3PUQA

Cekdm7a from c.elegans, complex with alpha-kg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
516
structure length
472
Chain Sequence
TPKESDRCGGCGKFTNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7 homolog
total genus 148
structure length 472
sequence length 516
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3puqA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3puqA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3puqA01
2LGGA 1WEWA 2YBPA 2MUMA 5FB0A 4TKPB 5ISLA 2YHOA 4CSWA 5FPAA 4Y3OA 2FUUA 2XDVA 5FZBA 3ASLA 5F3CA 3LDBA 4EZ4A 2WWJA 5FWJA 2BAYA 2VJFB 3HTKC 2Q8EA 2PUYA 3I2DA 5A7QA 4UF0B 4URAA 4GNGA 5G05B 4V3KC 5FYVA 5FXXA 2MIQA 3DXTA 4CUGA 2MA6A 5AIUA 5IVFA 3ZPV1 2H0DA 4YATA 4C8DA 4IGOA 3L11A 5D1LB 5FZ9A 2CKLA 5J3XA 2YBKA 2Y1NA 4Y4RA 2L80A 5DINA 1WIMA 1X4IA 4O64A 5F5AA 4AYCA 3N9OA 4Q6FA 3AVRA 4P5OB 3ZVYA 3DPLR 1LDJB 2YU4A 4NN2A 5DKAA 2LQ6A 3PUAA 4A4BA 4I7CA 2YUCA 3VK6A 3L1ZB 3O36A 5FYIA 2EODA 4V3LC 4BHWA 5TRBA 2W2IA 2M85A 3K3OA 4IGPA 5LY1A 3KV9A 2ECTA 4GB0A 4ASKA 1WESA 3ZLIA 1WE9A 3UYJA 5FY1A 3KVBA 3DXUA 2LGVA 3MHSA 3KV5A 4R7EA 5F3GA 5FB1A 5FJHA 2QIZA 5FZLA 2K16A 4S3OC 2EA6A 2XEUA 3N9LA 2KR4A 2YURA 5A7NA 3LQIA 3ZYQA 2P5BA 3RVHA 2KWNA 2YSJA 3GV4A 2YQMA 4CCKA 4A0CD 2VPBA 2WWUA 5D1MB 5A7WB 2PNXA 4UF0A 3O33A 5A7PA 1BORA 5FY7A 5F39A 2KREA 1JM7B 3EB6A 5FZ1A 5A7WA 5A3NA 4XDOA 5FY4A 2CKLB 4L7XA 2VPDA 5H1UA 4LJNA 2YPDA 5EYAF 4HOOA 2KFTA 1T1HA 3PHDA 2L75A 1CHCA 2VP7A 1X4UA 5FPBA 4TN7A 4AYCB 3ZVZB 3T7LA 2MD7B 4FO9A 2L43A 1Z60A 1VD4A 4A4CA 1ZBDB 4LLBA 4WA6A 4GJZA 1MM2A 2LXPC 2ECWA 4D6RA 2YREA 2YQLA 5FZGA 3PURA 4QX8A 2H0DB 4PTBA 2K4DA 3U5OA 2FUIA 4LKAA 2YSMA 5FERA 5FZ8A 5FJKA 1RMDA 2OX0A 4IGQA 5FXZA 3M99A 5KH3A 2KIZA 1V87A 2KGGA 4LADB 5LY2A 5FXWA 5A1FA 2M1RA 4WZ3B 4YABA 4F52B 3NJYA 3ZTGA 4CCJA 4E4HA 2YT5A 2CSYA 2YW8A 2KGIA 2XMLA 5FYTA 3C5KA 3LRQA 5FWEA 3U5MA 3IHPA 5FYZA 4PPEA 3KQIA 2Q8CA 2E6SA 4LIVA 5B76A 2Y1MA 3KNVA 4BU2A 5FZOB 5B79A 2JRJA 2LV9A 5F2WA 2KU3A 4C9ZA 5E6HA 2VJEA 3MHHA 2PXJA 5B75A 1MM3A 3U5PA 2CSZA 1Z6UA 3RPGC 5FP9A 5AITA 5FZCA 3ZPVE 4BISA 5IWFA 4GNFA 4AVXA 4XI1A 3RTRB 2MA5A 1WEPA 5FP7A 3O7AA 4CCNA 4GJYA 5A1LA 5FYCA 5IVJA 3C6WA 4I7BA 2HDPA 3KV6A 4UI9B 4YADA 2KWJA 2Y43A 2ECGA 4HONA 4GD4A 2Q8DA 5FZIA 5KH9A 3AL6A 3QZVA 5FPLA 3N9NA 5IVYA 2XB1A 4W4UA 1E4UA 3K3NA 5H1VA 3PDQA 2NAAA 5A7SA 5K4LA 4V2VA 4MSXA 4B86C 4BXFA 5LW9A 4YAXA 2OQ6A 4YC9A 5TABA 2I50A 2KYUA 1WGMA 3AL5A 2ECIA 4UP0A 2KWKA 2C2LA 5D1KB 2CT2A 4BBQA 2L5UA 1WEEA 4D6QA 3U5NA 5FYSA 4CCMA 4QU1A 1XWHA 5FZFA 5FYMA 5KH7A 4QXBA 5TDRA 3HCTA 4AAPA 2GP5A 2VD7A 5FZ0A 2ECJA 4FJCA 3L1XA 4FK5A 5F5IA 5ANQA 3SOWA 3DQVR 4N3WA 2XXZA 5B8DA 3OPWA 3O70A 1X4JA 4CCOA 5H9MA 3PU8A 3O37A 3KV4A 5FZEA 3PUQA 2VNFA 4L58A 2E6RA 5LKZA 5TBNA 2YBSA 5FPUA 3K2OA 3ZPOA 1WEMA 3LQHA 5F3EA 1DVPA 5KR7A 3EB5A 2HYED 3ZNIA 4XDPA 2JMIA 3GL6A 5LCWB 2LGLA 4GNEA 3N9PA 2JMJA 2YU1A 2MT5A 5FZHA 5LKUA 5LKXA 4N4FA 4YBMA 4LIUA 4LK9A 4WZ2A 4UP5A 5F3IA 4D6SA 5FY0A 5IVVA 4X3GA 5FUPA 2GP3A 5FZ7A 5A80A 2LXHC 5IVEA 4ZDTA 5IVCA 4LITA 2LDRA 5FZ3A 5A3TA 3PUSA 5FY5A 2KE1A 2EGPA 2LRIC 4MVTA 1WILA 1VRBA 4CCLA 3PTRB 5FP4A 4V2WA 1VYXA 5F32A 5FYYA 4FIPA 4CCGX 5FP8A 5TDWA 1WEVA 2MD8C 5FZOA 5FYUA 1JM7A 5G04B 5H1TA 5FXVA 4AP4A 2VPGA 2ECNA 5FZ4A 4QXCA 1HYIA 5F5CA 3SHBA 2LGKA 5FBJA 3RPGB 1WFKA 2OS2A 5FY8A 4IC3A 3U4SA 