3PUQA

Cekdm7a from c.elegans, complex with alpha-kg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
516
structure length
472
Chain Sequence
TPKESDRCGGCGKFTNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 7 homolog
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 148
structure length 472
sequence length 516
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3puqA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3puqA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3puqA01
5LKXA 2YBSA 5FPVA 3EB6A 2G6QA 1WEVA 2RI7A 4O64A 5FB1A 3RPGB 3O70A 5FZDA 2PUYA 2MT5A 4Q6FA 2VJEA 2KIZA 2MIQA 2HDPA 3DXUA 3PHDA 1X4UA 2DX8A 4GNFA 5FZCA 5FPBA 1WE9A 4LIVA 4GAZA 2HYED 5E6HA 1WFKA 2K16A 5IVFA 5FY5A 5FZFA 2E6SA 5A3PA 3M99A 1BORA 4V2WA 1X4JA 3U5OA 5FZOB 1FP0A 2ECVA 5A7SA 2W2IA 5H9MA 5F3EA 4YAXA 3O34A 2C2LA 4IC2A 5I3LA 2YQLA 5H1VA 2LXPC 3ZVZB 5DKAA 4QF2A 3AVRA 3LQHA 4LK9A 4S3OC 5FY0A 2FUUA 5LKUA 1WEEA 5B8DA 5FZ6A 4Y3OA 2LGVA 2K4DA 4QXCA 3UYJA 5FZKA 3M63A 5LCWB 4UF0A 4GNGA 4QX8A 3U5PA 4E4HA 3C6WA 5FP7A 2F6NA 3KV9A 1X4IA 5FV3A 3VK6A 5FJHA 2YURA 4QXBA 5FUNA 5D1MB 4CA1A 3HTKC 4I7DA 5LWBA 4MVTA 5FYHA 2D8SA 5LKTA 1IYMA 4IC3A 3LD8A 2LXHC 3ZTGA 5B77A 5F2WA 4A49A 5KH9A 2CKLB 4R2YA 5A7WB 1LDKC 1JM7B 4YADA 5FZ8A 2NAAA 3ZLIA 2ECNA 2VJFA 5FZ4A 4TKPB 2CSYA 5C11A 3U5NA 1G25A 4D6QA 4WZ0A 3DXTA 2VJEB 2EGPA 4QF3A 2WWUA 5FZAA 5FPLA 2VD7A 2MNZA 3U5MA 4NN2A 1DVPA 5JG6A 2YPDA 5FYMA 2JMIA 3AVSA 2YUCA 4FO9A 4V3LC 4YBSA 3N9QA 4DIQA 3HCUA 5FXZA 5FEYA 2OS2A 2F6JA 2OT7A 2H0DA 5IVJA 5FP8A 2VPGA 5FXWA 2IDAA 5K4LA 4F52B 4BU2A 2QIZA 5LY1A 3PUAA 5FYIA 5FYTA 5IVCA 3KV4A 2M3HA 5A1LA 2LV9A 5FJKA 3KQIA 4QWNA 5ANQA 4YBMA 5ISLA 3ZPOA 4PTBA 4L7XA 5FWEA 5FY8A 5FZHA 1Z2QA 1VRBA 3N9LA 3HCTA 4QX7A 5FZ0A 2YSMA 4GD4A 5FXVA 3ZNIA 2YU2A 5F3IA 1WIMA 4CCNA 1WEQA 2KGIA 2L5UA 4C9ZA 5FERA 5A3TA 3K2OA 2LQ6A 4IGQA 2GP3A 3SOUA 5FWJA 4I7BA 2KREA 3PU8A 4S3OB 3O7AA 2JRJA 2Q8DA 4CCOA 4L58A 5C13A 2LN0A 3PUQA 5FPUA 4UI9B 2OQ6A 5A3NA 3O37A 2UZGA 4GNDA 2XXZA 5IWFA 2Y43A 5G0FA 2MNYA 4AYCB 3KVBA 4BISA 2VJFB 5A7NA 1V87A 2E6RA 3MHHA 2K1JA 5F32A 2ECIA 2EODA 3O35A 2M1RA 4FJCA 3ZPVE 4EYUA 4FIPA 3OPWA 3U78A 4GNEA 5A7PA 5B79A 1E4UA 2P5BA 4NUBA 1LDJB 5FY4A 4LKAA 5FPAA 3U4SA 4PPEA 3LQJA 3HCSA 1VYXA 2M85A 2YHNA 5TDWA 3L11A 3GV4A 5G05B 4YATA 2PXJA 5EYAF 5FP9A 1HYIA 1MM2A 3L1ZB 2L75A 5FZMA 4V2VA 2M6MA 5FZ7A 3SHBA 4UP5A 5FY7A 5FZ3A 5FY9A 2WWJA 1ZBDB 3I2DA 1XWHA 5FYCA 3C5KA 5FP4A 1MM3A 2LGLA 5FYYA 4HOOA 4CSWA 5LY2A 3RVHA 4EZHA 2XMLA 2Y1MA 4HONA 2ZETC 3O36A 1WEOA 4D6RA 4AI9A 3N9NA 2YREA 3SOXA 5F39A 3QZVA 4XDPA 3DQVR 4XI1A 5FZOA 5FZLA 1WEWA 5FP3A 5FUPA 2JMDA 4BHWA 5FYVA 5A7OA 4CCLA 4CUGA 4LJNA 1WILA 2KYUA 4CCGX 2GP5A 2L80A 5H1UA 2VPDA 2XB1A 3IHPA 2KWOA 2BAYA 2YT5A 4YBTA 5F3CA 3L1XA 5F3GA 3SOWA 3LRQA 4I7CA 4XDOA 5TRBA 3KVAA 2QICA 3PU3A 2ECWA 5F5AA 5DINA 2AN6A 5IVYA 4WA6A 3T7LA 4CCKA 2VPBA 2MD7B 4Y4RA 5FYBA 2MUMA 4URAA 4UF0B 4WZ2A 4IGOA 4R7EA 3KV5A 5FZBA 5TABA 5FYSA 2MA6A 5FZIA 4Y33A 2G43A 3DPLR 4N4FA 3ZPV1 5F5IA 2YBKA 4YC9A 5KH3A 5CEHA 5B78A 2CKLA 1WGMA 5A7WA 1JM7A 2JMJA 3N9MA 3RTRB 5KH7A 2I50A 2QJ0A 4FK5A 1K2FA 1Z60A 3PTRB 2XDVA 1JOCA 3GL6A 2KU3A 4A4BA 4BBQA 2LGGA 4LITA 5A1FA 5D1LB 2YW8A 5TDRA 3PURA 1WEMA 4D6SA 5IVBA 5IW0A 3M62A 2Q8CA 4P5OB 1WESA 2KWJA 5B75A 4TN7A 4R8PK 2RSDA 3LQIA 5FZ9A 2YU1A 2YYRA 4WZ3B 5A3WA 5D1KB 2EA6A 5IVEA 2ECJA 2YQMA 2XUEA 2K17A 4LADB 2YSJA 5G04B 3RPGC 5FYUA 1VFYA 3KV6A 2KE1A 4V3KC 4ZQLA 2KWNA 3PUSA 2Y1NA 2LDRA 1WEUA 2H0DB 3ASLA 3KNVA 2LGKA 2YHOA 2YBPA 3AL5A 1RMDA 3MHSA 4W4UA 4A4CA 4X3GA 2KGGA 1F62A 4ASKA 4QU1A 5FZEA 4B86C 3FL2A 3EB5A 5FZ1A 2KR4A 4CCJA 2CSZA 5J3XA 2XEUA 4GJYA 5B76A 4EZ4A 5AIUA 5LKZA 4AAPA 4DO0A 4BXFA 2F42A 4LXLA 2VPEA 2OX0A 2VNFA 3N9OA 1N87A 5FZGA 2OQ7A 2MD8C 4LIUA 4AUQB 5KR7A 5FY1A 4C8DA 2L0BA 4LLBA 2OXQC 3OPTA 2L43A 1VD4A 4N3WA 4IGPA 5IVVA 5F37A 3T6RA 5A80A 1T1HA 5FXXA 4QXHA 3N9PA 4MSXA 4AYCA 4ZDTA 4UP0A 5F5CA 5F2SA 2ECTA 1CHCA 1U6GB 5LW9A 3PDQA 5FYZA 4GB0A 3K3OA 1WENA 2KWKA 3LDBA 2KFTA 3K3NA 4AVXA 2G45A 4AP4A 4YABA 5A7QA 2PNXA 5FB0A 4B7YC 2FSAA 2CT2A 5H1TA 3AL6A 4CCMA 2LRIC 1HYJA 3V43A 2Q8EA 2VP7A 3ZVYA 1WEPA 1FBVA 2YU4A 3O33A 3NG2A 5TBNA 4ZUXU 4A0CD 1Z6UA 3ZYQA 2C2VS 5FBJA 2FUIA 2MA5A 3NJYA 2ECGA 5AITA 4GJZA
chains in the Genus database with same CATH superfamily
