 5C3PA 4AEDC 2VZVA 3R05A 1DVPA 3TAYA 1J59A 5FZ1A 5LZ6A 4V1PA 2R6GF 4X5TA 4BQ5A 5H9MA 2LKHA 2VZSA 4E4DX 1FMD1 1Q8PA 3VD9A 1CX4A 5C8WA 1ZHCA 2ACXA 2KSRA 2RP4A 1N36T 2ZX1A 3EB6A 1UPSA 4MYEA 5JOZA 1QJX1 3RPQA 5A80A 2WZ8A 3I8TA 3PMSA 1DG6A 3N9MA 4QXCA 4R9DA 3GZEA 4AQFC 3ACGA 1RUJ1 4CCMA 3TEXA 2WY2A 4OHVA 2QKDA 3U11A 4HN9A 3WNKA 4U36A 4TTGA 4LMFA 3CQGB 1V9U3 5FVLA 2F17A 3LEMA 2V5YA 3PL0A 4BXSV 4Z90A 4MH0E 5KHIA 2VKHA 2VMGA 2PAMA 1UKRA 3N7JA 3CO2A 3OB8A 4H7MA 3LDYA 2QICA 4RGAA 5L9RA 1RUD2 2W62A 4MGIE 4UFLA 3R6NA 1VR3A 4LBJA 1D4M1 1O3QA 3MHHA 5A7NA 2D6KA 5CFCC 1WW4A 4IREA 3WDTA 4IW3A 4JV4A 2WAAA 3ZSEA 1LHUA 3MUY1 5FMNA 2R043 3ZPOA 2OIIA 1OFNA 2VKOA 1C5HA 2YC0A 3HR0A 2Q9QB 2L3LA 3EHKA 2D6LX 1ZM1A 2HKXA 4NROA 5T52A 2XAHB 2IVJA 5CFDA 2EICA 4ZY9A 2WS93 1LULA 1KNPA 5A3NA 4L5GA 3SHRA 2VWAA 1NCQA 3ZYPA 3INAA 4WZXA 2W61A 4FPGA 3A21A 2EA6A 2CU5A 4XZCA 4OHZA 3UKTA 4YG0A 3UU4A 2PYTA 1U12A 1ND2C 5KXDA 4LBNA 2VVFA 3AFKA 4WM7A 1V6OA 4NHMA 1JZ4A 1FT9A 1IAPA 4OFZA 4Z82A 1LOCA 1OUSA 1LB2A 5AQUB 3CNAA 2CM0A 5L2LA 4QWNB 1WCRA 4XF1A 5FMCA 3QOFA 1RUC1 5AFEA 4QXBB 1HQLA 4O7XA 1VALA 4QU2A 4NO4A 5HBAA 3IPVA 4WBOA 3AEFA 4LNVA 4RQPA 4CCCA 5C9AC 5KHGA 5AQOB 2C2VS 4ZONA 4COUA 1OWAA 5A6QA 2WFPA 2E51A 1O5UA 4JV5T 4L99A 2BS2A 2R16A 2CWOA 4HKLA 2WO1A 5IVVA 1KEXA 5K0UC 1CAUB 1IBMT 1OMIA 2BERA 3JCIA 4JDMA 3U14A 2VPDA 1JS9A 2WSVA 3WQ1A 4PDWA 2P6HA 3ZT5A 2LRKA 4CU8A 2PHRA 4RFT0 1VB4A 3NQHA 4LO4B 4D69A 4MSVA 1TQ5A 1PIV3 5FPBA 3USUA 2W1WA 5JDNA 3WAKA 2EHOD 5JDFA 3NV3A 5GLWA 2C4XA 5TDRA 1DYPA 4GKKT 4IGOA 5FR3A 3LVQE 4I01A 4GA9A 5FK7A 5FYSA 1RB8G 3E22E 1XBFA 1ACCA 2ZX2A 3MIEA 5FYTA 2AZ5A 1OURA 3UESA 4WM7C 3RVHA 1HYJA 1LVKA 1JYVA 1T72A 3P4WA 5AC92 4Q4X2 1E1HB 3ZN1B 2JMHA 1I3HA 1VRH3 4Q26A 3VKOA 3WD5A 3SC7X 4AW7A 4UF0A 