5IW0A 5FP3A 5FY9A 5IVBA 5B77A 2K17A 2VPEA 2OQ7A 4YBTA 4R8PK 4QWNA 2RSDA 3T6RA 2ZETC 4EZHA 1WEOA 5FYBA 3LQJA 3NG2A 1FBVA 3N9QA 5CEHA 3OPTA 2OT7A 5A3PA 3V43A 1Z2QA 1WEUA 3LD8A 2KWOA 2MNZA 5JG6A 2VJEB 5A7OA 4DIQA 2VJFA 1N87A 5F2SA 2G43A 5C11A 5LKTA 3M63A 2M6MA 4A49A 2MNYA 4WZ0A 2XUEA 2IDAA 5FYHA 5B78A 3HCSA 5FPVA 1WEQA 2L0BA 2ECVA 3O35A 5FZDA 2YHNA 5LWBA 4ZQLA 5FV3A 4QF2A 5FZKA 2FSAA 4LXLA 2RI7A 4YBSA 4Y33A 4R2YA 5A3WA 3M62A 4QXHA 1IYMA 3SOUA 2QICA 1HYJA 1FP0A 4S3OB 5FZ6A 2M3HA 2D8SA 1LDKC 3PU3A 4QX7A 2DX8A 1U6GB 4AI9A 4CA1A 5F37A 2C2VS 5FUNA 3O34A 1F62A 1VFYA 4GAZA 5FEYA 5G0FA 4DO0A 4GNDA 2YU2A 2K1JA 4NUBA 3HCUA 4EYUA 4QF3A 5FZAA 5FZMA 2OXQC 4I7DA 2F6NA 1WENA 2YYRA 1JOCA 5I3LA 1K2FA 2F6JA 2AN6A 2UZGA 5C13A 4ZUXU 3SOXA 1G25A 4B7YC 3N9MA 2G45A 4AUQB 3AVSA 2QJ0A 2F42A 2LN0A 3KVAA 4IC2A 3FL2A 3U78A 2JMDA 2G6QA
chains in the Genus database with same CATH superfamily
1QF3A 3WAJA 1DZRA 4JGZC 3TAYA 3O14A 5FO9B 1N3OA 4B3ST 1HX6A 4GALA 3MV11 2BAYA 1AXYA 2PLV1 3A7QA 1YFUA 3WUDA 1TZOA 4UF0B 2UY9A 1ZHCA 2JG9B 2UXCT 2ZEYA 3E6CC 4F6RC 1FV2A 4JKKA 5JVDE 3D0TA 4C8DA 3WNMA 4B8EA 2RVAA 3VD9A 4OVEA 2HBUA 1XXNA 2N2NA 5FL1A 4BA6A 5AQFB 2IXLA 3IDAA 3ZVYA 3PTYA 3L8RA 4JI6T 3DKWA 4A4BA 2KM2A 3EDUA 3HWJA 2YUCA 1GZWB 4KWJA 5EPAA 1UGOA 5LY1A 1W90A 4WVVA 1ALYA 3UYJA 2XQ8A 3JB8A 3ZSMA 4DUYT 5FJHA 2IIUA 1VBD2 2PELA 1SDDB 3DWDA 4EEDA 1POV3 1HNWT 2YKSA 4UBGA 2DI4A 1FMD2 4NPPA 4AI6A 2V73A 4GIWA 2C5DA 2YPJA 4FFFA 1G9BA 2VBPA 4CDWA 1HXS2 1O3XA 3ELNA 1C8M2 4IDZA 2E6VA 2R071 3BGAA 3OGVA 2RM22 1JYIA 1W6PB 4HSLA 3ZN0B 2WDVA 4Q27A 1S0EA 2H88A 2GC1A 3B69A 3DECA 2VZOA 5LY2A 5LA9A 2XBO2 4XFFA 2JEMA 4JEUB 5I8YA 1QY4A 3BVCA 3X29B 5FYZA 2DSMA 3WI3A 2Q8CA 2IXIA 2JDMA 5D8AC 1VLNA 1HX8A 3PLWA 3MV01 2ZZQA 4HBNA 2NMNA 3LQCA 3FZ3A 3USSA 1YEWA 1V9U2 4L92A 3AEFA 4H9QC 1O5LA 3AZYA 2VJXA 1H2NA 1ULFA 4PDWA 3WW4A 5AQKB 1CVNA 4XBLA 3PIJA 3LJCA 1IBMT 1UOGA 4MYEA 3S4UA 5FZIA 3AL6A 2C5IT 1YKHB 2V7MA 1LECA 1OEDC 4YVSB 4OGEA 4XJZA 2UWBA 5LW9A 5BNPC 4NRPA 3PUIA 1WEEA 2HWE2 4KUMB 1OUSA 3JBG1 4RQPA 1KEYA 4LK7A 3JD73 1VBD1 2XXZA 5J2TE 5SVIB 4LUKA 3FFQA 2ZOEB 4LTAA 3NRXA 4WZFA 4QKFA 3I9WA 2QUOA 4ZOLE 1AL0G 3KV4A 5FZEA 2TUNA 1QOOA 4L58A 4XFBA 4HN1A 4AFDA 3QB5K 3KINB 1WEMA 2WYFA 3RYRA 4K8RB 2ZMNA 4ADZA 3LG7A 1PO21 2RPAA 5EWSA 2RDRA 4WVMB 2GN7A 1KNRA 1PO11 4QQ2A 2B45X 5CZKA 3E0ZA 3ZC0A 1RB8G 4LJHA 2J1RA 2A3XA 3A7MA 2FQPA 5JQGE 4ZDTA 1AUYA 2G1MA 5A3TA 3UETA 1FMD3 1HQNA 2WT2A 3E5UA 3A0NA 4I55E 4XJ8A 3U3IA 3Q5DA 3Q1DA 3AYCA 3VBRC 3KGZA 1AYM2 2D2SA 3MEPA 4XUQA 3ZYPA 2FDKA 3POFA 5FY9A 5IVBA 4A7ZA 5GLWA 2SPCA 5CIRA 2DCFA 1C1LA 1GNZA 3N9QA 3RQWA 4ZZ5A 3OYZA 2KWOA 3P4PA 4XBNA 1KFYA 5B2GB 5CFCB 2C1FA 3H8OA 2V72A 3B9IA 3U75A 5A3LA 1ZA7A 1M7KA 2G43A 3KT1A 5IYZE 4XETA 5C11A 1FIOA 2PLV3 3VKFC 4A49A 1N1VA 4B29A 1LHUA 3L39A 4E2GA 2ECVA 2I74A 3LDYA 2RR13 2RI7A 1VALA 4OHFA 2LS6A 3VBSA 1IYMA 1Q56A 4COFA 4RS5A 1WCQA 2WZHA 4ASMB 4Y20B 2O8QA 4X6QB 5ABJC 2XQXA 4DUWA 2DL1A 1T7SA 1H6YA 2WNUA 1JOCA 5H6RB 4YW6A 1NENA 1RMU2 3ZMNA 4AI2A 2RA1A 4DUVA 1QUUA 2UWCA 4ZUXU 2X0HA 2B9UA 4XFGA 4CDWB 1WLTA 2G6QA 4LBKA 5CAZA 5ISLA 1FAYA 2GC3A 2L3LA 2YHOA 1QJX3 5FPAA 2DUQA 5FMDA 2W00A 1ACCA 1Y43B 4XACA 1JU3A 1MVEA 5FWJA 5C4WA 2UXBT 4JGYA 4JRAA 3RIUC 3ZMZB 3T0AA 3ZPV1 5EK2A 5C33A 2WJSA 4EOZB 1OQDA 2V7JA 5KHJA 3ZYIB 2OUJA 4QPGA 4LKEA 4A44A 2JX9A 4HKLA 