5FRAA 2OZJA 5CBLA 1FEWA 1UCXA 2RI7A 5FZDA 1RB8G 3UU3A 3EHKA 4FPLA 2Q8OA 4X64T 3J8F3 3M7AA 1AR63 1QQP2 4PBPA 4C0BA 3RIUC 4P9JA 5CIRA 4C0HA 3HI2A 4AZZA 1CAVB 2VR4A 3OOXA 3SH5A 4B3MT 3VD9A 1TZOA 4XHBA 5C7GA 5D8AC 5HEGA 3GJBA 4P1NA 5IYYA 1I1EA 1X9BA 1W04A 5JVDE 2WS92 1AJKA 5C3RA 2PAKA 1X4IA 2LT3A 3K51A 5FV3A 1R1A1 4GWMA 2BG9B 1KFYA 2XAJB 2VTXA 3FANA 2X10A 4CA1A 4O8SA 1IYMA 3LD8A 1UF2C 3WZ1A 2B46X 2R063 3ZYKA 3EB7A 2NW9A 3RYIE 4DRRA 1HLCA 3NV4A 4X65T 4X6QB 4AQFA 3ZM8A 3ZYPA 2YMZA 3ZXFA 2YUEA 1SBFA 3Q8CA 5T55A 1RUD2 4BJMA 1FMVA 5FPZA 2YUCA 4AKGA 2V4AA 4LPLA 1QJEA 1NXMA 1ND2C 1WMEA 3J7MA 2YDQA 3MXZA 3SRZA 5FYTA 4Z8XA 4FSJA 1A8MA 3MDPA 5ACA3 5GLVA 5ANQA 3UJOA 4PTBA 1B09A 4BMBA 2YSMA 4UOJA 2XH6A 4I7BA 5IAVA 2NW8A 2C6SA 1MMNA 1LOFC 5CFCB 1GNZA 1OOPB 2IC6A 2FQPA 5E16A 2UZGA 4X1KE 5HYAA 4Y5SA 4COYA 3OBTA 3QCWA 2D6MA 2Z5WA 2K48A 3V0BA 3UKVA 1WYCA 2K1JA 4EIWA 1RUI3 1HTJF 3F57A 1QNWA 4DV7T 2WSVA 4EYUA 3WAJA 1E4UA 1SHZC 4RFRB 5SVYA 2JDYA 5J0ZA 5FCCA 4AVCA 4PPEA 4AVTA 1NT0A 4XF9A 2E9XD 1IZ3A 5L3BB 3BTYA 2WWSA 3WNKA 2XGXA 2PHLA 4H9QC 4IDZA 3POSA 4X8PA 2W52A 2GMMA 2LGLA 2MOZA 1VMFA 3ZN4A 1NY71 4YG3A 5C8WA 3O9XA 4D6RA 3N9NA 4D0QA 1YFUA 1W2AX 1KJRA 5AQFB 3HAGA 2VBPA 5FZOA 2JMDA 1R082 2WDVA 1IBMT 4QHOA 3L1XA 2DF7A 4OULA 5LNKA 3SOWA 1ULCA 1LJ7A 2IHR1 2A6XA 1MS4A 1OVPA 4TWDA 1YXWA 2XJTA 1ZZCA 5DG2A 1PIV2 1HB2A 4JI3T 1RUJ3 4DPNA 2IAKA 4GH4B 3I7DA 5H6RB 4Y22A 4EJRA 2ZX1A 4NPMA 1PGSA 1G9AA 5LB6A 2G43A 3CIHA 1W0NA 1XJAA 2XQAA 3OTFA 4AE2A 5FUIA 2CKLA 5BPXA 2WAOA 1DZQA 1Z0HA 1PVC3 1UL9A 3SH4A 1BJQA 1CAWB 3O7OA 2QCSB 2DCFA 1MS1A 4YSYA 1D7PM 4K1YA 2KWJA 1UYYA 2JB8A 2XL7A 1D0ZA 1UMHA 1XMOT 3E5XA 1LEMA 1BMV1 1FX5A 4K8FA 1PO11 3RS6A 4YARA 1LVFA 3PMSA 5I0TA 4WM7B 4TNVA 4CU8A 1K45A 4TYSA 1RMDA 3UFGA 4QKDA 3FL2A 1N3OA 4CCDA 3VR9A 3H3UA 1N3PA 1MZ5A 2NZ9A 2Y38A 1EPZA 2WAUA 1FMD1 2BKNA 2HWD3 4AI8A 3V0AB 5JSPA 1K5JA 2L0BA 4ORFA 3WSOA 5KXEA 4E2QA 4GQ7A 3K3QC 1MR5A 1GZCA 3LEMA 4R9CA 5AQLB 2ETEA 3AX4A 2CV6A 3W5MA 3P7IA 1XYNA 1D0GA 1SPPA 1OA3A 2B5HA 2XUMA 5HXMA 3NJXA 1L7QA 3VKNA 1WBFA 1WR6A 2V7LA 2ATFA 2P37A 5H1TA 3U37A 2QGSA 2XSAA 4YVSB 1MQTB 4FTEA 3AAEB 3VBRC 1E1HB 1REFA 4XUTA 3H3LA 2XBO1 1W0BA 4WVWA 4CZZB 1GZWA 4IREA 1AR92 5FKCA 3WUDA 3PLWA 4JDMA 2ILMA 2VKJA 1EZ3A 2V7JA 2XHKA 1VIWB 5FZFA 1D4M1 1FP0A 2RV9A 3JD72 5LMNT 1V70A 1SA0E 5CA6A 2C2LA 4XQWA 5I3LA 2YQLA 2X68A 1NLRA 4ILCA 2W3JA 4JV4A 5H1VA 2JMKA 4Q1RA 3RHWA 4YY3T 3CLPA 4DINB 1VBA3 4EN0A 3OD0A 5FZKA 2RDNA 5JR9A 2P3IA 4UF0A 2HWE2 4PBOA 3POJA 3USUA 1YXRA 4HWIB 3OTOT 3C6WA 5FP7A 3CHXA 2ZM0A 4GWNA 3WINE 2YURA 1COV2 4DEQA 3H8OA 1WLCA 4TSVA 5AC92 4KX6A 4TWFA 3LA7A 5F5WA 1JM7B 2XQ4A 1SCRA 1HCIA 1AXZA 1RHI3 2GC1A 2MYSA 2CSYA 4LF8T 2CYFA 3EO6A 3ZYJB 4C1XA 4JZRA 3U5NA 1V9DA 3KCYA 4M1PA 3PE0A 2CCQA 1K5MA 3VBHC 3H3ZA 5AQJB 5LASA 2EGPA 1YW0A 3WNPA 3VBOC 1VLNA 4QXKA 1XDPA 3CJXA 4NN2A 3AVSA 1XU2A 1F9KA 5KMGP 4FFIA 3W21A 2H0DA 1RXFA 5L2LA 3WHUA 4J1WA 4AXOA 2K9AA 5LY1A 3LVQE 2JPFA 3KV4A 1JYTA 3M3OA 3ZDSA 2C26A 2LV9A 4LKFA 2JUNA 3P6BA 2Y6GA 3ZN6A 2ZKLA 3LE0A 2QDNA 2XJ7A 4NPLA 5K7PA 3AE5A 3S4UA 2EHOC 2V5YA 4QX2A 3SOUA 3THTA 2A3XA 5KHGA 2MEV3 2VBBA 5A3LA 2CRWA 1QXJA 2UXXB 4GNDA 2GAUA 1XQNA 1D1AA 4LFCT 4IDOA 4LMLA 5CFDA 4DR5T 4P14A 3RYHE 5A7NA 1S4CA 2FJAA 3KD4A 3UETA 3IM0A 4BPZA 1W9YA 3PVOA 3CNAA 3DUIA 2D9DA 5ANNA 1MS9A 2WZHA 3LIHA 2HH9A 3IAQA 3B5LB 3AJZA 1DYOA 4LBKA 1HRI3 3W58A 3KDSE 4LEJA 1K12A 2W66A 2ZMAA 1BBT1 3HN3A 5TDWA 4PT6A 4S2GA 2MBGA 3FE5A 2C0ZA 5F5QA 2RM23 5JDLA 2ZGLA 1WD3A 4FCAA 4M0HA 4V2VA 5FZ7A 4XDQA 5L3DB 2VL8A 4UVBB 4L9IA 3M1HA 3WDTA 5IK8A 3ACGA 3CQXC 4MH0E 4NAMA 3ZYMA 3N7LA 5TAOA 4EOZB 3GF6A 2IXIA 3KBTA 3H7YA 3T1LA 2XLAA 4RYDA 3UKNA 5LP6E 4PIYA 4N53B 5F9TA 1VP6A 3E6BA 2UU8A 1W6PB 4MSVA 3IHPA 4WM7A 3C50A 3SMHA 5F3GA 3ES4A 2VL4A 1YYNA 3DEMA 4AVBA 2V8SV 2EIBA 2X9YA 4PJYA 2CAUA 3ZXDA 2VPBA 5C70A 4RS5C 5DZGA 1CPNA 1SLCA 2XTLA 1FAYA 4IGOA 4XTPA 4WZ2A 1PO13 4NWWA 3I3EA 3BTXA 2EIGA 4QDRA 3I0OA 4AKIA 2PHTA 3JAFA 5EPAA 2WRAA 1QXRA 4XCAA 3ZMSB 2EIDA 3SKJE 1X82A 1SFNA 3OGVA 3B5MA 4Z1VA 1JYNA 4DNDA 3KSCA 4A4BA 1CZTA 2R0FA 2Q8CA 1N34T 2PMWB 3U75A 4PFOA 3RLFF 2RSDA 3LQIA 3PUWF 5JCTA 1W3XA 3D3AA 3T2PA 2QZ3A 5HEJA 1VFYA 1CGPA 4W4ZA 1GU3A 3BTZA 1JZ3A 3ETPA 5J98B 2YHOA 2DYCA 3MHSA 5DG1A 4HZFA 1UURA 1CZSA 4B86C 3AXEA 5JDQA 1PO22 1UOGA 3W9AA 4OQ9A 5B76A 1OI6A 2CU5A 1W6QB 4QWNB 4AAPA 1OH3A 4YYOA 1JH5A 3VKMA 2PHFA 4JEHB 4IT4A 4KG8A 3ZT6A 1HNWT 2I07B 1LHOA 1O7FA 1YLLA 2XY8B 4FI5A 3RYKA 2OLTA 2WA3A 4FBFA 2AZ5A 2RS31 1AL21 2JENA 3WT3A 4AGGA 2I0MA 1H2MA 4KBZA 4CDUB 2BGPA 3TLVA 1G73A 2ZTNA 4OI4A 2GNMA 1BYHA 2ZMLA 5K3QA 2WO2A 4YZ1A 4UFHA 1ZZ8A 2DWGA 2HWF2 4FXGB 1X8MA 2YU4A 1IBKT 4NE9A 5L73A 2XJVA 5A3OA 1DBNA 3TOJA 3KWVA 2C2VS 5JREA 2WNUA 4PLNA 5HV0A 5FBJA 2JICA 4NUUA 3JBG1 4ZONA 5DQ0A 4CXYA 4KWLA 1MNEA 1DQ6A 2A7AA 3I49A 2EVXA 1GYKA 2G6QA 2VAUA 4J6GA 1OF3A 3E6CC 2VURA 5FO9B 4KHZF 4AVVA 4HGAA 3RX6A 3FX3A 5AQIB 5C8CB 3HD8B 1GUIA 1RIRA 5E6HA 1MMDA 3ZXKA 5A3PA 1ULGA 5ABJA 4BOWA 1YNAA 1LECA 3M4FA 1N3QA 3ACHA 5EZYE 4Q4W1 1BK0A 4DUXA 5JAXA 5DKAA 2LSJA 3A23A 3LQHA 1YRZA 2A3DA 5I8TA 3PLQA 2XPKA 4R9AA 4FPFA 1H9WA 3WLUA 4Y5Z0 1ND3B 2VXJA 3PVNA 1XNTA 4O4IE 3AKRA 2CGNA 4QXBA 3LB9A 4FAHA 3MPBA 2CRRA 1F31A 4AQ6A 1OSGA 1UIJA 3UFEA 4A49A 5I91A 3ZKRA 5A7WB 1J1JA 2CXFA 4BXSV 1GICA 4DV4T 5IHRA 1AXKA 3C4WA 3TNQA 4YM3A 3GXUA 3C7HA 2ZX3A 3HWJA 3UT0A 5JRCA 2VD7A 1W8WA 3WF3A 1QF3A 4YBSA 2D6NA 3SUBA 4LKDA 3TLWA 3I8TA 5KC6A 1RUC1 1POV0 4YW6A 1IPJA 2XVKA 3QB5A 1PK6B 3ZSJA 5L47A 3CJIC 2M6BA 4QX7A 2QNKA 5FZ0A 3ZNIA 1Q8SA 4HVRA 3V56A 2WNVC 3ZSKA 2YC4A 2A71A 1LHWA 2DU0A 4CA9A 2H0VA 4P0AA 4UAPA 3BPSA 5T5LA 5H9RA 5T5OA 4AFDA 5ERLA 2W63A 1FMWA 5JPNB 5FR3A 1LESA 1VBC2 1BEV1 3LEIA 2VNRA 3VRBA 3NRXA 3H9AA 3IIAA 3ITQA 4NPRA 3AYAA 3T4VA 3VZOA 5A6QA 2HEYF 2VVEA 