3B9IA 1OLRA 2DCZA 3K2OA 2QUOA 1JODA 3K8PC 3IT8A 1X8MA 3L2YA 2E63A 5LMUT 1WE9A 1TMF3 4TLFA 1WYBA 2FCTA 4OUEA 3BODA 2ZZQA 5C3QA 2XONA 5DINA 5C7GA 4ISRA 5FERA 3T1HT 1W39A 2IIUA 4HG6B 2BKNA 1SFYA 2WQZC 1SHZC 2XHEB 3Q5EA 2DCYA 1CX1A 2OQ7A 4Q27A 1B35A 3FJSA 2HWE3 2TUNA 3QUJA 2OVUA 4A7YA 2BVBA 4H9RC 2X5IA 1YHFA 1LJ7A 1JYIA 1T6GC 2BV4A 2JDNA 1D0ZA 3QC9A 1CESA 1GWKA 4GH4C 3U1XA 3LEKA 5EK3A 2XQXA 4UP5A 3HIFA 3SWHA 2YREA 1PMHX 2VASA 2IXHA 5HXMA 4DR5T 4H14A 4XABA 3VGIA 5SV5A 4ZI2C 2IFRA 2EIBA 3C64A 3AKSA 3WNNA 4WM7B 3ZR5A 3PUQA 1BBT3 5EXOA 2ARCA 3LDRA 4GMP3 3ASLA 1WD3A 2JIJA 3C5KA 1QLBA 3OTFA 1MM3A 4AVCA 4CQIA 5JR7B 1LOBA 3TEZA 2LLYA 1DGWA 2JIWA 2NMNA 5JDGA 1PK6A 4LTAA 4FOYA 3T2TA 5BR8T 2VNRA 2B76A 5FP8A 2ZGSA 1H9PA 5LK7B 3IB3A 2BBHA 1VRH1 2Y6GA 4GWMA 1AJOA 3AE2A 2XASB 3AKTA 3H7YA 3ZXDA 3IWZA 2A5ZA 4YVWC 1VBE1 4DV3T 4LMJA 2F4VT 4HK8A 2XVGA 3P4QA 4NUUA 3CJXA 1C8M3 1UKGA 2LTNA 2RS12 4DIDB 4DXRA 1H8VA 4JTNA 2WR9A 1EY2A 2WABA 1Z2QA 3H1WA 1ODMA 1XDOA 4CDUA 5A70A 1JOJA 1QIQA 4Y1VA 2H0DB 2D98A 4AP4A 2WWUA 5DQ0A 4CP1A 1PX4A 2A70A 1GMMA 2BVVA 1H2KA 2G1MA 2P17A 1N33T 1X82A 3O7AA 4JDOA 4AUQB 1VMJA 1S1AA 2QNKA 5L36A 4Z0OA 2XQRA 1JM7A 4NHKA 2V6YB 4COZA 4G4FA 2GNDA 2VQET 1G9BA 4FOVA 3WXPA 1XE7A 2YPJA 1OSGA 5D1MB 4LORA 1K5MA 2NZ9A 2FDGA 1XWMA 3X1DA 4I30A 2GH2A 1H30A 3JAFA 4O8SA 2RS33 5LRSA 2WN2A 2J42A 5AITA 3O1RA 5TAOA 5CA1E 3RTRB 4I3PA 4NIQA 4JC1A 4AFAA 3ZFEA 1IYMA 1C8NA 2JDPA 2P57A 1POQA 2E6VA 4ISQA 3ZYLA 5C5TA 2X5IB 3HL6A 3AX4A 4XDPA 2OA2A 4F8AA 2JE7A 5AC91 4NN0A 3RIAA 5DZGA 5TDWA 1Z7S2 1A34A 5GM0A 3IDEA 4C1XA 3EI0A 4U7IA 2D5FA 2OUJA 4Z2AA 3KQRA 2MEV1 2XOCA 2G9ZA 4AQSA 4KGQA 5IWAT 1IBKT 1OF4A 4N78D 5HXRA 3DECA 5KH3A 4JGZB 4WNKA 2CLYC 5LBCA 3UK9A 5JDHA 2CDPA 3WDYA 3ZYGA 4H55A 3WAJA 2YDSA 2BVLA 4U3CA 