3EJKA 4WW0A 4AYCA 4FQ4A 2LEHA 2JRKA 2P9BA 2MEV3 4AEKA 4ARYA 2P3IA 1DU2A 4EQVA 5TRBA 3FUOA 4QM9A 5BPXA 1PNGA 3ZLIA 2A6VA 4OQ9A 2CLYC 3B13A 4DUZT 3THCA 4LLOA 4DR3T 5JR2A 4JQRA 3ZYQA 2DTWA 2LHRA 1HXS3 4UF0A 5JR7B 5FIXA 3ZC1A 5FFOC 1C57A 3RGBA 2CCQA 2NM1A 1S94A 4J1WA 5IATA 1JOPA 3WG4A 1F35A 2IFRA 4QDQA 4I0UA 2W87A 2UY8A 1XDPA 2KINB 1ZBDB 1DQ0A 1RXFA 1AX0A 4ZHNA 2ZGQA 3U5OA 4HSJA 2B9VA 3VKHA 4HANA 4IGQA 3R05A 4QD2A 2X51A 1V87A 2WC2A 2Q30A 4LFBT 2W67A 4U3CA 4FCAA 4E4HA 4OFGA 4Q26A 1D4VB 2RS32 1VPHA 2WNVB 4CPBD 5AQOB 3AYAA 4RA0A 3R84B 3SFDA 2J62A 3KNVA 1LU2A 1IHMA 4E4ZA 3ME2A 2FJDA 4FFIA 1N32T 5D8AA 1NLSA 3EO6A 1RXGA 5L2LA 3RTRB 3BOWA 1RMU3 2WDQA 2JICA 4PFPA 2J1DG 1W2AX 5BNNA 4GJYA 2Q9QD 4DEVA 4XJUA 4CXWA 4I7BA 1PGW1 4N43C 2VZPA 1L3JA 5E8AA 4I0AA 3AL5A 2ZM6T 2C2LA 3LWCA 3RRCA 1OEDE 5DAVA 5CA6A 4CDQC 1WZXA 2VW0A 5DUWA 3I8TA 4NN0A 2XP0A 3CQCB 1VB2A 4ISQA 4HMZA 3AM2A 4FPFA 4K1YA 3FEHA 1BR0A 2YGMA 1Y9QA 3JUUA 1RL3A 3WG2A 2ES0A 1RC6A 5DPNA 5F3JA 3P1IA 4MXVA 1WMDA 3UESA 5I0DA 3QCWA 4XF3A 5JPMB 2DLRA 2MPKA 2HN1A 3AJZA 1VRH3 3VBUC 3O1JA 2VG9A 1X7NA 4AQYT 5FK7A 2R6QA 4X1KE 3HR9A 2VTXA 3NAPB 3PVBB 2RMU1 3Q8CA 2YU1A 1LKXA 1QQP3 2VBDA 4E4DX 3W59A 3EHZA 4HFHA 3ANWA 2ZXQA 1N1TA 3WNKA 1X50A 2ZABA 3C7GA 3PMEA 4ZZCA 4V2WA 1BEV2 3B5LB 1WD4A 5FP8A 5E0OA 3WNXA 4GWIA 4JDMA 2XQ9A 4F8HA 2JB8A 1D1BA 2HWB3 3ACLA 4RGKA 2D6KA 4AVBA 4HN9A 1SHZC 3AK0A 2JPFA 2K17A 1KITA 1DGWX 4YPJA 5L9VA 4TWFA 4KNCA 5CEHA 3ZMSB 3WQ0A 1TEIA 3LD8A 4GKXA 2QQNA 4COUA 5IT6A 5AQGB 5JVVA 1UZ0A 1LEDA 5JI7A 5LBQB 4UIGA 3WINE 2Q0AA 5KXBA 3M8LA 1VMFA 4L5GA 2BJSA 4AGRA 3K4ZA 2W63A 3NMBA 2Z79A 3ZYMA 4J6GA 2QYWA 5H6QB 5C4WC 3VDAA 3RIUA 3LEKA 4LXLA 2UYBA 2R072 2ZGLA 2X53S 3FWEA 2PA7A 2QICA 2CHNA 3MACA 5AC91 5FOBB 4BE3A 2DX8A 5C8WA 2IC1A 4UAPA 1RJ8A 3I0QA 3ETUA 3PUZF 4RS5B 3CJIB 4AR2A 3AE2A 4QB6A 3U07A 5M4YA 2LOPA 3OBAA 5I3LA 3BTZA 2WDRA 4E2SA 1IBLT 3WDXA 1H1MA 1PK6B 5J09A 1LODA 4RFRB 3AE8A 1NX9A 1V9U1 4O61A 1LB2A 3VB9A 2B0OE 2HEYF 3VDBA 3WX5A 1MIYA 3LBXA 5ABJB 1QMJA 1LAJA 1BK0A 1NXD1 2Q8EA 2XKOA 4JKMA 3LPGA 2MIQA 2JG8C 2WL1A 4HWDA 2Y0OA 3UQ4A 3CQGB 2Q4SA 3VBUA 4ATFA 3PVEA 4ZXKA 2KLQA 3ZFFB 3OEBA 4P02B 4U31A 1OLQA 3ST7A 4K6BA 3ON7A 1IS4A 1W8OA 4GB31 5F5AA 5A33B 1W09A 1ZBA1 3WP6A 4ZY9A 2LQ6A 3ZXEA 4DR6T 2UURA 1VBB3 4CEYA 1W8HA 4BOWA 4QQOA 4LF8T 2MEV2 2PHLA 5HXHA 1YQ3A 2W2IA 4QKDA 1MEC3 2EIBA 3BQLA 2JB4A 3ZMTB 5FB1A 2Q9QB 2W5FA 5GLUA 3POSA 2V5YA 1CAVB 5LBEA 3MUY1 2XLAA 1K5MB 1XJAA 1LOEA 4YZ5A 4JV4A 3CQOA 5KHGA 4LA3A 2ARBA 5FZ1A 4EWAA 2PHTA 1HRV1 4AKRB 3H3MA 2BV4A 3PHDA 3PUYF 1G86A 1ND3C 1X4UA 4TN7A 3INAA 1JH5A 4QAWA 1A8MA 1J1LA 3FZFB 2WUHA 5GZEA 5BNNB 3IDCB 4XABA 2CRRA 5C9AC 4D6RA 4RQPB 2YQLA 3PURA 4A3XA 3WCRA 4E4SA 1AYM3 4PCRA 3MPPG 5FERA 5FZ8A 1OFNA 1MMGA 2W2UA 3AP6A 4QDSA 5APAA 4P9JA 4CUBA 4JI3T 2LUWA 4WZ3B 1Y3TA 2CRWA 1W6OA 1O91A 1XYOA 2CSYA 1W05A 1JYXA 4UW4A 4QQPA 2K46A 3C5KA 1XNQT 5CKMA 1JU4A 2IQJA 1KNZA 1UWWA 2BDEA 2KU3A 4UWDA 3ONJA 1Y9MA 3LF7A 2ZLYA 1UQXA 1YD8G 1WYCA 2R0FA 5F6KA 1WEPA 1VJ2A 2QQIA 3AA7B 1UCUA 1A6CA 4OHZA 2RR4A 4UI9B 3JB4C 2J4GA 5C5TA 1ST8A 5H1VA 3K3QC 2NAAA 1X82A 5A7SA 1CAXB 1ONAA 3WDVA 4WM8C 4Z90A 4BAYB 4AQ6A 3QOPA 2VZUA 3LA2A 4BBQA 4N78D 3NL1A 4AKHA 5DZFA 3WVJA 4KBZA 4YZ1A 3BUCA 1UCXA 5LHGB 4CXYA 1OXZA 1IOAA 1OXCA 3MHZA 3RI8A 1WW5A 3L1XA 4FVVA 3AECA 2WM9A 1QSDA 3DQVR 4P0AA 