2W91A 3DYOA 2M85A 1WGPA 4BDVB 5GJ6A 1HN0A 5K0UA 1PX3A 2Y60A 5AVPA 4XJZA 4CUAA 1JHNA 3NWIA 1D1BA 3SWHA 3M3CA 4QPGC 1KEXA 3DPRB 1CJPA 3MF9A 3U10A 2ZGPA 3RVHA 5DAVA 1UX7A 1V6LA 4I0UA 5JH7E 2WM9A 1DFQA 5CU1A 4PNIA 1B35B 4XDPA 4TXWA 3O14A 2GN7A 3L39A 4CCLA 4L92A 4NROA 2YT5A 4P09A 3AE7A 2ACZA 4DXRA 1HNZT 2WCAA 3E6DA 5L7OA 3SOLA 1Z7S2 2B9VA 4ATFA 1EY2A 4F8AA 2AN6A 2D98A 2D2SA 4JDNA 4Y20A 1ENRA 1QJY2 1UU6A 3GYDA 4EN8B 4MG2A 5JZGC 1EAH1 4Y33A 4MO3M 4XUNA 4FP2A 4EAHA 2ET7A 2WO3A 3SNMA 2E8IA 3ZMVB 2N7GA 4ARYA 5KHHA 3TEWA 2XDVA 1RUG3 3CL1A 2VVDA 4YW4A 5JPMB 2VMIA 3M62A 5LA2A 2YDRA 4HN1A 2KKXA 3UT5E 4U33A 2VZ3A 2HH7A 5CKMA 5T3NA 4UW4A 2V73A 4QPIA 2E6VA 2GALA 3RPGC 2FD8A 4YW1A 1KF6A 1CONA 5FOJB 2PN5A 5E0OA 3OY8B 3RQUA 5KDMC 3UTKA 4YW5A 3Q5WA 3TN91 2KGGA 4ASKA 4QU1A 5C4WC 2O8QA 3EI0A 2ZBJA 1MS5A 1SFYA 1UW8A 3H8XA 5LKZA 1AF9A 5GLUA 4D7YA 1W39A 4EGWA 4LKSA 4BQ5A 4LE3A 3TAYA 4AUQB 1PM7A 4RGKA 5AVAA 3ZMNA 4AOCA 3UUBA 1CPMA 3LAGA 2RS13 4LO7A 3JBG3 4IGPA 3I9WA 2DCZA 2HJIA 3RZGA 4RGAA 4Z91A 1O3QA 5LEJA 2V7KA 1NCRC 2ECTA 1CHCA 5C2TA 3RF1A 3IDEA 2YINA 4JV5T 3K3OA 3UU4A 4ASMB 2KFTA 4H3WA 3ZXAC 2IC1A 2WR9A 1U12A 2E61A 2PNXA 4B7YC 3ST7A 1W0OA 1V0AA 4GK5E 3PTYA 2BBHA 3MHZA 5EJ1B 5A33B 3Q2MA 2LJLA 3NG2A 4EEBA 2N9DA 4ZXEA 2V6YA 3P50A 1E57A 2WP9A 4B6XA 1QXPA 2LOPA 1XDOA 5LKXA 4N43A 3RZHA 2WDQA 3BIEA 4DZGA 2YROA 4Q0SA 2GH8A 2BS4A 4AQTA 1LOBA 2M6IA 5DAWA 3VBFC 4XZUG 4J25A 5FZCA 2FDKA 3VBSA 4GAZA 1HKDA 2PAMA 3M3EA 1JOPA 1IHMA 3DDTA 2BVVA 2JG9B 5H9SA 3H1YA 5L9BA 1ZRIA 4KHPT 2BV4A 2JG8C 1DYPA 2WT2A 1LRZA 2P6CA 5EV7A 3HQRA 1M7KA 2JRKA 4Y3OA 4QXCA 4OFGA 3MIDA 4GNGA 2CAVA 3TNPB 1RITA 2CBJA 4AFAA 4BLIA 1S94A 4IHJE 2AGSA 3Q8BA 1XNKA 1ZZ7A 4GIQA 5FYHA 5C3SA 2D3PA 2WZR2 4R52A 5EWSA 4FP3A 1AVBA 3DV8A 4CP9A 2G1MA 1AYM1 4QQHA 5GLZA 4JI4T 2NMOA 2I2SA 3NKGA 1G25A 1FI2A 1OUXA 3BODA 3R4SA 1ND2B 3U4XA 1O3SA 3CMLA 4H55A 3R84B 2IMLA 3IDAA 1E7PA 3ZN1B 1AYN3 1RJ7A 5CJ5A 4ATEA 4QQLA 4YT0A 3AXDA 5DMYA 1RUE1 4EN9B 3AB0A 3ANWA 3O1JA 2VC9A 2C5DA 5K4LA 4BU2A 4JI1T 4YFWA 3UGHA 1XU1A 1J1TA 3O1VA 4IQPA 2D0UA 4FOYA 3CEWA 5M0TA 2R041 4QGLA 1XNRT 3O12A 1UZZA 1EV12 2V72A 2HLEA 1T2XA 2HEWF 3OSDA 3BVCA 5FWJA 4RQPC 5BNPA 3IEEA 3NNFA 5JXIA 1PGL1 3SQOA 4BA9A 1TME3 3RYRA 1KDMA 3P3PA 2FCTA 4DXSA 3DCQA 3QH7A 4YM2A 2ZZQA 4KU7A 1GP5A 4UBGA 1UPSA 3B3QE 3N35A 4WZXA 3IMNA 3AZXA 1MZ6A 1X7NA 2E5VA 4LKAA 3KINB 1V9U2 5BNNB 3SEPA 2A5ZA 3LQJA 2XG3A 4ES9A 5BV6A 1ZRFA 4HANA 5J7MA 4FOQA 2J47A 1R091 4QB1A 1UKGA 3ZFEA 4HOOA 3VD4A 3FXDB 2VL0A 2NPIA 3H7HA 2P57A 2ZGNA 3EUHA 3M70A 1WW4A 4X8NA 2CGOA 2W5FA 4I43B 4XUPA 4JTNA 2VKOA 3VZKA 3KFWX 3DQVR 3WI3A 4ZHQE 3WVJA 1VBE2 1HXS1 4MXWB 3ATGA 4MXVA 3N5LA 5TRBA 2JIGA 3O1MA 4CDXC 5SVIB 2YN6A 5LBBA 5BUVA 5EYXA 5FAXA 1H7CA 2XR4A 4LO8A 3G6JB 4R7EA 3KZ4C 2WQYA 1SLIA 2E2AA 4HSJA 2QZ2A 4CU7A 3RKOA 4YC9A 1WCSA 3P4SA 1FPN3 2JDHA 2RVAA 5JTGA 5JDGA 1Z60A 3T2TA 4UFMA 1ZRDA 1JOCA 4TWTA 2DBIA 4Y1ZA 2UWBA 3PDYA 2Y6JA 2YVRA 3RI5A 3OYXA 1M4WA 2J22A 1FOD2 3UQ4A 4Q0PA 3VB9A 1QJU3 4XBNA 1XNAA 4LADB 1A34A 4GZ9A 1HNXT 1ZBE2 1AZDA 3USSA 3AYCA 5HXVA 3LDYA 2UYAA 2ZX4A 2DVFA 2IDOB 4HWCA 1DG6A 3ZX7A 2VZPA 4AKLA 5J48A 3CZUA 2EGMA 1ST8A 2H7OA 4XYXA 5LK5A 4NPPA 2JM3A 4AXPA 1S0CA 4HKLA 4DR7T 2O1QA 3JXSA 3K46A 4ONUA 1KS4A 4LIUA 2CNAA 3SLIA 5D8AA 1PGW1 3RZKA 3OPTA 2L43A 4Y1YA 4N3WA 4Q4Y1 2BP6A 5I93A 4MSXA 1UYXA 1GOFA 3JCIA 1YFYA 2GN3A 2VZ1A 2VQUA 5AQKB 2QQPA 1WENA 2XM2A 3J7HA 3WG2A 2R072 5AQPB 4Y1XA 3RJRA 3DN7A 3VBRB 5C3PA 3THPA 4AVXA 3HIFA 1AR82 3T3YA 1D0HA 5FB0A 2ZGSA 4R9DA 4NOTA 5IUQA 1HYJA 1J5ET 4XURA 2QE3A 1CESA 2K24A 5K8SA 3ASIA 3GCWA 1RC6A 4QD2A 1RUF1 4HMZA 4DV0T 1DP0A 2XPJA 1DGLA 2VOXA 2RR11 3WG1A 4IXLA 2LE8A 1Y9MA 2QRXA 4AAXA 1QEXA 4YGCA 1ZBA1 3A7QA 4COUA 4HVQA 1ZA4A 1UX6A 1LENA 3IKWA 3HBKA 2YDSA 4EEDA 3D4KA 2E9XC 3RKGA 3A21A 2D97A 1ZV4X 5LXTE 5HEOA 2XQXA 3RGBA 4D7TA 2RDSA 2E6SA 4QM9A 3GM8A 4CUBA 3POWA 4A4AA 2UUAT 3ZFGA 5BXXA 1NUKA 4O2BE 3D5OA 1VBD3 2ZGUA 3J9X1 5LG3A 4Q26A 5JQGE 2XWBB 2AENA 4HFBA 4DV2T 1XNDA 4EV6A 3FLPA 1LOFA 4RL7A 3MYXA 2YYOA 2J1DG 3KV9A 3VD3A 3T1YT 2DBNA 2DWKA 4XFFA 4Q8KA 1E5HA 1H2KA 4M00A 4META 5GKAC 2ODUA 4BWOA 2CA5A 4H14A 4X5TA 2Q9QA 4BQWA 2R043 2NM1A 4OUMA 3I54A 4HFCA 3ZIXA 2ADDA 4E2GA 3ONXA 3WP4A 3LEGA 5HXEA 2JX9A 2VJEB 1WCKA 2G19A 3ZEFB 3S5AA 2BFUS 1NQJA 5FYMA 5CA0E 1S0BA 2IXCA 3O1PA 5IVJA 3F2EA 2UWAA 3NRUA 1FJGT 2EHOB 1VMJA 3H8RA 2WBKA 3BOWA 2DTWA 1HF8A 4UFLA 3K4ZA 3HNMA 4YBMA 4K0KT 1O5LA 3LOBA 5G04L 2KA3A 1US2A 4AQYT 2ZX0A 3FLTA 1W6MA 4GH4C 5CA1E 2V5DA 3GBFA 1IOAA 1GR3A 1NA1C 3AZVA 3ZDVA 3D0JA 2Y33A 2E7AA 3QH6A 5C8YE 2EIEA 3R05A 4LHLA 5FPUA 5DABA 4GB33 5IWFA 2C9KA 1DQ0A 1XYOA 3MW2A 1T8BA 1W0PA 4Z8BA 2PHXA 4JGZC 2VQFT 2UXDT 2VWAA 2ECIA 4AKRB 5HPOA 3SHRA 3B94A 1HRV1 3N36A 3THCA 4LK7A 1LDJB 4QHZA 1PMJX 5CGMA 2OPWA 2EHOD 3O0XA 3JUUA 2CSVA 4QQOA 3I3DA 2JDPA 5FKBA 1UYZA 2PXJA 4LT5A 1UK5A 3NL1A 3AP4A 4LO6B 4NHXA 5FMDA 5K9YA 5APAA 1VB4A 5I0DA 3JB8A 3ZIWA 3ZVXA 3BB6A 4B4PA 1MZEA 2E51A 3WQBA 3QUJA 4AVSA 1ZKEA 1WEWA 5FP3A 1OEDE 3FZHB 3D0SA 5T54A 1STMA 3NW4A 2VPDA 2OW4A 