4XFAA 1RUC3 3GNEA 2WDBA 3PUXF 2J4GA 3CKHA 3AVRA 3ZN5A 4MV2A 3VBSB 1VRBA 3EDVA 3OPTA 2X68A 1PX3A 2WWJA 5GJ6A 4NOTA 5JDMA 2DFBA 3NJXA 4UVBB 1I94T 3ORJA 4M00A 1FNYA 2H7OA 2LXPC 3AZVA 3K46A 3NVOA 3G06A 1B7TA 5FPLA 2WO3A 3OG2A 3C4ZA 2RS31 1I5ZA 1KFUL 1NA1C 4ZKTB 5C3JA 2K9AA 2WINB 2XQ5A 3EB5A 3J8F1 1YI7A 1E4UA 2JRKA 3B93A 4N9HA 4RD7A 2ZCWA 1ZA4A 1T6BX 4AWDA 5ACA2 5T54A 4IEYA 2QZ2A 2IC9A 1HRI1 3EBRA 1DGRN 3JZVA 1T1HA 1GQPA 1OLME 4LEJA 2LM2A 3N7MA 3VDDB 3BALA 2B1EA 3ABZA 1YJKA 1OFSA 3ZMNA 2PLV3 3WF0A 4Q0UA 5GZFA 4QPIC 4CCEA 4QD2A 3KVAA 3WHTA 1U5YA 1V6IA 3OY8A 1V6LA 5IHRA 4JI8T 2EALA 5FRAA 2WJSA 1SLCA 3PLQA 4HN0A 4CU7A 3VB9A 1SHWB 3VDCA 4AVAA 2CSYA 1TME3 2GH8A 1SBEA 1HB3A 3GBFA 3E5UA 3H3LA 2ZHKA 1ZNPA 3JUUA 4A4CA 5JSRA 4CUCA 1AR81 1V6KA 2VVEA 1C5IA 4W6YA 3K1SA 3M3EA 4OMCA 3LDBA 4BMBA 4HE8A 2HWB3 2IXKA 2W9XA 1X79A 4IL9A 5FZ0A 2JG9B 2GMEA 3WNMA 5LHGB 2GC3A 3FL7A 4COYA 2VCMA 1D2QA 3H9AA 1PIV2 2VCCA 3H0OA 2DDUA 1YCIA 5FLHA 4OI2A 5HCBA 2W2IA 4IV1A 3P6BA 4Q0SA 3CJIB 4D8MA 2ZAAA 3N9PA 1NAEA 4UW6A 4ILUA 1SACA 3HD8B 4PPEA 3RRDA 4A0CD 1W06A 4CDWA 2VG9A 1PZ9A 3H7HA 4BLIA 3M8LA 3LQCA 5CJ5A 3AP5A 5HWXA 2AEZA 4Y24A 4P5OB 1AR91 3EXUA 4Q0VA 1DZTA 4CN6A 3AMMA 2FUPA 3P7IA 4I09A 4ES8A 2DCTA 4CUAA 2C1FA 4LA2A 4LE3A 3UJQA 5J96B 4LBLA 3ZKUA 1GP4A 4X3GA 1W9WA 1WLTA 5CBLA 3MZHA 2XQ4A 4RSUA 4CEYA 1MMDA 1ENRA 2R042 2DWGA 4OHXA 2ZGKA 5I0RA 4XDOA 3O1IA 2CHHA 3NG2A 1GNYA 2N9DA 1PK6B 4QKFA 2OV9A 3S5QA 4Q4X3 2ES0A 4PF1A 3ZFGB 3T8OA 4CI1B 5J37A 1AXKA 3ZX7A 4A41A 1G25A 4MHUA 2YDRA 3RFRA 5B2GB 1IHMA 4BQ4A 3LD8A 4EB6E 3AZWA 2PLV2 1KEYA 3WNXA 2YGMA 2NR4A 2BW8A 1F4AA 4DR6T 3D4KA 1UMZA 3J7Yq 1I9RA 4JZRA 5FZ9A 2BNMA 3PE0A 2XMLA 5FP7A 2MA6A 2L7PA 1ZVFA 3RPUA 4E4HA 5GLTA 4AGVA 2VMFA 1O6UA 1DQ6A 1FAYA 1M06G 1KDMA 4A97A 2R062 