1ZBE2 2VASA 1KS4A 4YVWB 4XEZA 4CCOA 3WAKA 3CZJA 5LJNA 1XZYA 2XPJA 2PHXA 3O1IA 2B1EA 2OWAA 5TBNA 4RGAA 2DCKA 1W9FA 4BPZA 3NWIA 2DUPA 1HB4A 3FC0A 5LCWB 4GNEA 2A70A 2OYZA 1FPN3 2JMJA 4XFIA 3NNFA 4Y1UA 2DUOA 4NMIA 3JUEA 1D1AA 1R082 5SVYA 3RLFF 2LXHC 4DEQA 3LZZA 4FTBA 1X33A 4L9BA 4BQ5A 3FHIB 2MAWA 1GNYA 1WCDJ 2VE1A 2UUAT 4W4ZA 1QXRA 2WLPA 3EABA 1JZ6A 4JZRA 4YSFA 2P6HA 1OPOA 3K4AA 1CZTA 3UJOA 5FP3A 4LF7T 2WZR2 5C3JA 3UT5E 4YM1A 2B46X 4X8NA 5CFCC 3S30A 4Q4V2 3GXUA 2WBLA 4H9PC 5A3PA 1WEUA 1GICA 5JG6A 4ILAA 2VULA 2E51A 3J26N 4OZOA 4UFMA 1DIWA 3M63A 1VBC1 4IL4A 4Y5Z0 3HCSA 5J48A 4LKSA 1SLTA 3RJ2X 4GWJA 4YARA 3IMMA 2V5CA 2D5HA 3RGLA 2ETEA 1AHSA 4A98A 1RUC1 1NA1A 3RQUA 4AI9A 2ET7A 3GYDA 3VBFB 5FEYA 2K1JA 2FMDA 3EB7A 4ZI2C 2VBBA 1HR0T 3C3VA 3N2GE 3VLBB 2PFVA 1DP0A 1UOJA 2YYRA 1GWMA 1YIFA 1K2FA 1MS3A 2ZGRA 1O3TA 4XILA 2G45A 1QDOA 3H50A 4IC2A 4Q4X2 1C1FA 2CMRA 2OPKA 3LSVA 2NYYA 4X62T 3GZUC 2OUHA 3RZKA 4LMLA 2V1DB 2K0GA 4JGYC 1DDLA 5BNPB 3DKQA 3AXJB 2A5ZA 1T98A 3RF1A 3FN9A 1EPZA 2VJFB 4PBOA 4HEAA 3SWHA 3ZOIA 3MW4A 3F31A 4QPGC 4UXAA 5JIUA 2EVXA 5EYYA 4PIZA 1G9CA 2WFPA 4MSVA 5D1LB 5JMCA 4RS5C 5J3XA 2D0TA 2M13A 1WIMA 4E8DA 4P5OB 4ONUA 1RUG2 3T0BA 3O0VA 2XOYA 2CAVA 1ULEA 4IE7A 1DGRN 2VMFA 2HWE1 2WZ8A 4QX8B 4IGPA 3FM8C 1JOJA 1OQEA 3AMNA 4P08A 3OY8A 2IC9A 2YQMA 4A0CD 5JAXA 4LBMA 2QVSB 3AP5A 4AI0A 1WD3A 3M1HA 2WQYA 3IN9A 4DNYA 4A7KA 3NVCA 1JYTA 2VPDA 2H0VA 2DFBA 1ZVFA 3B01A 3AEAA 3VKOA 2WNUC 2EXIA 4FO9A 1VD4A 4UI9L 1WCKA 3IAPA 1C5HA 4LF4T 2WYSA 5KHIA 1OMIA 1AR73 4S2GA 1G73A 2V6YB 3LAGA 1MBMA 3V0AA 5JZGC 5FL0A 2UXNB 2F4VT 2RS53 3ENRA 2BNOA 3N4MA 3IDBB 5HYAA 3ZVXA 2ZKLA 2W1QA 2E2AA 1WW4A 1D0HA 4H3WA 4XOGA 1LHNA 4XHXA 1R1A3 2LRKA 4YFSA 3JQXA 4LF5T 1R093 2LM3A 5IWFA 2M6IA 2H6BA 1OA2A 1QH7A 1TME2 3C7EA 4CCNA 1I5PA 1RUOA 1F2NA 3O1HA 3Q8FA 4L8QA 2J1EA 3B7MA 4DY5A 5T54A 4AEMA 5DG2A 1ZZ9A 1VIWB 3I2FA 1U5IA 2W08A 4QWNB 1WUVA 2KWKA 5JOYA 2D6PA 2EICA 4XZCA 2ZGPA 1QOSA 2Y38A 4YGEA 5F7UA 3ABZA 4CUAA 3FLRA 1NY71 4YG0A 2F17A 4K40A 5HV0A 3R6SA 2VR4A 3E6DA 3CU7A 1GANA 3RNSA 2RS33 4D94A 3ZPOA 4DMWA 2VTFA 2PLV2 4YXDA 5KR7A 4PJLA 5JOWA 1POQA 4IW3A 2TBVA 4AKLA 3HKBE 3BQKA 2ATFA 1PVXA 4WM8B 2A1XA 3PJYA 4KP3C 1G7YA 2ZJCA 3O9XA 5A80A 3FE5A 1Z7S2 4MVTA 1PX4A 5BXXA 4CCLA 4Z2AA 1JBCA 4LMKA 2XOCA 4FPYA 2A3DA 4KG0A 1ENQA 1OVSA 1QJX2 1GZTA 3TLTA 3ZFGC 3U10A 4AP4A 2VPGA 3MZKB 3FXEB 3K48A 3Q8EA 4PBPA 3UL2A 1VCSA 4BQXA 1O8SA 1E1HB 1GBGA 4XQ4A 4DBQA 4YBTA 5L7OA 4R8PK 5G05L 2EXUA 4TX5A 4NRMA 2ZETC 5L9RA 4DOUA 5L4HA 3THDA 5BMVE 3T2QA 4LOSA 1DYPA 2BVVA 4RR3C 4F7ZA 4Q4W3 5DUUA 1RGSA 3AXDA 2HWC3 1PO23 4AAXA 1POV0 3ZFEC 4FFHA 3OOXA 4JI8T 2ZX1A 5F2SA 2Q9QC 4XXPA 4IL9A 2MNYA 2LT3A 2LM9A 3WW2A 4F83A 4W8JA 2Z42A 2CSVA 1PM7A 3AE3A 1WLXA 3TEYA 2XJSA 2SBAA 3WG1A 1OT5A 2GNTA 1HG5A 5CB7A 3N3HA 3HAGA 1DYOA 1H6XA 4Q2FA 4FBFA 2WSSV 5FKBA 3AE1A 4Z07A 1UY2A 2YU2A 2VMIA 3ATGA 2HH9A 3PL0A 1SLCA 3DCQA 2LSJA 1HNXT 4HVQA 2W1SA 1I94T 1AYM1 1H2KA 2JQHA 1BVVA 1HB2A 1BR2A 2F4LA 2YOEA 2BS4A 4BM8A 2GDFA 2I45A 1W9TA 3ROUA 4AFBA 4YHHT 4HKOA 3BOPA 3B3QE 4Y1YA 3PJQA 2JUNA 3MPBA 2JQQA 3DL3A 3ILRA 1XYNA 2CHOA 4EZ4A 4HE8A 2V4VA 5LHIB 2Z5WA 2AUYA 3EBRA 2P3KA 3W20A 5FTTC 4V3KC 3LPFA 3RIFA 3V5SA 1HW5A 1CGPA 1J59A 4CU7A 4YATA 1W0NA 1VAKA 1FNZA 1X36A 1LGNA 2A3WA 1QJU2 4IL7A 2JDPA 3T1LA 3N7KA 1T2XA 3AAIA 4FAGA 3W5MA 3VD7A 1W0AA 3U1XA 