4CN6A 4PDWC 1KQRA 5BR8T 2B76A 4Q4V1 4MGQA 1UU4A 1UX5A 2A3YA 2WYSA 2YV8A 4XQDA 3BIWE 4HKWA 2VVSA 1W2TA 3L2HA 1MVEA 4ZHNA 2RMU1 1XZYA 2C9AA 4HFHA 1Y3TA 1YEWA 2GC0A 2TUNA 1YQ3A 2LM9A 4PK5A 1YQ4A 2PBIA 1YQCA 2BBJA 2V7MA 2BNOA 4ZU5A 2BZBA 4D69A 4BIFA 3N9MA 2NP9A 2I50A 1RUOA 1T6GC 4JKLA 2PLV1 2L8KA 4J2CA 4CDQC 4YFZA 1AR73 2JXAA 2ZM8A 2LGGA 1JTZX 4IV1B 4XPVA 2X0HA 5LHIB 1IZNB 4ISRA 2D43A 3RIAA 4KBMB 2Y6FA 1N1YA 1OFNA 1GP6A 3NQHA 2DL1A 3IBPA 4L0PA 1WEUA 3I2JA 2Z79A 4O9GA 4W4UA 4IV3B 2OPKA 1P8JA 1RYYA 3P4PA 3KCCA 2RE9A 4XXPA 2YPJA 2F4LA 5CB7A 3QOFA 1WW7A 3N3HA 4Q29A 2A6YA 2OQ7A 2OXQC 5B4NA 2IFRA 1G8XA 3C2UA 4JVAA 4BM8A 1PVXA 4U36A 3T6RA 1PVC2 4H9NC 3POYA 1YHFA 4LBMA 5F5CA 1ZBA3 1S2BA 1C8M3 5F2SA 4AFMA 1JXNA 3NNJA 5A1AA 5CG9A 4YNIA 3AP6A 2J62A 4DR1T 4V1Av 2VASA 4RHV1 2WQZC 1MZFA 2CONA 4F8HA 1DU2A 1RUH3 3WHTA 4UV9B 1F5JA 3AE1A 2ZEWA 3VKOA 3VBHA 2CM0A 4PAGA 1QJX2 3AKSA 5SVXA 3VBOA 4HWFA 3OKQA 3I2IA 2CE7A 3NJYA 3C7EA 3H3AA 1QDOA 4HKOA 1YC61 4ILBA 2X66A 1VBB2 3O70A 2PUYA 3ZN5A 2VJEA 1LGBA 1OWAA 4Q4X1 4HLTA 1W9TA 3S0MA 2ZOEB 5FPBA 4LF4T 4LIVA 3PUXF 3OJBA 5JMOA 4MFRA 1O6UA 4LNVA 1VRH1 2XAGB 2ECVA 1W3VA 1UXXX 3PL0A 3O34A 5L4HA 5ABGA 3ZC1A 3ZVZB 1ODMA 2EAKA 1KEYA 1OA4A 4DBQA 2A72A 5L4EA 3PVEA 4IDPA 2FDJA 3WF4A 1KK7A 4MYEA 4XJUA 5LGUB 4YG6A 2A6WA 3WD5A 4E8DA 2WDBA 5CKNA 5KH9A 4XIKA 4E8CA 2DUPA 4YGBA 2ZGMA 2QYWA 4LE4A 4LOSA 1HDKA 4R8HA 3B01A 4LTAA 3LBXB 4B7EA 1K42A 1R1A2 3DXTA 4PK6A 2QQNA 5FPLA 4YVWC 4ZU4A 1AJ3A 1O3RA 1H0BA 3D8CA 3IMMA 5HAXA 2F6JA 3MEPA 5FP8A 5KHJA 3RMYA 5KXCA 3CJIB 4NIIA 2VPGA 3C98B 4DIDB 2UY9A 2QIZA 2YC2A 3PIGA 2WNVB 3ZKYA 4K6BA 5HCAA 1HRV3 3E97A 2KT9A 5CISA 1W8NA 5L3GB 1Y01A 4NIGA 3MUY1 1LGNA 1RVF1 5FXVA 2YU2A 1CAUA 3TLSA 1V00A 1FV2A 1LOAA 3AYDA 1CVNA 1RUD3 1KRIA 3ZFFA 4RS5A 4XBFB 2WQ4A 1CX4A 3ALQA 5FQ0B 5A3NA 1ZZ9A 5EJ3A 3IPVB 5A32A 4H9DA 3N2KE 4AYCB 4Q5OA 4AEDA 1XSQA 3O35A 1MMGA 4ZS3A 4GKXA 1J3PA 2MKEA 3ZPVE 1ODNA 1AX0A 4SLIA 5GLTA 1ULDA 1H8TC 3AA0B 5B79A 3RWKX 3Q9DA 1UYPA 3AA7B 1I3HA 2XL9A 2W1SA 1S0EA 2Y26A 3NMBA 3WY6A 1MM2A 2HN1A 2BYVE 4IDQA 3P1IA 4JI0T 3OG2A 4M3CE 1NE4A 1AL0G 4DY3A 1ONAA 3UESA 4HONA 4BIOA 1UY2A 4XEZA 3NJVA 2LKGA 1N47A 4AI9A 4NHLA 1YJKA 2JDZA 2DI4A 5ABFB 1KXGA 3SFEA 2VCBA 3VKGA 4XFBA 1WWYA 2PLV3 2LSYA 5A70A 2ZGTA 2GP5A 4AIUA 2D40A 1SFPA 3H3MA 4KH9A 4HWDA 3BOPA 3OYWA 5JZGB 1PZ7A 3RRCA 1NY72 3RZMA 1EPWA 4HTEA 5IVYA 4W65A 3T7LA 4CCKA 2DHRA 2JDKA 4HSLA 1C5IA 4CU9A 3HKDE 3ILNA 3CWZB 3WCSA 4AFCA 1QH7A 3VDAA 1SLLA 4CDUC 3JCFA 3S57A 5HCBA 2VB6A 2IVIB 4JX0A 1DQ1A 2GU9A 4LO5B 2HEVF 2WO1A 4KI5M 3KF3A 1R083 2EA7A 1IS6A 3WDUA 4QX3A 5JDHA 5TDRA 3OGSA 3WX5A 4YW2A 3KB5A 1L7RA 4QAWA 2PAEA 3I4IA 2FDHA 2ZLYA 2HBUA 5C4WB 1EYBA 2EA6A 5IVEA 1UNBA 3ZXJA 3I2GA 4HPKB 2PTMA 3AM2A 2KE1A 4V3KC 3EVYA 2W00A 4AQFC 4I0BA 1IKPA 2YBPA 4JRLA 2Y6HA 1QNYA 2BQPA 2FCUA 1OEDB 5JUVA 1AJOA 2ZHKA 4XBLA 2WU5A 2OX0A 1BMV2 4DVDA 3IB3A 1NCRB 1PO12 3RZZA 3EDVA 1W90A 2EICA 4LLBA 3J8F1 1AR61 1KNPA 2JE8A 4KGQA 1ND3C 4OCTA 2VVFA 2VPVA 1OMIA 4QXHA 2YGMA 3TEZA 3RMXA 4EXTA 4RR3A 1FMD2 2KWKA 2DCYA 3ZYGA 4HN0A 3B02A 2FDGA 2IFWA 4AP4A 2CLYC 1NLSA 4YTMA 1E5IA 2G9GA 4CEYA 1NLQA 4DMVA 4CCMA 3LIGA 2R0HA 2Y48B 2Q8EA 5IFTA 1ALYA 2I6HA 3A5XA 4XVHA 3VBFB 1Q8PA 2R061 3VZMA 2XVLA 1X36A 1VOMA 4OHYA 4BJNA 1ZEEA 4EWDA 4WBOA 3E2DA 1ZZBA 3ZSTA 2LUWA 3GZTB 2L3LA 2X5IB 3U11A 3E5QA 5IK5A 2XBO2 1ZX5A 3GBWA 3ZOIA 3ZMOA 4CCCA 2D5UA 2IXLA 2HKXA 2CHHA 1MMAA 2E7QA 4MV2A 5DDJ1 4OI0A 1BR1A 2N1GA 3O0WA 2XAHB 2YDEA 5DUWA 5ACA1 3TBDA 5JOWA 3OJAA 1BR4A 5EK3A 2VM9A 1AR93 4LKEA 5C9AA 5DN2A 4YHJA 4TUYE 1D4M2 4K8RB 4K40A 3FHIB 2HWB1 3HTKC 1O8PA 3DL3A 2R49A 5F8PA 2JE7A 3QNUA 2G4IA 1HB1A 4YADA 2Q1FA 3HVDA 5LJNA 1NEKA 4K20A 3ZSMA 5FLJA 2VMGA 3NV3A 4NHKA 3E08A 3VKHA 4D6QA 1RUI1 4FPYA 4GMP1 2V1DB 4Q0QA 3RZLA 2HWE3 3EYPA 4FQZA 3DPRC 5DZFA 4QPGA 5LZ6A 4FPOB 3IBMA 1COV3 1B35C 2DFBA 3FHAA 4F83A 4FT8A 1KS5A 3MGUA 5AC93 2XOZA 3WNOA 2OV9A 3RJ2X 3ZPOA 4RQPB 5LMUT 2Y6LA 5FZHA 2QQLA 1NZCA 3VD5A 3AEGA 4XFHA 2W4XA 4A44A 1WCUA 4W8JA 3S6PA 2BGCA 3FFZA 4UI9B 2NW7A 2CMRA 5LGNB 3MJXA 5JZGA 3MLKA 3LA3A 2MNYA 4QPWA 1QGLA 1D0XA 4RA0A 2E6RA 5LEKA 3MHHA 1RUJ1 4A7ZA 2VZSA 2W1QA 2ZX2A 1YI9A 1CWPA 1N32T 1IPKA 3G06A 2VKDA 4QGMA 4INDA 1RMU1 5FY4A 4Z92B 3VBUA 3U4SA 2HPLA 4DR2T 3HCSA 3ZYBA 3M3IA 2YHNA 4B4QA 1PNFA 1DQ2A 5JLVA 3GMIA 4HXCA 4PLOA 1ZREA 3L9JT 2VOWA 3ZMTB 5FYCA 3Q5EA 5LA9A 5HEHA 2VY0A 2JKXA 4KBBA 3T2OA 3VZJA 2VCCA 3TEXA 5J3UA 1BBT2 2WSSV 3ZYIB 1D2QA 3CDZB 2Q5TA 1Y4WA 4Z90A 1BR0A 3UUNA 4XJ9A 2K2SA 2BAYA 3TB0A 2WB5A 3I1AA 4I7CA 4A56A 4A6OA 4HBNA 5I8SA 3N4MA 4M4RA 4ZI3D 3GN5B 4XJWA 4NO4A 5AQOB 3H50A 4XUOA 2PA7A 1NCQB 1W6OB 2HWD1 1UD1A 5JDMA 3HQUA 1L7LA 2X67A 3AKTA 5JIAA 2RDRA 3MFCA 3HKEE 3RTRB 5I8YA 4AI3A 3UNPA 1OLME 4DXZA 5JR9C 4CTEA 2VVNA 4ZZ5A 2ZJCA 1BCXA 2KU3A 3OF1A 2WUHA 4XUQA 1H2NA 2NLRA 5ADXL 4URTA 3FL7A 3NV2A 1N36T 3A22A 4TN7A 3AP7A 2ENRA 4LFAT 5H6QB 2XQ3A 1C1LA 2YSJA 3PUHA 2FFWA 4M3CB 1YFXA 4ISTA 3MLJA 3RG0A 5ABHA 3R4DB 2LROA 3CO2A 3RIFA 2LDRA 1HFAA 1G7YA 4X3GA 5FZEA 2C5JA 4CCJA 4WVMA 2JG9C 4PF5A 2XHNA 