3WQ7A 5C4WB 4CPBD 4J1WA 5FO9B 3O1UA 4OI1A 2JDHA 2DSMA 3PVBB 1BYHA 4NMIA 5LMNT 1ZKEA 3CL1A 3AZYA 1ND3B 3HPNA 4BA6A 3JD72 4N53C 1FOD3 4QX1A 4AVBA 5EJZB 5JR9C 4LBKA 2QQKA 1J3RA 2DVBA 1WEEA 4P5HA 4O61A 2CA5A 1LOAA 5FO7B 5K7PA 2DCJA 5IFTA 2LUWA 3SH3A 4RS5C 1QJU2 1SLAA 2XJTA 4OX9T 3AE1A 2D3PA 1ALYA 2VURA 3WINE 2E7TA 2XWBB 4DRVA 2YY1A 2PLV1 1BEV3 2W2UA 4Y5TA 1QQP1 1R1A3 3LB9A 3TRSB 1OXCA 1FPN1 2F6JA 4QGNA 4HFCA 4LFAT 5H1TA 1FJGT 4TSVA 2RSDA 1DGLA 4HOOA 1LRHA 1AX2A 5JI9A 2WZEA 1AUYA 1IPSA 3DPLR 4X66T 4Y33A 5CKMA 1JHNA 3SOXA 3A0KA 2IHR1 4KBZA 2Y6XA 5L3GB 2BOIA 2E2AA 3IF8B 2X29A 3L2HA 4AHYA 4UXAA 4S2HA 2E7QA 5FPZA 5ABHA 1D0HA 4EYYR 4O64A 2P37A 2RDQA 2B45X 3VL8A 3ZSMA 1WRDA 2HH9A 3I1AA 3UFGA 1OBNA 2VE1A 2R6QA 3LIHA 3VBOB 3M1HA 1TME1 4TN7A 3ETVA 4B1MA 1C57A 3MW4A 3R4UA 1Y9QA 1S0DA 3VD4A 4HXCA 2MNYA 2P3IA 1UOFA 3ALQA 2VB6A 3WG2A 2QQVA 4FPFA 2H0DA 3F95A 1J83A 3VRBA 1ZZ9A 2ORZA 4ONUA 1VBC1 3F31A 1MACA 3VDDC 4GK5E 4MHCA 2WC2A 2XHNA 2YV8A 4FQ4A 4AYCA 3NL1A 4KMCA 4D94A 3PUHA 5KMGP 5FZ8A 1FP0A 2ZGMA 3A7MA 4FPOB 3N2GE 5KWRA 1RHI2 1XQNA 3S57A 3ETUA 2WB5A 2HBTA 4WM8B 5FK8A 3Q8FA 4S2DA 3I2KA 2WZIA 5CZKA 1MVQA 3B9CA 1WILA 1NCQB 2JEMA 4A5XA 4D6RA 1BJQA 2B7YA 4ZXEA 3DPRA 4G2AA 2EXUA 1QHDA 5F32A 3RHWA 2IXLA 1ULCA 2KXPB 3VZNA 2VAUA 2JUNA 5AQNB 4DMIA 3VV1A 4FVVA 2CHOA 4IV3B 4LLFA 3AXJB 3ZJ1A 1COV1 4L9BA 3IMNA 1BORA 2EVXA 3P5BA 3N9LA 1R8IA 4H9QC 2WAUA 1EAH3 2VM9A 1RUF1 3B7MA 1LOGA 5JCTA 5FWJA 1QQP2 3MK7C 3RZKA 5KHKA 1CJPA 1N1YA 2X9WA 3AB3B 3KGLA 4PQ9A 1RL3A 3VHPA 2Q9QD 1F5FA 1RUH2 2PMWB 1C4RA 5JRCB 1P8JA 3I49A 3ON7A 4P5YA 2KMFA 4PLOA 1W0NA 5T5PA 5FY5A 5HCHA 3I2JA 1J3QA 3R84B 3JB8A 5CADA 5E89A 3TKLB 4AQ6A 3ZXJA 1NT0A 1Q3EA 1W0AA 2R30A 3TNPB 4EQVA 1RIRA 4YATA 3N7LA 1UOGA 1DQ0A 2FHRA 3HNYM 1EP0A 2CWSA 