3HT1A 1UIJA 3AVRA 3DPLR 2PQQA 4H9OC 2E32A 2BWAA 2D3SA 5EJZB 3F2EA 5JZGA 4PJJA 3TOJA 2ZX0A 3KV9A 2ECTA 3AXEA 4ASKA 1ZZBA 3WF3A 1AL23 2FJEA 4D7YA 5LP6E 4DBRA 2P2KA 4WYVA 3GWHA 4XFAA 4MGIE 1GP5A 5A7NA 1PO12 1GNHA 1MS4A 2P3YA 1JMUB 3CX8B 2BGOA 2HJIA 5F39A 3ESLA 4P9IA 2ZX3A 4UV8B 1W2UA 1OC1A 5FY4A 5BNOC 1NT0A 2EAAA 3PLQA 4YZ2A 1YLLA 4WNKA 5HXRA 2J1AA 1F5JA 1S1AA 2NN8A 5FLHA 4GZ9A 3SOLA 4RR3A 4CRQA 4C91A 4N9HA 5ADXL 4LLBA 4LO7A 3P6BA 3SEEA 1OOPA 4CN4A 4QX8A 3AC0A 4Y1VA 1SLAA 2V7KA 2JG9A 3OGJA 1PGSA 1SBDA 4CXXA 2X09A 4LADB 2WAAA 3KS7A 1JZ5A 3CJIC 3AE5A 2QA7A 4IREA 3OPCA 2YT5A 1DQ1A 1I5ZA 4XFCA 4Q4X1 3IHPA 2PQSA 4AEJA 1AVBA 3K51A 2GU9A 2L9LA 2D3RA 1FI2A 3IZOA 3RYCE 1CIYA 2WSVA 4FQZA 2RDNA 4PIYA 4P09A 2IZWA 1Q8OA 4AVXA 4KMQA 1LVFA 2IW5B 4QX0A 1NE6A 3HT2A 2FCUA 2GMPA 4GYRA 1MACA 1VBB2 1HB1A 1PZ9A 1JZ4A 1K42A 4EN6B 5AFEA 5KBFA 3RFRA 4DV6T 5KH9A 5FPLA 3N9NA 3RKOA 2HWC1 1HS7A 1TMF1 2JDAA 2W46A 4YW1A 1U5PA 2D5FA 4XBFB 3RRDA 3LDKA 4YAXA 4L97A 4EV0A 4XIOA 1FYUA 2X0YA 4TWDA 4HFDA 4MFRA 4IEUA 4W6WA 5K0UA 1RMU1 4AK3A 1O4YA 2ECJA 4FJCA 3OTFA 4CEWA 4GMP0 5C2TA 1NAFA 5B8DA 3H1WA 2EHOC 3O70A 3T8OA 2YXSA 3FANA 3AEEA 4KI5M 3O37A 1ZZ8A 4H2AA 1UY3A 1N36T 3WY6A 2VQUA 4JYAT 2DBIA 2XAJB 1NCQA 3ZYRA 4CA9A 3RWNA 4Q4W1 2Z69A 3LQHA 1X9TA 4BCUA 1EY2A 1S2EA 4MGTA 4Q5OA 4XDPA 3AKQA 5BNQA 5SV5A 1W9RA 2BVBA 2ADEA 4PDWC 3ZFEA 4YNIA 2XVLA 4NIGA 5E16A 4UP5A 1W03A 1VBE2 3MLLA 4ZHQE 4WM8A 4O2BE 2N9DA 3ILNA 2LRIC 3ITQA 3ONXA 2WS92 5C9AB 2ADDA 2ZA9A 1O4TA 1ZP0A 3WW3A 4QB1A 2XHNA 4YY3T 1WBFA 4MGKE 4BHPA 4G2AA 1KEXA 5FZOA 1XQNA 1Q8QA 4Z82A 3MIGA 3SKVA 5LMNT 5F5WA 3GHMA 4URTA 1ZOYA 4U72A 2W62A 2EF6A 5IW0A 3E2DA 4YHJA 4XTPA 3VHRA 3AEDA 2ACZA 5FNVE 5JLVA 2HPLA 4DRVA 2JG9C 4OUEA 4ISTA 4Q0VA 4RD7A 2VOWA 1IG3A 2EIDA 5LBBA 3HI2A 3JC6C 2YDSA 2BBHA 5HCMA 2VJEB 4DY3A 1RUF1 2VZVA 1GUIA 2ZHMA 1K45A 4GYSA 1TVGA 3QH7A 1MZEA 5IHYA 5LYJE 4QXHA 4ORFA 3H7JA 4HZFA 2QBXA 2M3HA 4Z1VA 5FMCA 3I54A 4P5YA 2C2VS 1I3HA 1YW0A 1VFYA 5KXJA 2OW4A 3NKGA 3F57A 5LZ6A 3T2TA 3VHLA 3ZSTA 4EYUA 1SFPA 2VCCA 3ES1A 5LCWL 4XUPA 1MPXA 2C0SA 1CAXA 2AYHA 1AR92 3SLIA 5LGTB 4WV8A 3I59B 5J1XA 1HCIA 2XQYA 4FOWA 1LOAA 4ATEA 1NCRB 2F42A 2A2FX 3UGHA 1LULA 3SNMA 5AC93 3K4DA 2LW8A 2YBPA 4NJ4A 4MGZE 1Q43A 4UFLA 3J8F3 1DU3D 1PVC3 3GGLA 1YQ8A 2XSAA 1YQ4A 1T72A 2BW8A 2IFWA 2HEWF 3HMYA 5H9PA 3F2ZA 4JC1A 5D8AB 2W91A 5CADA 1AXZA 3NAPC 2L80A 4DRRA 4FAHA 1DCSA 3PIGA 1LDJB 1UMHA 4YW3A 3ZYJB 3NZPA 2K9ZA 1AYN2 5JDMA 4A5XA 2QQLA 4LORA 4ZI3D 5CA1E 3EDVA 1COV2 3KFWX 5HWYA 2QIZA 1QJY2 3FZHB 1O4ZA 4FXKB 4O4JE 2KR4A 3RWKX 3N2KE 2LKHA 2XKPA 1X8MA 1EYBA 3M3OA 1N3PA 2W39A 3SS1A 3AZZA 3K77A 5FY7A 1JM7B 4GWNA 2X10A 4YTPA 3ZJ1A 1AR83 4L7XA 4JEHB 2KT9A 3IKWA 2R1DA 1CAVA 2R49A 2L75A 1PX3A 4YZ3A 4CU6A 1NE4A 3ZN4A 3T7LA 1BQPA 1Z78A 3G6JB 5K3QA 3VBRB 2JG8B 2YFZA 4KWLA 2LE8A 3SCGA 5DAWA 3SEPA 1WR0A 2DWKA 1AR61 2WN2A 5C71A 4PTBA 4WBOA 2VK9A 2G9GA 3UTKA 4PJNA 4IGUA 3JXSA 3EYPA 3FJSA 2PYTA 3T1MA 1UNBA 2ES3A 3ASIA 1QOTA 4AQGA 1GWLA 3KCCA 2DJAA 1UMIA 3ZX7A 4LBQB 2KA3A 2OV9A 1BZWA 4ZU5A 3CNAA 3VBOA 2QFEA 3U14A 1UZWA 2Y33A 4Y1ZA 3WNNA 5A6QA 4C9ZA 5F9TA 3KGLA 2WNVC 3THTA 4EN0A 1NZCA 3W21A 3WSOA 3ZJ2A 4IEYA 1LHVA 4JGYB 1FJGT 3SRZA 5T3NA 1CHUA 1RVF3 4ZS2A 3CIHA 1BR1A 5AC92 2Y43A 2DURA 1QJU1 1G9AA 2RHPA 2E7QA 1XC6A 3CEWA 1L7LA 2A73B 3AAEB 2KD7A 2KYUA 1Q8PA 2R043 4KU7A 4E27A 