5DUXA 3VHNA 3N9OA 1N87A 5F3JA 2JG8A 4EN7B 2VMFA 4LHSA 4BK5A 2VMCA 1VD4A 1QUUA 1WLTA 5EYYA 5HXHA 4JRAA 1Y64B 1W05A 5LBQB 4CDWA 2WDRA 4EV0A 1VBA1 2UXBT 3OB8A 5C5TA 1R8IA 1PO23 3I59A 1UKRA 4Y4YA 4LF5T 3HBZA 2ZACA 2RR4A 4AGRA 1IGOA 3ZCJA 2WL1A 2RS32 2QKDA 1AL22 5J2TE 2VP7A 2IC9A 4B1LA 3ZYQA 5DDJ3 2J1RA 3K8PC 2E9XB 5A3MA 2JDUA 4K0UA 1RHI1 4IESA 1CAXA 2R30A 2GMPA 3EB6A 3RGLA 4RN5A 2JB4A 4OUEA 1DQ5A 2NMNA 2HWB3 3JUEA 5KC5A 1C1FA 4PJMA 5GZFA 1X4UA 5TSWA 3VN4A 1WE9A 3LK42 4PLMA 2HYED 3W5NA 1OUSA 3JBG2 2AXDS 5T5JA 5BNOB 4NRMA 4D8MA 2XKOA 3POEA 1WKYA 2H3RA 2OVUA 3EJKA 2WLPA 1VJ2A 4GMP3 5LKUA 1WEEA 4JI8T 5IYZE 2K4DA 5C71A 2K0GA 5D1IA 4HKAA 3K4AA 3G7DA 2QVAA 1HX8A 2JQQA 2LALA 1VALA 4U7IA 2WMNA 1JN2P 4Q4W2 3ZR5A 2MEV1 4MZUA 1URXA 3CPZA 3J4UH 3IIIA 4HVOA 4R2YA 1UOFA 4AHZA 5BNNC 3LKJA 2Z69A 1W09A 2B39A 3ZLIA 1YIFA 1QMJA 5C11A 3FUQA 2VW0A 2BDRA 1VCTA 4CPBA 3OUHA 3KHBA 2H0BA 4K1ZA 1XNCA 1SLAA 1OPOA 4ARXA 3BKZA 3T1HT 1OT5A 5AQTB 1FNYA 2V26A 1HRI1 3HCUA 2JKBA 4AI1A 3NRYA 3O1OA 4ZI7E 5CFBA 1XE7A 2QQWA 3RPUA 4F52B 3E5UA 3J7LA 2RM21 5FYIA 4CXWA 2M3HA 2QQJA 2Y8KA 3ZKUA 1NA1B 3AEDA 4OHXA 3WEZA 1RMU3 1KJLA 1XE0A 2XQ8A 4YSFA 4MALA 2TBVA 1NE6A 3WV6A 4JGZB 4CDXA 3PIJA 4OUSA 3BU0A 4S3OB 2JRJA 2LN0A 2JECA 2P34A 2X29A 4EWAA 2R1DA 1RUC2 4L9BA 2Y0OA 3FLRA 4DQAA 2ARAA 3HJRA 3GN5A 1DYKA 3VDDB 5GONE 3AA6B 2A73B 4FTSA 3OPWA 3PV0F 1B7TA 2KR2A 4NUBA 1YFWA 1IJ6A 4CEWC 1QLBA 1UAIA 1SDWA 2OZ6A 2W1WA 2VKHA 1SUMB 4LHNA 1LVKA 1BEV2 2WFF1 4WYVA 1UMIA 1WMXA 3BTAA 3UK9A 4O4HE 5T50A 2LM2A 5LBEA 1JYCA 2VOKA 5FP4A 4XHXA 3QD6A 4QU2A 3I3MA 4QT6A 4PDWB 1VBC3 4OGCA 3FWEA 4XABA 3QK6A 3RRDA 5JWPA 1V6IA 1L0VA 3KT4A 2XOCA 5FZLA 1CAVA 4DMWA 4CUGA 1LHVA 4HN9A 2OA5A 3FAOA 1H8VA 3J26N 3FJUB 2BOJA 2WINB 2VNGA 3POFA 2YG0A 1GFF2 3MK7C 2J4GA 4QQ2A 2BG9A 1QY4A 5ABJC 4CDQB 4GK0E 4QX8B 5FZIA 4N4FA 3OBZA 4UXNB 3AE8A 4LK6A 1H2LA 1BVP1 1SG3A 2L9LA 3HMYA 3PTRB 1S2KA 3MUZ1 3T0AA 2ZAHA 3ONJA 3VRAA 2C4XA 2IUWA 4A98A 1Z7S3 2W2UA 2SBAA 3AJYA 4FPGA 1EAH2 2PTFA 2VU9A 5HI0A 4AR2A 1QJY3 3B13A 4JGYB 3KDEC 1JU3A 3AK0A 1UOBA 3MLLA 2LRKA 3AL5A 5LBMA 3W59A 2C0SA 5AQQB 3AMNA 3FC0A 1YI7A 2RDQA 1WW6A 4A42A 4QKBA 1U5ZA 2VPEA 3AEBA 4UYBA 5KR7A 1HQLA 2RJLA 4E2SA 5J2UE 5CFCA 3TN92 1OOPA 4OLLA 2GMEA 5F37A 4LBQB 2KNDA 1V6OA 3VZLA 3HQXA 4NRPA 5LW9A 1G8WA 3EXUA 3LDBA 2P17A 2YFUA 5DJQC 5KHKA 2G45A 3A4UA 5F6KA 3BK9A 4OYJA 3X29B 4DFSA 3RDIA 1WD4A 4I30A 2Y34A 3ILFA 3OYZA 2JDNA 2W08A 1AX2A 1UPIA 2CPTA 3LZZA 4CXXA 4PIXA 3FUOA 3NJZA 2DU1A 1G86A 2CWOA 2MA5A 3O1RA 1TNRA 3L3PA 4PFPA 5EIYB 4XF3A 2I59A 5FB1A 4QGNA 1I5PA 4LUKA 4YZ5A 3J9SA 4EB6E 2HDPA 3FHQA 1G9BA 3PHDA 2ES0A 4LBQD 1MS3A 1GZ9A 4UW3A 2D6PA 5K0UC 3VLBB 4IEWA 3WG4A 4W50A 1LODA 4X6RB 3K77A 1PMIA 4P5HA 3RH3A 5D21A 1UZ0A 1X4JA 1MIWA 2WO7A 2X09A 3AAIA 1DHKB 2ZA9A 1KITA 2LXPC 1H30A 4QF2A 2XLGA 4GH4A 2FUUA 1E5RA 3SKVA 4P9XA 3UYJA 4Y24A 3NAPB 2FDFA 4XJ8A 4E4HA 1TEIA 1ZHCA 1LGCA 5L7OC 1JZ6A 5FJHA 1MIYA 4FPKA 3N7KA 4HEAA 4E4DX 2LXHC 3I2HA 1CAWA 2VO5A 3AAAB 4BK4A 4DS0A 2HWC1 3OCPA 2UYBA 4YVWB 1KNZA 1ZRRA 5EFUA 2NP0A 4U2AA 2YOEA 5IATA 2JIWA 4WZ0A 2BTVC 2GNTA 1HG5A 1C5HA 2HN2A 1LULA 4ZS2A 4TLGA 2BBVA 1HJGA 1S0GA 3ZO0B 1JHJA 2MTQA 3DGTA 3N9QA 4COZA 4GULA 5FEYA 1DLLA 2ZCWA 1AYM2 3N2OA 2N2NA 3APBA 2PYTA 5JR2A 5FVKA 2WZR3 1PM4A 5LBCA 4MGZE 5BMVE 3KQIA 3EQEA 1I6XA 2YY1A 5DXDA 4QPIC 4LF7T 3UQ7A 4FPEA 3V0AA 3HKCE 3ROUA 1NENA 1RUE2 1XPWA 2WZIA 3KM5A 5J36A 5B2GB 3MZHA 3LEKA 4IGQA 3IT8A 5DAPA 4QX1A 2IVJA 4Q25A 2BKOA 2WFF3 2PHDA 4BB3A 2DLRA 1ZYBA 5L3EB 1H8TB 4TLFA 2NQYA 2R042 4OZOA 1MEC1 4BE3A 2VECA 3KVBA 2J1SA 4YSXA 5F6LB 5AQMB 2Y6KA 4IE4A 3K4DA 2E9QA 5A6ZA 5HV4A 3OGGA 4OHWA 4MADA 1GV9A 1JNRA 4YVSA 4AL9A 1PGL2 2XM1A 1W8HA 1MQTA 4IV1C 1EV13 4OX9T 4BHPA 2EXJA 2KZ7B 2E33A 4IEYA 5FPAA 1RGSA 5LHHB 5JXHA 4DR4T 5C3OA 1VYXA 5HEUA 1S0JA 5BY5A 5FY7A 4MLOA 3SCGA 1ZBDB 4WM8B 1RUG1 2Q0AA 1O8SA 4ZXLA 1W6NB 2FZ2A 2FD4A 1FXZA 2WA4A 3ZSSA 3FMGA 1JZ4A 2VQET 1AXYA 4IV3C 3VHOA 1H4HA 1WEOA 4JLEA 2BFUL 2Y8DA 1BR2A 3DKWA 1R092 4LJNA 3U1XA 1WILA 2KYUA 4CCGX 2EXIA 5H1UA 4N43C 1V9U3 1CX1A 3TLTA 3LJCA 5SV5A 4ASLA 1H9PA 5F5AA 4I50E 1O4TA 3WDVA 4P02B 2E32A 2V5CA 2ZXQA 3R6SA 1REDA 2MUMA 4URAA 4LJHA 1HXS2 3F31A 2GNBA 3DPLR 1IG3A 4JQTA 5AQUB 5KH3A 2DCJA 3VGIA 2RS11 3U3IA 4JBWF 2WFPA 1JM7A 4BJ0A 1VBE3 3POGA 4YWAA 2E53A 3SITA 1K2FA 1YWKA 4LITA 1SZBA 4D6SA 4EQVA 3ZYRA 3B7MA 2MNGA 5LHGB 4K21A 4W6WA 1POV3 2QQKA 5FZ9A 4D94A 4WZ3B 2E31A 3AE3A 4L11A 4DMIA 2YQMA 1IAPA 2BGOA 3T9KA 1WLXA 4P08A 5AQSB 5C5UA 3FM8C 3PUSA 2LGKA 4KMQA 1F62A 1NAEA 4PJNA 4L97A 1Q3EA 2QQVA 5I0UA 4E4SA 4EE2A 3TRSB 3GALA 3WQ0A 1RL3A 4C8DA 1VMHA 2BZDA 1FOD3 2KSRA 1G9CA 3O47A 2DUQA 1QWRA 1ZBE3 1U5XA 3ZXEA 2CLYB 2BVMA 3SCHA 2FMDA 4LBNA 4QKFA 4GXLA 2XVGA 4L2NA 3PDQA 5FYZA 2NTYA 3ZMUB 3V0BB 2XWJB 1PGW2 5A7QA 4MBQA 2JD4A 2ORXA 2VZUA 4NN0A 4Q4Y2 3IAPA 1WW5A 5IHYA 1XOYA 3WG3A 3T0DA 4B4RA 5C3QA 2JMHA 4P9YA 5C6CA 4ILUA 2W67A 3GJAA 1UY4A 4AKHA 5EHDA 3AP5A 2XONA 4NIDA 3AE6A 2MT5A 2R073 3IHRA 4N53A 4GNFA 1FV3A 1AR83 1RUF2 1AYN1 2W1UA 1W6PA 1WFKA 2K16A 1JNZA 2LTNA 