2WQYA 5SV8A 3OGRA 2OA5A 3FZ3A 2D6PA 2CSZA 4BYYA 1EV11 3VRAA 4U2ZA 2VL8A 4TWTA 4JRAA 1NUKA 5GLZA 2FMYA 3PUGA 5JIAA 1QMJA 4IXLA 4L0PA 1QOTA 3IBPA 1G9AA 4QX2A 2KXLA 1KJLA 2KD7A 2WWSA 1B35B 1SMVA 4OYKA 4X1IE 2J62A 2YYRA 4H9PC 4YTPA 3EB7A 4JKLA 3NV1A 3R4SA 2JE8A 1CHCA 3ZPVE 3VDAA 2LOPA 3VUOA 2BKOA 4QF3A 3WT3A 3WQ0A 3WQBA 1HG2A 2UXBT 2MA5A 4N53B 1XNKA 1ENQA 3KVBA 3IHRA 2EHOC 3O0XA 1ZRCA 4COFA 4EAHA 1RUF2 4HVQA 4TNWA 2BNNA 4N43C 3ZFEB 2X0HA 3K75B 4XBQA 2VQTA 1ZV4X 4FFIA 4JGYA 4Z1VA 5L9VA 5DXDA 2XQ7A 3MJXA 4IE4A 1NA1B 1HB1A 3ELNA 2D3SA 4A7KA 1NXD1 1JU3A 4PT6A 4YG3A 2YBKA 2PFVA 4GKXA 1D1AA 2VMHA 4AEMA 4G9SB 1FX5A 1DZRA 3U5OA 3QBQA 4HPKA 4XUOA 3ZXAC 2Y6JA 3PTYA 1NENA 3OBRA 3NRYA 1MEC1 3ZYQA 1FV3A 1UW8A 1W6PA 4OUMA 1F2NA 3C7EA 5FMBA 2DWKA 5CAZA 5A7QA 3RKOA 5LA0A 2UXXB 1CIWA 2WNVB 4Y20B 2AUYA 1PM7A 5LGTB 5EJ1B 4QAWA 2BPA2 3U10A 4ASLA 3AP4A 2GNTA 4XAAA 3URFA 3W59A 2WNOA 3ZYKA 1DDLA 5B76A 5L47A 1JUIA 2FUIA 3QH6A 5J2TE 4NHLA 1PGL1 4TLGA 3O34A 3W15B 2DURA 4H9DA 2ZX3A 5C8CC 2ENRA 4BH9A 3IMMA 1N3OA 1N3QA 1Q56A 4BWOA 1PM4A 1RUE1 1O3XA 3KT7A 5GKAC 2HJIA 2QQWA 4RN5A 1WBFA 4W6WA 3P4PA 1TME2 2XB1A 5C71A 5C5UA 4PTBA 4R8PK 3ABVA 4LUKA 4IE7A 4AIUA 4YTMA 2EIDA 1SLTA 3FZMB 1W9RA 3AJZA 1H1MA 2IC1A 3JXSA 4QXHA 4AI1A 5A3LA 2IW5B 3KLSA 2PHDA 2V4AA 3LFMA 3C2UA 3D0SA 2TBVA 2C9KA 2XKOA 2NTYA 5G0FA 3BTAA 4I7CA 1IPKA 4CEYC 4GALA 4KGGA 3I3MA 2PAEA 4I2OA 3BU0A 3PUWF 2OS2A 4MOAA 2WO7A 4GMP1 2QGSA 4I3GA 5IYYA 2PFWA 4TV8E 4E7SA 4L11A 1QJY3 3UUXB 1AYN3 4KU8A 2LGGA 4YHJA 2QZ3A 3WX5A 3P8CD 3PNAA 2WNVA 2Q1FA 1RUJ3 1WMDA 3H50A 2IWGB 4W6XA 3VKLA 3DQVR 2JPFA 1GLHA 4QQ2A 4OVEA 4OQ8A 1W2NA 2HWD3 3C50A 2ODUA 2VJEB 1V9U1 1W03A 1YNAA 4MXVA 4TZ4C 2B9UA 2R32A 2WSSV 1LU1A 3SOUA 2ARBA 4DBRA 3H7JA 5LEJA 5FZIA 3OGVA 1SFNA 4QX8A 3SFEA 