2JD9A 1WFDA 3VV1A 1BXHA 1W8FA 3BTXA 1OD3A 4NHYA 5A6XA 1O3QA 4HFVA 3ZFFC 3POBA 3HA4A 2WSUA 4UVCB 1CAWB 2GNMA 3D3AA 1WR6A 3A5XA 1UU6A 3S5AA 4QHZA 4PW8A 2WT0A 3BALA 4XC9A 2W0XA 2HWF1 3K2OA 4BJ0A 1MEC2 1RUF3 3FB2A 1JS9A 3NV1A 1TG7A 1JYVA 3MIBA 4R9BA 4XF4A 3BU0A 4Q4Y2 4AIUA 3Q8BA 4HFEA 1KXGA 1LENA 5DDJ1 4CP9A 3P7IA 4EAHA 5L73A 1ZEEA 4R4ZA 1A34A 1V6MA 2V4AA 2XVKA 2XL7A 1UY1A 3O4XE 5L3CB 4N43A 4B7KA 3JC6D 1WILA 4P5HA 1A3KA 2BG9B 4S2HA 4FIPA 4UFJA 4MHRA 1OI6A 1C8M1 1BYHA 4WZXA 4CDQA 3HKDE 4G63A 4JI5T 4ZZBA 3WUCA 2A71A 1TME3 4HGAA 3SHBA 1S0FA 4SBVA 4GK0E 2FDIA 2D97A 2HH7A 4EN8B 4XJAA 1QHDA 2VURA 2RSDA 2EHOB 2EXJA 3AB0A 4P0BA 3K46A 4ZPIA 1W04A 1W39A 2Y60A 2J47A 4AVSA 2J1VA 2RS13 2Y34A 2ZX4A 2IHR1 2DCYA 1ZA4A 2Y6XA 4UELA 3UUBA 4BK4A 1JXNA 2VNVA 3CJXA 2M6MA 2YVRA 1HN0A 1SPPB 5FYHA 3R4SA 4KBMB 5JDGA 2L0BA 2V7LA 4U7IA 5A3WA 5JXGA 3LOBA 4M3CA 3M2MA 4JI2T 1HYJA 3AE9A 1RVF2 2B76A 3AXJA 4Q8LA 3VZLA 4P1NA 4X64T 2WDBA 3OBZA 3O34A 4DO0A 3R6NA 4QF3A 2D7FA 3RYFE 2K9AA 4DV1T 3UKVA 4CE8A 2BBJA 4MLKA 1OVPA 3MJXA 4LPLA 4BK5A 1RUC3 1HLCA 4Q4V1 2QDRA 2WZR3 2JM3A 1CQ9A 4O4LE 3VBFA 4PAGA 2JDYA 3ASLA 3FFZA 1JYCA 3MUZ1 1FEWA 4Q4W2 4AQ2A 1VBC3 2X9XA 3I2DA 5A7QA 1Q8SA 2ZZJA 1V6KA 2VZ1A 4LBJA 2DNXA 3KT4A 2VVDA 4HL0A 3IEEA 4EEBA 3MK7C 3WF0A 2WNVA 2GMMA 2ZHLA 1CX4A 1JUIA 1NA1B 5C8CC 2YBKA 4DV5T 2WS91 3AMQA 2J1UA 4YW5A 5ABEA 3SCFA 3MF9A 2F4PA 4C1XA 3HIFA 2YN6A 1ND2B 4I7CA 3IT8A 1V6IA 4PF5A 3O36A 2CBIA 2EODA 4BHWA 4BB3A 2M85A 4AI8A 2Q9QA 2ZGSA 2N7GA 1SFNA 5L3EB 3HNBM 4CU9A 2LGVA 3MHSA 3B93A 3OJBA 1AL22 3ETQA 2VW2A 5JSRA 3OBRA 2WQ8A 1JZ7A 3CK6A 4RR3B 4OFZA 3DUIA 1A78A 4I3GA 4PIXA 2XJTA 4YGCA 2YPDA 4Z0RA 5DG1A 3ZDSA 3IB3A 3NO8A 5FPBA 2C5JA 1WW6A 3UU8A 5J0ZA 5CBLA 2A6XA 1W3XA 2LXPC 1ASJ1 3I2HA 3C4XA 2W9XA 2J22A 3RX6A 2YB7A 1YC61 4QX7B 1IBKT 5HXSA 4LQRA 2TEPA 3O1OA 1RMDA 4YZ4A 2G19A 2WU5A 2KIZA 5JXJA 4LKFA 3LVRE 1XRUA 2FD8A 1XNAA 3TEWA 5IJRA 3C7FA 1IJ5A 4HFIA 5AQMB 2QE3A 5FYTA 3LDRA 1V70A 2RDQA 3I2KA 2BNMA 4UBHA 2VCMA 4DR2T 5B79A 2I07B 4WVZA 4AG4A 2FDFA 2LV9A 3U5PA 5B75A 1IKQA 2CU5A 3RPGC 1O3SA 4Q29A 3CMGA 4YTMA 2EIEA 4U2YA 1JNRA 3MF6A 2H7OA 2VL4A 3EMRA 1V6OA 3ZFGA 2XQ3A 2UXDT 4JI1T 4YADA 1QWRA 4P9LA 5HXEA 2ECGA 4LHSA 3FZLB 2P4EA 2Q8DA 1H8VA 1PVC2 2RS11 5CISA 3B00A 2OZJA 1FOD3 1OOPC 2VUCA 2WNUB 4JHZA 2OQ6A 4DXSA 4WVWA 1NCQB 3P4RA 1UU4A 4OHWA 2LSGA 3GBFA 5FYSA 3ALQA 5LB6A 5KH7A 4QXBB 5JRCA 5LA0A 5TDRA 4AAPA 1RUH1 4IDOA 3AE6A 2CXDA 5L3DB 2C26A 4J25A 4ZONA 3MDBC 4Y5TA 2BUKA 5TAOA 2LRLA 2IDOB 3AJYA 4YJ2E 2EGMA 2YDRA 5DXDA 1W6OB 2YBSA 3D4KA 3LFMA 3AMMA 2RM23 1FPN2 3CDZB 4JKLA 3HR0A 3ZEFB 3AFGA 2MT5A 5FZHA 4Q4V3 2C4XA 4MX3A 5EYXA 2BS3A 4LK9A 5F3IA 4GXLA 4MUVA 3IAQA 5IVVA 1W28A 2XQRA 1W6MA 5LNKA 2EGPA 2RS51 4BMEA 5K0UC 4HXCA 1DHKB 3I7DA 1WEVA 5FYUA 3LK3B 5G04B 2VOVA 4A6OA 5FZ4A 3A22A 2XAFB 3VR8A 1QKQA 1WFKA 1ZREA 2J7MA 2VVFA 3H3AA 3POEA 2BP6A 5DZEA 2E7TA 1UN1A 5HV4A 2GAUA 3PVNA 1YYNA 3KF5A 2L9QA 1XB9A 3J8F2 1AJ3A 4IV3C 2AEZA 4FPEA 3VBHB 1FX5A 1GYKA 5AVAA 4DUXA 1FBVA 5ACA1 5T5OA 4QX5A 4LO8A 1K5MA 2RS31 4YW2A 4IV1A 3TEZA 2P17A 3SFEA 3VBHA 5FVKA 2PHFA 3OD0A 1H30A 1X9PA 1IGOA 1PGL2 2H0BA 4DS0A 4XCAA 4OX9T 3CPZA 1W6QA 3O0WA 1R1A2 2DVGA 2RP4A 4IE6A 5CYYA 5CKNA 4Y33A 5JDQA 5C5UA 5JI9A 3GN5A 3NW4A 5C6CA 4NROA 2B4KA 4CQIA 2LTNA 4L0RA 1B7TA 1OURA 5FLJA 2D8SA 2YYOA 1AX1A 1KS5A 5EV7A 4CA1A 3GM8A 