4FPHA 1DDLA 4PIZA 2RR12 5FZOB 4OVEA 2HWC3 4I01A 4KNCA 3ZFEC 5GM0A 4YAXA 1ZBA2 4IC2A 5IK7A 4NVPA 2JDMA 3CQGB 5B8DA 5JXJA 2VH9A 4R4ZA 1SCSA 4PQ9A 5T5PA 4YTNA 3U5PA 4YLHA 2DVGA 4Y22B 1X9TA 3C3VA 1LHUA 3VK6A 4P5YA 4AHYA 3P8CD 4OK0A 4QH5A 5JIUA 3LJUX 4I7DA 3CF6E 4Z07A 1OF4A 5B77A 4NRQA 3HPNA 4FTBA 1TME1 2KINB 2CKLB 3POIA 2Q30A 1Q8OA 2F6BA 2PQSA 5FZ8A 4OZXA 3LVRE 2AUYA 2YKSA 1Z78A 4IE5A 3PHMA 4XAAA 1O91A 3JADA 4QH4A 4TTGA 4CPBD 2YXSA 1HJFA 2VTFA 3MBWA 5LB7B 3AZZA 1NX9A 4GA9A 1ZZ6A 4UW6A 1SACA 2KKYA 1GQPA 1MEC3 5A6YA 1OBNA 2W92A 1W6QA 4QWNA 2VUJA 2VE1A 2LRPA 4XMIA 4ZY9A 2G0UA 4O4JE 1F4AA 2X05A 1W8FA 4D7SA 4UT5A 3AZYA 1FYUA 4XF1A 4YM0A 2KGIA 3C7OA 4B3RT 2W0XA 3TEYA 5IAXA 3KQRA 3ZPYA 2BWCA 4LLOA 2Q8DA 5DZEA 3O1SA 3PUQA 2FBEA 1JYWA 5FFOC 2ET1A 3PJYA 4AHWA 2Y43A 3BN6A 4CDUA 2TNFA 2EODA 1SPPB 2ZEYA 3U0ZA 4P9IA 5HCHA 3AE2A 4GNEA 4BLJA 3S5QA 2PFVA 1QDCA 4LMFA 4N9IA 4U72A 4AG4A 3JZVA 1FPN1 5FBZA 3WW1A 1QU0A 2YC0A 3PVBB 4C1WA 3UKTA 2ORZA 1HRV2 1GZWB 1XNQT 4PK4A 3ETVA 4Q8LA 3VZNA 2QJVA 5C8CA 1WUVA 3WP6A 4Q1PA 2UWCA 2XQ9A 4IL9A 1QJU1 1F4HA 1OEDC 1F5FA 3JQWA 1V6NA 4YRDA 2ZGKA 1VAVA 2XB1A 3SH3A 4YBTA 4JI5T 3ZSEA 4LUMA 1QJZA 2XJUA 3KVAA 4UXAA 3PU3A 4AGVA 3IA3A 4S2HA 1D1CA 4AWDA 1ND3A 5J1XA 2JQ9A 4A97A 5JR9B 4UF0B 1UY3A 3IN9A 2MA6A 3USUB 1U4QA 3ZFGC 4LR4A 4H9SE 4CI1B 4Q4V2 4NWVA 4LFBT 2WN2A 2XP0A 2J1AA 4TZDA 1WGMA 5A7WA 5C3JA 2Z6EA 4IL7A 2W94A 3SCFA 4FK5A 2RMU2 1OH4A 3IZOA 4BBQA 2EXKA 3E0ZA 3UUMA 5IVBA 2NTXA 3ACFA 5FLIA 1UZWA 2FMYA 4R8PK 2YYRA 4R4XA 4ZEYA 5HXSA 3BQIA 2ZGQA 1K5MB 4G2AA 2R7EB 2BRTA 2A2FX 2ECJA 3RC8A 2Q9QC 2PLV2 3KV6A 2C5IT 2H0DB 3KNVA 4NJ4A 3WDWA 2X5IC 4A4CA 1OFSA 2WU2A 3P4WA 3EB5A 1PK6A 2X9WA 3AC0A 4X66T 3AB3B 4XILA 1UU5A 5AIUA 5ABEA 2WBLA 4IL4A 4Q0UA 1BKZA 3D6EA 3ZN6B 2WAAA 3AE4A 4HWHA 2VK9A 2LOSA 4A3XA 2RA1A 5HXRA 2OXBA 5IVVA 1SDDB 1MNDA 2D0TA 3E22E 2BNNA 3RFRA 5FXXA 1ASJ2 4UP0A 2XQ6A 5FMOS 2MAWA 4HK9A 5CAZA 1VBD1 1V6JA 3UU8A 4IW3A 2GNDA 2PELA 5CFDB 3I97A 2P4EA 1PZ9A 2FSAA 2ZPXA 3ZXGA 3V43A 3PMEA 2NYYA 3O33A 4ZZBA 3LK3B 2XKPA 3BPZA 2W46A 1SEFA 3HNBM 3NNLA 3DPRA 4GMP0 3CKDA 3DKQA 3HNYM 2DVAA 4AQSA 5IT6A 4RHV2 4NIAA 1NOVA 3EBRA 3CKHA 2CWSA 3UU5A 1B35A 1UN1A 2WSUA 2MIQA 2LSGA 4H7MA 4CUCA 3ILRA 4TNWA 2DSMA 2E26A 3M99A 3PUVF 2ZZJA 5A7SA 3MIBA 5FLHA 4AK3A 5C33A 2G9ZA 4CN1A 3WQ7A 3AVRA 1QJX3 1HG2A 4ANJA 2C24A 3UGFA 5FZ6A 4AEJA 4L0RA 4Q4X2 4OYUA 4LQRA 4FAGA 1JMUB 4YJ3E 2BS3A 5HWYA 2F6NA 1S0IA 1CHUA 1BQPA 1VBB3 3OBRA 1XBFA 1VRH2 1KFXL 2WYFA 3KGZA 1A3KA 1JUHA 5LKTA 1AUYA 3ON7A 2VQ0A 4ZI3C 3QB5K 5GZCA 1HV0A 2IW5B 4ISSA 4Y1UA 4GB31 4ISQA 3AEFA 2QQIA 1YJLA 4TKPB 2XASB 4GOUA 1PZ8A 3MIHA 5I0SA 4PI0A 2UXCT 2AEYA 2JMIA 2OT7A 3OY8A 4FOWA 4OFZA 3UV9A 2IDAA 2P3JA 4F7ZA 3VDBA 3MDBC 5IVCA 4CRQA 4NUVA 1WMDA 5JVVA 5GALA 3VHLA 4L7XA 2X9HA 2CGPA 1VRBA 1KGYA 1YQ2A 2GZWA 2ZEXA 2RS51 5CYYA 1R1A3 3A0NA 3LOIA 5FERA 1UZYA 2PG8A 1ULPA 4I02A 4PJJA 4YW3A 4BYYA 3UUXB 1W0AA 2LSIA 5L3CB 1NCQC 3CU7A 4BA6A 4HFVA 2CXDA 2Y6XA 4H2AA 5G0FA 4XFCA 3AKPA 3RPQA 4JYAT 4CEWB 1EP0A 1C57A 1RVF2 4EN6B 4OMCA 5FK8A 2M1RA 4KWUA 2WZPP 2KWIB 1CJDA 1OQEA 4FIPA 1QIQA 5A33A 3LDKA 2WKKA 2DURA 4M3CF 2ZAAA 2ZHNA 5FPXA 4QKNA 1GQHA 4K9SA 1YKEB 3AZWA 3L11A 2FJEA 2QVSB 1BLZA 3RIUA 2WNUB 1H6XA 4UP5A 5FY9A 2XQ5A 3I2DA 1PMHX 1AR71 3C5KA 2B1EA 1KNRA 3PUGA 3GZAA 3I2FA 4YFSA 1SMVA 3JC6D 3LGRA 4FOVA 1GQGA 1FIOA 3E1F1 1GWMA 4HK8A 4IE0A 1UX4A 4QM8A 1OLRA 4Z82A 2JG9A 4PJLA 4MHRA 4H63V 3WCRA 1I94T 3NZPA 5ABJB 2JDAA 1LRHA 3EAMA 1ULOA 4HETA 2HYXA 5KWRA 1W8OA 4XFAA 2XB6C 1ZP0A 4UELA 3MKDA 1ENSA 4G3YC 4MGYE 1QSDA 2BVLA 1ENQA 3OGJA 4UEMA 2ZABA 5FZBA 5TABA 5AQNB 1RTVA 2UURA 1QOSA 4PCRA 5F5IA 3KBUA 2I45A 2PQQA 4BQ3A 4QXBB 2JEMA 4UV8B 5IJRA 4I2OA 2L9QA 1HN1A 1C8M1 1I9RA 4CI3B 5A1FA 5D1LB 1ND2A 3N7JA 2LHNA 1WA4A 3CMGA 4XAXB 3CX8B 1S0DA 3LCPA 5G04B 5JRCB 1RUH1 4LHKA 5IK4A 3Q8FA 2M13A 5LRSA 2VQAA 2VUCA 1C3HA 4B1MA 1OD5A 4Z2WA 5JOZA 1O4ZA 2RJKA 5BNOC 2CWMA 3FEHA 1TMF1 3WNNA 2L7PA 2ZGRA 5L19A 4DBRA 1IQDC 5HBAA 1DGWX 5J09A 4QX7B 5FO7B 2V4VA 1POQA 5A80A 4U2YA 2C1FA 1GNHA 4O2AE 5AFUL 2WZEA 2LW8A 2G9FA 5H9QA 1RJ8A 2R16A 4G4FA 4YZ4A 4MGKE 2WABA 3J8F2 1AR62 1DZTA 2H89A 4E7SA 3ZFFC 2CT2A 5BNNA 5KXBA 2B7YA 2IUBA 4NR1A 3AXJB 3HT1A 3Q5XA 1O59A 3ZVYA 4B7KA 5LA0A 1FBVA 3ECQA 3O5SA 3FJSA 3X1DA 4AEDC 4PI2A 1QQP1 2Z42A 2CWYA 2R6QA 4JKMA 1S1AA 2VW1A 5K0UB 3MA9A 4GJZA 2YBSA 3MIFA 1I5ZA 1RINA 3CK6A 2VBDA 5HCFA 1MPXA 2ACXA 4LF6T 2HPJA 1FMD3 4Y26A 3A7MA 3ZXLA 2LAUA 3OEBA 1N1VA 2FZ1A 2WS91 5L9RA 2JE9A 4MGSA 4MXWA 5IVFA 2R062 2Q4SA 1X8EA 5GZEA 4IEOA 1MS8A 1JZ5A 4OGEA 3QC9A 5H9MA 3LSDA 1W99A 3M65A 1WCRA 3WW4A 2VGDA 5SVIA 5L7OB 1HB3A 2LLYA 4FI9A 3OPCA 3PJAJ 4S3OC 5FY0A 3TKLB 1FT9A 5EQUA 1J5WA 4I09A 2XHEB 1OLQA 4Y20B 1E5SA 4A2UA 5FUNA 5JSOA 3LK2B 3VDDC 4CP0A 2J1UA 2Y64A 4OHVA 4U7YA 3URFA 1RUD1 4CP2A 5DDJ2 2XSBA 4OI2A 1XYPA 2ZMKA 1NZIA 2XBO3 3WDYA 4I55E 3SEEA 5ACA2 2YGLA 4CEWA 4JQRA 2EXUA 1HQWA 4AYUA 1JUIA 2RS53 3IDCB 3HOBA 2HWB2 5BNQA 4LMKA 3VKFC 4QF3A 2JQHA 4ERRA 2UY8A 3ABVA 4OMDA 5JG6A 4TZ4C 5FVLA 3KT7A 1UOJA 4LULA 4V3LC 2XAFB 1D4M3 