3LA7A 2WMOA 4EWDA 2LRPA 2ODVA 1AVBA 3KV9A 2WZR1 5C9AB 4LR4A 4Y1XA 1PIV1 4TXWA 3ZVZB 2UXNB 5FY0A 2VTFA 1CAWA 4B4QA 5T5LA 4AQ2A 2KWHA 5GLUA 2YUCA 4V3KC 4K20A 3SCHA 2KWKA 1NX9A 5D1LB 3FLRA 3UGHA 1LGNA 3PIGA 3LAGA 1F9KA 2XBO1 2WMNA 2CSGA 5A6ZA 2VNVA 4HGAA 3USUB 2W66A 1UWWA 5A1AA 3AP9A 2W95A 1CGPA 2XVLA 3O1MA 4X8PA 3HQXA 1RYYA 3O14A 2VZPA 2Q0AA 3LK2B 3ZYMA 3O70A 5G05L 5KX5E 4LXLA 5E1RA 5FYVA 2QQLA 2Y6LA 4IERA 4DB5A 4N53A 5BNPB 5FZAA 5F39A 4ISTA 5JG6A 4LO5B 5IUXA 2NOXA 4KWJA 2R063 5KBFA 3I9YA 1W6NA 5C8CB 5KHJA 1BR2A 5FQ0A 4QGMA 3PJAJ 3T6RA 3NO8A 3HOBA 1DQ1A 1GSLA 4JGZA 1YW0A 5ISLA 1NCRA 1EZ3A 3WDVA 1AYM1 3NNLA 2CGOA 5FXXA 3KS7A 3A8YC 5AFUL 2FDFA 2X9XA 1HG5A 3ASIA 3C7FA 5JWPA 4R7EA 3MACA 4O62A 4AHXA 3OJBA 3RYCE 5L7OB 4CCGX 4XZUG 3OY8B 4B7KA 2E9XC 3D5OA 5BNNC 3P3PA 3BU7A 4DV2T 1RGSA 1XNQT 3QB5A 4LE4A 3I59B 2V72A 2WNEA 5FZ7A 3W5MA 4IDOA 3SXWA 1FBVA 2VUDA 5E16A 4N7IA 1PGW1 4OGEA 2B8MA 3QB5K 1ZRIA 1AR63 1WFKA 1UYXA 4K1ZA 2QQIA 4DXZA 4PJMA 2QRXA 1JNRA 3P1IA 3F2EA 3Q8EA 1JYNA 3LQJA 2QDRA 1DFQA 4WZ2A 4UFJA 4B4RA 2H0BA 1DCQA 3M3CA 4XXPA 3CDZB 4EGWA 1ZBE1 4BHWA 3HT2A 3OBAA 1K5MB 1N3PA 3ACIA 1WEOA 1XWHA 4L58A 4MXWB 3FJUB 1FXZA 3T2PA 2AH2A 2OWAA 3GCXA 4O4LE 4PBOA 2V09A 2PTFA 4CXYA 1VAMA 3ZMUB 2LT3A 1QSDA 4HFHA 5LBMA 2P1BA 3NRUA 1N1TA 2HYXA 4BOWA 4JDNA 5HV0A 3T4VA 2XPKA 1WCUA 4GH4A 3MBWA 3O36A 1GV9A 4DR2T 2CGPA 4SLIA 3H1MA 2RS51 3U3IA 1EAH1 5LCYA 4GMP0 4ZPIA 4S3OB 2JG8C 1J5WA 1AL23 2ZA9A 2OPKA 1QQP3 4PFOA 1Q5OA 3DKWA 3IPVB 2AXDS 1H1AA 1WA6X 2WN3A 4BQ1A 5H1UA 3VBRA 4AR2A 5FJKA 3FC0A 2WLQA 3TLWA 1RUD1 1O59A 3HN1A 3ZSJA 2W4XA 1REDA 4IEOA 2ZM0A 2YMZA 1W0OA 1BKZA 1OH3A 1TE1B 2BZDA 4UFMA 4AG4A 3LWCA 1W6MA 2Z42A 2XSAA 3MV01 1RUD3 2KKYA 2PJQA 2L75A 4LKFA 4JI5T 1DGWX 2A3XA 4TWDA 1QXJA 1AR83 1VBB2 5CG8A