2CAUA 4HTEA 1L7QA 4AFCA 5GALA 5HPOA 3AYDA 2D5UA 4B3RT 3SC7X 2PG8A 1RTVA 4FPGA 1Q3EA 4XF9A 3ZSEA 1DQ2A 4ES9A 3DEMA 4HFCA 1N33T 4JDOA 4FOYA 4AZZA 4OHVA 5B4XA 5FB0A 5H9QA 1PK6A 2A7AA 2FMYA 4UXNB 4ES8A 3QNUA 4P14A 2E33A 3CJIA 4UW6A 5H9SA 5AIUA 1MZ6A 2Z6EA 4LEJA 4IGOA 3UUNA 1ASJ3 4KG8A 3L11A 2QNKA 2ACXA 1UUSA 1FMWA 2Y1NA 1VAMA 4Y4RA 4QGMA 5LOVE 3ZKYA 5DQ0A 5A32B 4O64A 3ZFEB 1UPSA 5L36A 2ZMLA 2VCAA 5LBMA 1QJZA 1GKBA 1WLCA 3L1ZB 3PUXF 1J1TA 3ACGA 3O1UA 4OYJA 3U4XA 2YEVC 3HN3A 2EA6A 3N9LA 3LQIA 1D4M3 2ZMKA 2XOZA 2Z2SB 3UFEA 2UU9T 2OKXA 4BQ1A 2C24A 4XIKA 3O33A 5A7PA 1ND2C 1RUJ2 1E2AA 1O3RA 4U33A 4INDA 4UFKA 3M3EA 1W9WA 4BJNA 5C8CB 4M00A 2VNGA 2BERA 5DUXA 1J83A 3OYWA 5HCJA 2Y26A 1OKQA 5HEOA 2A6YA 2WLQA 1IPKA 4GJZA 1SBFA 4AOCA 1J3QA 2VQTA 2H0DB 2R32A 2K4DA 4UW5A 3GJAA 2FUIA 4LKAA 1YFYA 5FO8B 3CL1A 3WW1A 3HVDA 5FXWA 1IPJA 2C0ZA 4ISSA 1O6UA 5JPNB 3OB8A 5FWEA 4LO4B 2B7YA 2ZMAA 3N35A 4GIQA 4TNWA 2Y1MA 2JJ9A 4XJ9A 4EGWA 2BZBA 2JRJA 3P4WA 3KQRA 1E5RA 2HN2A 3ZPVE 4M4PA 2XJQA 4HWCA 1UYYA 4JDNA 3VR9A 1QIQA 5FP7A 3KM5A 1SZBA 2PHRA 3URFA 4GKYA 4RHV3 2CWSA 3J7Yq 1OPMA 3DN7A 3NQHA 4Q4X3 4DXRA 1IKPA 3PDQA 5K4LA 4BXFA 4PJMA 3USUA 4B7EA 4FTEA 4XQDA 3ZFFA 4CCMA 2JIGA 1VCTA 2RM21 5A3UA 4N53B 4CDQB 5KXCA 2VXRA 3UQ7A 4GB32 1OLRA 2KXLA 1TMF3 1I6ZA 2DCZA 1K12A 4X1IE 2ZGOA 5FPZA 1BR4A 1KD7A 4M3CF 5FQ0A 4PK6A 3JD72 3FL7A 2GC0A 2AREA 3JBG3 3C7HA 1J3RA 1XE7A 3EVYA 1LESA 1YFXA 4YM0A 4M3CE 4CP1A 2VNOA 2CGNA 3M4FA 5BY5A 4OHYA 4FPLA 4LHLA 2E9XC 2XQAA 4AYUA 5I0UA 1WW7A 2ZEWA 5FY0A 4X3GA 4IXLA 1KQRA 2GP3A 5FZ7A 4DXTA 2VU9A 5FZ3A 2KE1A 4CDUA 2WMOA 5A3OA 4AFMA 3WEZA 4RYDA 5FYYA 2YG0A 5FMBA 1UOFA 2CSGA 3AKPA 1ZBA2 3ZYGA 3S57A 1JM7A 5H1TA 3GJBA 1K3IA 4LHKA 5BV6A 2WY2A 1Z7S3 5ANNA 3BPZA 4RQPC 1DZQA 1Y01A 1WEOA 1SLLA 1ZBE3 5HEHA 2IVJA 5GLVA 2JDHA 3H1YA 4QQHA 1W6NB 3FMGA 1E5SA 3J7LA 1LU1A 3CIRA 1E5HA 2XJPA 2VCBA 2VM9A 5J1GA 5EXOA 1US2A 4QX3A 3H9AA 3P4QA 2L7PA 1D4M1 3V65A 4GA9A 4QPGB 2DFCA 3WP3A 1UZVA 3ZXLA 3VBHC 3BKZA 3HD8B 2LLYA 3M7AA 2XQ6A 5K8SA 5HEUA 5C4WB 2QGSA 4CDWC 5SVXA 4DNDA 3LE0A 4RHV2 4FPJA 2W1UA 3ZT7A 2B5HA 3PUHA 4Y5SA 5A6ZA 2ZGNA 3WT3A 4ZS3A 2WU2A 4NAOA 1V00A 2WCAA 4I7DA 1BEV3 1NCRA 5EHDA 5J7MA 4QX1A 5CU1A 5ABHA 3G7DA 5FOJB 5L3GB 1MMDA 4EXTA 1IJ6A 1DQ6A 5JDLA 1HTJF 3FL2A 3QACA 3SISA 1HX1B 5DMYA 1WA6X 2CLYB 3AA1B 1RYYA 4CSWA 2MKEA 1LHWA 3RRWA 3RPQA 5FZBA 2VO5A 5M0TA 3LDBA 2FBWA 1UY0A 2WWJA 3QD6A 3HTKC 1VRH2 2IMLA 5AQVB 1D4M2 4EB6E 2JKXA 2Q5TA 2D3PA 4NHMA 4BXSV 4XPVA 3CWZB 3LOIA 3OGRA 2CKLA 2XASB 1WA4A 2X8KA 1RUD2 4MXWB 3ZXJA 2NZ9A 2RS52 4UW3A 1XNBA 3VDDA 1X4IA 1JZ8A 1S0GA 5ERLA 4NN2A 2A6ZA 4I0BA 4UVBB 3I3QA 2XWJB 1WGPA 2ENRA 1MQTB 1YUDA 1JYNA 3ZIWA 1OF4A 4AEDC 3O1PA 3A8YC 2NR4A 3MLJA 2P5BA 1GZWA 3VZMA 3D5OA 2MOZA 2C9AA 5A7WB 2PNXA 1VBC2 4LF9T 4LBLA 1WWYA 2KREA 4YW4A 2PHWA 5C70A 4HK9A 3S5QA 4PK4A 1UF2C 3WHUA 4XDOA 2VAUA 1H8TC 2ZM8A 3WQ1A 1J3PA 2X5IB 2FJBA 3CKDA 4H55A 3ACFA 4CYDA 4R4XA 3M7KA 4A4CA 5EZWA 3AP9A 2W95A 2YY1A 2BRTA 1NOVA 5FJKA 4XVHA 4BIFA 3M99A 3D0JA 1KNPA 2R042 5GZFA 5I0SA 2VQAA 1OWAA 4Z2WA 3OD4A 4PPEA 3MA9A 2VL0A 4DINB 5B76A 3WDTA 4CDXB 5JR9A 3FHNA 4DV2T 3JD71 1MNEA 1VBA2 2PXJA 4OUSA 4EN9B 1VBD3 5HXVA 1QU0A 3IIAA 4KU8A 3GZAA 3POWA 3JCIA 3O1VA 3AB3B 2ID4A 4KQ7A 3O7AA 4DQAA 3NVOA 5FYCA 1KDMA 4XF0A 2BVLA 3OYWB 3TLUA 2QKDA 1RUF2 2X68A 4GD4A 2OA2A 1NCQC 1EAH3 1BJQA 