2J1VA 3GHNA 5FXZA 4QPIB 1OXZA 3Q8EA 1G9DA 3RYPA 2Q1ZB 1CIYA 4H7LA 5A1LA 1RUI2 2JJ6A 5FJKA 3KT1A 2W61A 3O4XE 4NIHA 5FY8A 4E9KA 1TE1B 3HCTA 4R9BA 4H63H 1JYXA 4OI1A 3BUCA 1QKQA 3LA2A 1X9PA 3K2OA 1UMZA 4D3WA 3VV1A 2E63A 1UZVA 2KREA 4A5XA 4S2FA 3O7AA 2DFCA 1Y43B 2DTYA 3ZC0A 4XOGA 4AI0A 2XXZA 2D3RA 3O1IA 4B3NA 2VJFB 4GYSA 3VBRA 3N7MA 1W2OA 4FJCA 3U78A 5A7PA 4NXNT 3AMHA 3WNLA 4AVAA 3VHPA 4CE8A 4I3GA 4RR3C 3GV4A 5G05B 4JUYA 1HR0T 3V5SA 4JGYC 4UVAB 5FP9A 4ZKTB 3L1ZB 1R081 2IXJA 5FZMA 3SHBA 1RUJ2 2V6YB 3ZYHA 4KI0F 4DRVA 3BYWA 3ZJ1A 4CEYC 5LA1A 2D6OX 1RMU2 4N43B 2ZETC 1LAJA 1PIV1 2LSKA 3AFGA 4KMCA 1W9RA 3DTOA 4IERA 3I2OA 4XI1A 3UULA 5FUPA 2A3WA 3VBSB 2L80A 3ME2A 2XJQA 4GYRA 5F3CA 3DP7A 2B0OE 1YQ5A 3KMHA 4YGDA 3AKQA 4BQYA 4FPJA 3WUCA 1HX1B 4YW7A 2NWBA 3DYMA 1FNZA 4DUVA 3B00A 4QXCB 3OPZA 3WF0A 1J3RA 3CQCB 2ID4A 4O4LE 4WBBA 5ETWA 3THDA 5CEHA 1BBT3 2PHUA 2M67A 3H7JA 4XMAA 5KH7A 4EROA 3HA4A 2K3WA 1TMF3 3GL6A 1JI6A 5C9AC 4CP9B 1XSRA 2JJ9A 4BQ4A 2HWD2 2BERA 2WMOA 4Q27A 4L5GA 2P1BA 3RYFE 5A3WA 4COVA 2CHNA 1JBCA 3AXJA 3F2ZA 3U14A 5FYUA 1DLCA 1S0FA 2RJ2A 3VU7H 2EHOA 3FBYA 3HR0A 2Y1NA 5GZDA 3ANWB 4Q2FA 4CP1A 4OQ8A 2RPAA 2B42B 2UXNB 3FZ3A 4DNYA 4FFGA 2P2KA 1LEDA 1DGRN 4BXFA 2QQOA 1GWLA 3Q5DA 4JCKA 3NAPC 1QQP3 1HW5A 4PW8A 1IQAA 2XAQB 5IUXA 4QPYA 5BNPB 4ZDTA 2YB7A 5JI9A 4KWKA 1TG7A 1S2EA 3TLUA 1U5PA 4UFKA 2ARXA 2WS93 2D6LX 1AR91 2W62A 1OURA 4RFT0 2J42A 4IEXA 1XE8A 4E27A 5LJMA 3FB2A 2J1EA 2FBWA 3ZT7A 4ZUXU 1OXCA 4AEKA 3L2YA 3M3ZB 3O1UA 1VBA2 2LEHA 3JD71 3OEAA 4ZZ8A 3C4XA 4O64A 2QFEA 3UU6A 5A6XA 5D2AA 3VBUC 3ZFEB 3DXUA 4DOUA 3LDQB 2OUJA 2X53S 2DX8A 2HWE1 2YFZA 1VAMA 5JDBA 2F4VT 1XXNA 3FBLA 4V2WA 3U5OA 2DDUA 4XXAA 2NOXA 2RS33 1G6NA 1AL23 1J3QA 5CADA 2X0YA 1RHI2 2DVDA 3LPGA 1COV1 4DUWA 2BUKA 1WCDJ 3DWDA 3WF1A 3WP3A 2A1XA 2SPCA 3SC7X 1GLHA 5AC91 2LGVA 1U0AA 2A9UA 3M63A 5LCWB 2WNEA 2W9XA 1LHNA 4UWDA 1ZOYA 1OD3A 1YUDA 3ZN0B 4WVVA 2ARCA 4MVTA 1H6YA 4FXKB 1ULEA 2QTWB 5FIXA 4RD7A 1SBEA 3NWKA 3AMQA 4OHFA 1YO8A 3ETQA 4W6XA 4IV1A 2Z2SB 4XZCA 2VJFA 3AECA 1GOHA 2Z4FA 1NWMX 4LBJA 4WM8C 4HT1T 2X8KA 3VL9A 1SQ4A 3POBA 2MEV2 4O65A 1DVPA 4H9OC 1MS0A 2ZHMA 3BCWA 4BCUA 5LBFA 1C4RA 4Z0OA 1K3IA 4IV3A 4Q4W3 2FUPA 5FXWA 3PUAA 3RI9A 3MPPG 1XB9A 1KFUL 1UO9A 1X33A 1LOGA 2IIUA 2ZKNA 4HFSA 3C7GA 5A3UA 3ACLA 2GH2A 3A0KA 4UFJA 2J1TA 4I4TE 3Q8AA 3N9LA 2IXKA 3B9CA 5I0RA 2SLIA 1HRI2 2ZS6B 1WIMA 5LYJE 1WFDA 4CCNA 3ZR6A 1S35A 1IKQA 2GP3A 3ES1A 5D8AB 2RM22 3NBXX 3O0VA 3PU8A 1W9SA 3ESLA 2DWRA 2OQ6A 1GNYA 5L9VA 1PX4A 4JI2T 3P5BA 2VMEA 4AI2A 1U5YA 4ZI2D 2WJSA 5KXDA 1PIV3 2QQUA 2X51A 3IDBB 2KXPB 1Y7BA 2VG9A 3EABA 5EZWA 1CR7A 5FKYA 1OVSA 2P5BA 5LK7B 3H37A 3L8RA 2YZ4A 4QMAA 3MO4A 3NO8A 4AF9A 2R32A 4CDWC 2H7VC 4WNKA 4YATA 1CN1A 4DUZT 4OHZA 2L75A 3N2GE 2K46A 1XWHA 1RUC3 3EHZA 4M4PA 5FYYA 5AQHB 3GZEA 4A41A 2B8MA 2KWHA 1LKXA 3QZVA 1JYVA 2PHRA 4A45A 1W06A 4QB2A 3ZMZB 2WFF2 5A7OA 4OYKA 4IIJE 1AX1A 2KLQA 3ETUA 1U5IA 3S7EA 4NHMA 2W0GA 2VUAA 1A78A 1GBGA 4A7KA 3ZFGB 2QICA 3QACA 2AR6A 5CZKA 2ECWA 1TVGA 1BEV3 5JDFA 4P9WA 3RQWA 2H6BA 1CZVA 1US3A 1ENXA 2MD7B 4QDSA 4QH1A 4Y5TA 2OWAA 2TEPA 5FREA 3PUYF 4YM1A 2NR4A 2AREA 2KD7A 5BYNA 2F4PA 3H42B 4XF0A 5KHIA 3H0OA 2JMJA 1RUNA 1YD8G 4HL0A 4SBVA 1Q8QA 1N1SA 2AE9A 4BQ2A 3LBXA 2W68A 2Q9QB 4K3UA 2YW8A 1WEMA 1LOEA 1Q43A 2AYHA 1G9FA 5IW0A 4P5OB 1DQ4A 3OGRA 2YU1A 1PO21 1V6KA 3W20A 5E1RA 2K17A 4L8QA 2HYKA 1T7SA 3CJIA 4ZQLA 1BZWA 2KWNA 2WNVA 2BS2A 1LB2A 2AH2A 3ASLA 4E4ZA 4XJAA 4KUMB 3M7KA 5FMCA 3LWCA 1GKBA 2KR4A 4COFA 5JXGA 2CSZA 4XFIA 2GK9A 5J3XA 4NAOA 1F2NA 2VZTA 1CIWA 3CX7B 3GZUC 4XE9A 2F42A 4LXLA 5JOXA 1EAH3 2GC3A 2D93A 4Z2AA 2VXRA 3O1TA 4V1PA 3CQOA 4EYYR 1WZXA 4X1YE 5FQ0A 3K1SA 1GP4A 1W6MB 3C4ZA 4B8EA 3JD73 2Q9QD 2HWF1 3IPVA 2AACA 4AYCA 1OKQA 4N7IA 5AQVB 4LLFA 5AQGB 4XACA 3Q1DA 3VKLA 3FN9A 1NKGA 4GWIA 4EWEA 4TX5A 4XIOA 4CZSA 2LRIC 3ZSLA 3DYPA 1PHMA 1JW6A 1EUTA 4DR6T 1IS5A 3NSTA 4MGTA 3TN93 4XF4A 1HIXA 3NKZA 1SLTA 2HBTA 2XOYA 3NVOA 3MIGA 2I74A 3VHRA 4KGGA 1T72A 1W8UA 4I3PA 1WEVA 1IS4A 2BW8A 2DUOA 2KIZA 2ODVA 5ABFA 3C7FA 5CVRA 2KXLA 3HL6A 3TYJA 1UQXA 2ZM6T 1H1AA 1GANA 4FPCA 2O14A 1R64A 2LKHA 2GDFA 2XQYA 3MV11 3FXEB 5DUUA 4ADZA 4YTPA 4J1XA 1NYWA 1BHGA 1WLWA 2ZGOA 3LF7A 4HFIA 3ABZA 4GKJT 4YHHT 4TV9E 3LDRA 3V5UA 4TWHA 3ENRA 4XC9A 1ULFA 1Z8UA 5JMCA 2B4KA 4IC3A 4C90A 1SLBA 1X50A 3ZTGA 5F2WA 4QX0A 4I0AA 2NAAA 2BG9C 4LO4B 2ECNA 5FZ4A 1HS7A 2IXHA 3AE9A 1QH6A 4M0NA 5C4WA 1OA2A 4HPKA 1MIVA 2WWUA 4G9SB 2A6ZA 2MNZA 4GKYA 4HFEA 3EDUA 2ZMNA 4DIQA 3AP9A 1LOCA 1J83A 3FZLB 5FOBB 2HWC2 5JI7A 4GALA 3AEAA 1D2SA 1VCSA 4WZCA 3C51A 3LPFA 3DJBA 4U74A 1DGRA 1LCLA 1OEDA 4N90A 5FMNA 1I6ZA 2EXHA 4IE7A 5FWEA 1NCRA 4IEPA 4IEVA 3M8LA 3T08A 1VBC1 2XQRA 4CQIA 1SE7A 3OD4A 3C8XA 1WR0A 2IQJA 2YEVC 3WOGA 3PJAA 3OBAA 2B45X 4F1PA 2CEAA 1OKOA 1DCQA 1AYM3 1W9FA 3KQ4B 4BISA 1OPMA 2QBXA 4JDOA 4FFHA 1W28A 1RXGA 1X79A 3ZJ2A 5CFCC 1BVVA 1OOPC 4YSZA 4IUGA 2O8OA 1N33T 5LRRA 5CNAA 5AQRB 1RUE3 4UBHA 3T8OA 2RG4A 5DAXA 2MPFA 3VBFA 1MEC2 4KQ7A 2QDRA 1K5MC 1DU3D 5DPNA 5EYAF 1HYIA 3WDXA 3NNMA 2PFWA 2M6MA 3MICA 3VBHB 5FZ3A 2UUCT 3WW2A 3I3QA 5LG4A 1H1IA 3VBOB 1Z7S1 4CSWA 2XMLA 2R1BA 2OA2A 2D44A 2X5IA 5FL0A 2W87A 5F39A 2LS6A 1QJY1 3QOPA 3DF0A 4BHWA 4LORA 3U07A 4H9PC 2BJSA 3CIRA 4JI7T 1RUG2 3I0QA 3AA1B 4MHUA 2A6VA 4U31A 3LRQA 4XDOA 3EMRA 4N9HA 4IE6A 3A8YC 4FJOA 1J58A 4QX5A 4Q0VA 3FBMA 5E88A 3WNXA 2FDIA 1NAFA 4DY5A 1SHWB 2FJBA 2UUBT 3KV5A 4CCEA 5FYSA 4XW3A 5CFDC 4JC1A 2BNMA 4YLZA 5EJZB 4MLKA 2DCTA 1LU2A 3KLSA 5LA6E 5E89A 1OC1A 1R093 2P9BA 4Z0RA 3FZKB 4S2DA 1R1ZA 5E8AA 1WESA 3DECA 2W39A 2P6HA 4DB5A 3K48A 3B57A 2RS12 1YIPA 2DVBA 5CKQA 3M2MA 1T6BX 2D5FA 2VULA 2HWF3 2YK0A 5FMBA 2ZEZA 3B93A 1HXS3 3Q9OA 2H6CA 4DV6T 2VMHA 1S55A 1ZNPA 2IWGB 5T52A 4CVUA 3CVRA 1UWWA 4RQPA 5JSRA 5FZ1A 3WAKA 4B3TT 4WBNE 5EK2A 4WM7C 2VNFA 4LMJA 1JU4A 4P9GA 4M01A 2QQMA 2EF6A 1IG0A 1CAUB 2WLQA 3RC3A 3T30A 1A8DA 1NG0A 1T1HA 4ZXKA 1GZTA 3ZFFB 4RS5B 4IDNA 3SISA 4ZPIA 2VTXJ 4RSUA 1O3TA 4X1IE 4JKKA 1CUNA 5A32B 4Y1VA 4YGEA 1WYBA 3K3NA 4AEDB 2ES3A 4YABA 4QB6A 4HE8A 5JR7B 2ERFA 3S30A 5JDNA 1JZ2A 3MACA 1WEPA 5TBNA 3AMMA 1Z6UA 1IPSA 2D8UA 1UGOA 4KG0A 4UVCB 2FUIA 4KU8A 4O7XA 3ZYFA 3WR0A 5L36A 4YVSC 3KGLA 1MQTC 4DV5T 4ILAA 4Q6FA 3R4UA 4FFFA 5IFPA 4UIGA 1M62A 5KXJA 1V6MA 2D7FA 3ZCIA 4A6SA 5H9PA 3AMPA 5FY5A 1YKHB 1BORA 3S7IA 4Q4Y3 1W2NA 2WIIB 1GSLA 3JC6C 5F3EA 3I3BA 5KBFA 1UY0A 1ACCA 2WZR1 4AEMA 1US7B 4LK9A 3OYWB 2DV9A 1HB4A 3KF5A 3BI3A 2C5KT 1ASJ1 1VAKA 1J1LA 1NCQA 1W6OA 3LFIA 1AYN2 1ZA7A 1SBDA 4GIWA 4HG6B 5D1MB 5FL1A 3VDCA 5LWBA 1UXZA 3D0TA 2D8SA 1RUF3 4KWJA 1Z0PA 4P0BA 2BDEA 2RR13 5FMOL 5J96B 1DCSA 1LDKC 1NQDA 3VD7A 1MBMA 3T1MA 4LBLA 4BQXA 1IBLT 2A70A 4DV3T 2WNUC 1W8TA 2HHHT 5FZAA 1ZRCA 4M3CA 4AI6A 2D6KA 1J59A 1EV11 3M3QA 3GA8A 1TME2 2OKXA 2LRLA 4YPJA 2FHRA 2J7MA 1OQDA 2DCKA 4A7YA 3GNEA 4NMIA 3R0RA 2RP4A 5ISLA 4JEUB 2FJDA 3MZKB 3K75B 1Z2QA 3ONLC 3J7NA 1C8NA 3P4RA 4O62A 3OUIA 2EAAA 1WEQA 4C9ZA 2L5UA 5FK7A 5A3TA 5LOVE 3RYCE 2AEZA 2LQ6A 4ITCA 1XRUA 4N7UA 3GBGA 5G05L 4CCOA 4L58A 5C13A 3JQXA 3KHCA 1WA6X 3O37A 1V9U1 2CSGA 3B9IA 4QXHB 4LOTA 3RWNA 2VZOA 1V87A 4PF1A 2JQKA 1VE0A 5F32A 2A75A 3FFQA 2YHJA 1WCQA 3NNGA 4RR3B 2UU9T 4PQQA 4ZZCA 2BWAA 4CEYB 3NKTA 1UUSA 2E9XA 4LF9T 4UFIA 2VNVA 5B4XA 1VBE1 1J84A 4IGUA 2VOTA 4C91A 1D0YA 3LSEA 5DQWA 1VPHA 4QQPA 4EZHA 3UGGA 1O4YA 2BEOA 2Y1MA 4H9RC 3O36A 3VUOA 3SOXA 2EALA 1POV1 1FPN2 5BNOA 2VCMA 2VJXA 3FHNA 3GCXA 1LKNA 5FYVA 2ZM2A 1WRDA 3I9YA 3C64A 1E2AA 4MOAA 5DUVA 4IEQA 2VQTA 3WXPA 1W8ZA 1IJ5A 2XZEA 3O1HA 4N53C 4G63A 2WNOA 3UJQA 4MHCA 3NZQA 1QJU2 2ZHLA 5HWXA 4MX3A 5FYBA 3T09A 2WC2A 2JWPA 1WMFA 3MV01 4U2ZA 5C9AB 3ZPV1 2YBKA 1FOD1 4QDQA 4KP3C 2KMFA 1ZBE1 1UY1A 2LM3A 1NXD1 2QJ0A 1H4GA 2P3KA 3T2QA 1WBLA 2X0LB 3PURA 2VZRA 5FTTC 1PNGA 2X9XA 2IZWA 5B75A 5GLWA 2WQ8A 3AYEA 2JIJA 3FZMB 5D1KB 1N1TA 1DGWA 1EUUA 3OVUA 4IETA 2WS3A 2R6GF 5DAQA 4QPGB 2BVBA 2CL2A 5EK4A 2VUDA 4Q4V3 1NA1A 3VL8A 4NHYA 2RMU3 4BAYB 4L99A 2XEUA 4GJYA 1YCIA 4EZ4A 3CX6B 1JOJA 4B29A 2V09A 3BU7A 2R071 2Y0IA 4JGZA 5FY1A 4ES8A 1AR81 4NIQA 4JHZA 1LTEA 3BQLA 4TV8E 4A3ZA 3WP5A 5IWAT 3N9PA 5EXOA 4YZ3A 2BG9E 3WF2A 3RQ0A 1U6GB 5L3FB 4DEVA 2PJQA 3VDDA 4GB0A 4DR3T 1TQ5A 2BU9A 1W9WA 4E7ZA 2CY6A 4FVVA 1VR3A 1LU1A 1Y9GA 1VBD2 3VBUB 3QBQA 2V7IA 4HFDA 2ECGA 1ASJ3 2XJRA 3MIEA 3QLQA 5DQVA 4PDWA 5FPVA 5LCWL 2CDPA 1KD7A 3MW3A 5AFEA 4AHXA 3RPGB 3CZJA 4YJ2E 3MFAA 1Q56A 4I0WB 1IS3A 3P4QA 2QUOA 1L3JA 3WQ1A 4AISA 2DJAA 3JU9A 2BBAA 1GWKA 1H1MA 3V64A 1QOTA 2O0OA 4ZOLE 2W2IA 2CHOA 3FZFB 1GMMA 4DV1T 2GSYA 1JZ8A 2VW2A 5C8CC 3LG7A 1YQ6A 4AW7A 4CI2B 4WZFA 2FCVA 4CDQA 4LBOA 4QX8A 4RHV3 4WV8A 1A6CA 4P00B 3F95A 2WWVA 3ZYLA 2E7TA 4F3JA 3AFKA 4NXMT 2CRBA 2E5LT 4O61A 3NVCA 4CYDA 2CBIA 4MUVA 4GWJA 5J1GA 5CG8A 4XZPA 4QHBA 3MW4A 2XQ7A 4P9LA 1CQ9A 5F1RA 3T4HB 5FNVE 3J7Yq 5FO8B 3WW3A 1F15A 2JD9A 4JGYA 4Q4X3 4YXDA 2V6XA 4TN7B 4RGGA 1QOOA 3U5MA 3OBVE 2YPDA 4FO9A 1VRH3 2OS2A 4WVZA 2GC2A 2RHPA 4GB32 2VMDA 2P3YA 4XAEA 3GWHA 3VBSC 1TNFA 4O9EA 4XTMA 4WVMB 5SV8A 2F17A 4CN4A 4GD4A 5F3IA 4YZ2A 3HEIA 4UW5A 4AFBA 2CDOA 4BZ4A 4LBQA 2JG8B 5JOYA 1OHFA 2BOIA 3T0BA 3ELNA 4YG0A 1PK6C 2ADEA 2H88A 4AQ2A 1DIWA 1JYIA 4ZU7A 3ORJA 1O3XA 3IWZA 4X62T 1WLDA 2OUHA 2RS52 4BMEA 3RI8A 2K9ZA 4CDWB 1OLMA 1XNBA 3V65A 4AQGA 3MF6A 5CB4E 3GGLA 1OQ1A 3I59B 3HN1A 1KDKA 3H1MA 2XJPA 1HQNA 4COWA 1UCUA 3D82A 5LGTB 1QJFA 4WW0A 4DUYT 2WZ8A 3OUJA 3IF8B 3BALA 2WWJA 1APNA 1XWMA 3MI8A 3P3NA 3AEEA 1T98A 1GQEA 1MM3A 3HT2A 4MGIE 5LY2A 1LR5A 3R6NA 1CAXB 1RVF3 2XJSA 5GZGA 1REEA 4JTOA 2VZQA 2YREA 1CD3G 1O5UA 4GKKT 1XMQT 2PHWA 4ET7A 3WNMA 1W2UA 1DF0A 4JI6T 4DXTA 2KWOA 2K5BB 3L09A 3GDBA 1AR72 4LA3A 4CU6A 3PNAA 5LATA 2ARBA 4FQ4A 2W47A 5DINA 3ACIA 3NAPA 1ZVFA 4WA6A 3RSJA 5F7UA 1Y9QA 5BNPC 4Y4RA 1BXHA 3FBZA 4XETA 3PUIA 1VB2A 5KX5E 3LSVA 1W03A 3VR8A 5B78A 5HCJA 2VZVA 1FATA 3RNSA 1JOBA 4BH9A 1JODA 4YVWA 2B9UA 2CXLA 1M06G 4UR9A 1F8VA 3SXWA 4N8MA 2LHRA 3ZT5A 2WY2A 1ZM1A 4N78D 2VNOA 1DZRA 2MHFA 3LQCA 3NV1A 1HX6A 2NN8A 3PUZF 2OYZA 3JAEA 3BGAA 4IEZA 3RZJA 1GOGA 2MPKA 1HV1A 1MACA 2D3SA 3H1WA 1YQ8A 2XUEA 4KL1A 2AC1A 4JAAA 5HXCA 4LA2A 3CBNA 2KM2A 4XFGA 5FDBA 1C8M2 3TWIA 3SS1A 4K7JA 2QA7A 3HKBE