5J37A 4A56A 1BK1A 2ERFA 2D8UA 3NKZA 1LR5A 3BCWA 4BQ2A 1WCSA 5CVRA 1FNYA 2AC1A 5FYMA 3KCXA 5T55A 4Y24A 5FZ0A 3IPVA 1LCLA 3SOWA 4DMVA 4OGCA 4CU8A 1X4JA 1UD1A 3VDCA 1HG2A 1YCIA 2YK0A 3ZT5A 1AR81 2BKOA 2V5DA 4YFZA 5D2AA 1GP6A 5FPUA 4AE2A 3ZCIA 5A32A 3N36A 3V56A 3LFIA 4V1Av 2JMIA 2W52A 1UX7A 4LHNA 3CBNA 1MVQA 3WDWA 4D7SA 3LEGA 1M4WA 3OPZA 1LOBA 5IK7A 2W68A 3ZSKA 5FPXA 5IVCA 1W8WA 5KXDA 4NHLA 1GFF2 3HQUA 1PIV3 5CNAA 1VYXA 2M67A 3ZIXA 4Y22B 5TDWA 3LVQE 4XMAA 4HKAA 1QQP2 4AWDA 2AZ5A 1UKGA 4LKDA 5C3SA 5FBJA 1HQWA 3U4SA 1UURA 3VHPA 3TKLB 1KRIA 2G9FA 2QZ3A 1V6JA 4ITCA 3J9SA 4BYYA 1F4AA 2V6XA 4DR7T 3T6RA 4O8SA 1UPIA 3ZXKA 1YNAA 3BYWA 5AVPA 5A1AA 4P9YA 3RKGA 2VVSA 1YJKA 3PDYA 4XAAA 3T1HT 4O7XA 1CONA 3MW3A 1W2TA 4O65A 4SLIA 1VMJA 4Y22A 2MPFA 1ZZCA 5AFBA 5DDJ3 4ZZ8A 4QH1A 2QCSB 4E8CA 4GMP1 2D6MA 3A21A 1WEQA 4ZQLA 5FV3A 5IK8A 4YBSA 3WDYA 3F95A 3SITA 2X9HA 4L2NA 4H7LA 4Q8KA 3H0OA 4O4HE 3Q9DA 4OK0A 4DMIA 4IEZA 3HOBA 5LA2A 1LDKC 3PU3A 1CZVA 4LNVA 5C3QA 3ZMVB 4A3ZA 4OMCA 3KDEC 2XTLA 4MOAA 4KL1A 2JG8A 3W58A 3K75B 2VQET 4TYSA 1V9DA 1QGLA 4NPLA 2NLRA 1UO9A 3AZWA 5F8PA 3JAEA 3CKHA 1KK7A 1BHGA 4U7YA 1K5MC 1RUE1 4AUQB 5GLTA 3AVSA 3I49A 5AQTB 4QGLA 3GDBA 4EIWA 2ORZA 1LOFA 3ZN1B 1U12A 1SLBA 1AYN3 2MUMA 3OYXA 2CRBA 3D6EA 2R0HA 3T09A 1YQ5A 3WP4A 1HXS1 2K24A 1W8TA 1H9WA 3TWIA 3H7HA 4R9DA 4B4QA 1AR72 2H0DA 5JWPA 2QRXA 1VBA3 3MIHA 1RUH2 1W3VA 5DINA 1ULDA 3VRBA 3A0KA 5LRRA 2FDHA 1KFXL 3VK6A 1ND3A 1D0YA 4KWUA 4TTGA 5FYIA 4V3LC 4MALA 1AX2A 3OG2A 2B39A 2YC2A 1WE9A 5AQLB 1LNSA 1PMJX 3KV5A 4K20A 4PDWB 3FBZA 1HB3A 2MHFA 4KWKA 3CX7B 5JRCB 3WZ1A 1SACA 3M65A 4FP3A 1IG0A 2IUWA 3MFAA 1W06A 1XWMA 5A3NA 3FUQA 1Z8UA 4EROA 4FI9A 4LJNA 1MEC1 5J98B 3VBOC 4CCCA 4TV9E 1GOHA 3RZJA 4QT6A 3AP4A 2YROA 2WQZC 2QQUA 3I3EA 3W9AA 4IHJE 2GK9A 3AX4A 2ZACA 1W6PA 2ECWA 5FZGA 1OA4A 1CX1A 3U37A 3N7LA 1SCRA 4YW7A 4XFHA 3WXPA 3ZR6A 4MLOA 4XTMA 3ZFGB 4I30A 2W4XA 2RJKA 4Q0UA 2PTFA 1UY4A 1ZZ6A 1US7B 2QZ2A 4F52B 4LO6B 4CCJA 3JCFA 2J42A 4MGSA 2BPA2 1X79A 4XMIA 2RDSA 4NHXA 3MFCA 1DCQA 4N7IA 1CPMA 4A41A 3E5XA 1QJY1 1EV13 3MHHA 2XY8B 1F5FA 4B1LA 5AQNB 4KI0F 2CSZA 2XHEB 2BKNA 3B9CA 2O8OA 3D8CA 5LK7B 1VRH1 2JD4A 2WS93 4CP9B 1C4RA 4M0NA 4CPBA 2VUAA 2W94A 5LEJA 3T0DA 2W61A 1EAH2 2WNOA 2YINA 4QHOA 1QEXA 3I3BA 5D1KB 3ZMUB 3UT0A 2BYVE 4BLIA 2L5UA 2E26A 4XUOA 5FK8A 4LA2A 3U5NA 1YWKA 4DR4T 2XPKA 4QXBA 3IBMA 4OHXA 5F5IA 1VOMA 5JSPA 3HNYM 1LVKA 3R4DB 1ULCA 3UV9A 3SH3A 1GU3A 3H8XA 3ZKUA 2E6RA 3H3ZA 4UFHA 5LKZA 3NKTA 4AVVA 3SMHA 3OUIA 4OCTA 5F6LB 1FMD1 2YFUA 4IE4A 4AXOA 1JHNA 1GWKA 3IIIA 1SBEA 1X9BA 2JDKA 5C3RA 3I0OA 3CHXA 3ZCJA 4GMP3 4DFSA 4MGYE 1T6BX 3W5NA 3DF0A 4LLFA 2XZEA 2IUBA 3WF1A 3UULA 2K3WA 5FY5A 2Y6FA 4E7SA 3VZKA 4XAXB 3J7HA 1REFA 3POIA 1XPWA 2CXLA 4I02A 4NHKA 3HKCE 4QXCA 1YO8A 3O1TA 2VC9A 4BA9A 2CYFA 1ZKEA 4IC3A 2CDPA 1AR91 1OSGA 1DYKA 4QM8A 2VPEA 2VOTA 4QWNA 2JIJA 2XB6C 4NUVA 5FYBA 3LQJA 2RV9A 1F31A 4ILCA 4DV3T 2Z4FA 3V43A 1Z2QA 4A42A 1RUJ1 2IXCA 3AZVA 2JECA 1FXZA 1ZRRA 1XNRT 1O8PA 4M3CB 1UXZA 3O5SA 4PFOA 4O9EA 4QMAA 1ASJ2 3MBWA 1EV12 3MIEA 1EUUA 5JMOA 2IDAA 1W9SA 4CP0A 4K7JA 3IM0A 5KWRA 1QNYA 3AP7A 5FZKA 4R2YA 4XHBA 3M62A 4COVA 4MG2A 1VBE3 4X8PA 1QJFA 1AJOA 2W47A 5FZ6A 4FFGA 3PE0A 2ZEXA 1AZDA 3GZEA 1IPSA 4TSVA 5SVIA 1ND2A 4HKWA 2QDNA 3WG3A 1HN1A 4L99A 4UVAB 1N3QA 3IMNA 1KFUL 2HYKA 4NWWA 2F6NA 3DPRC 2A9UA 4YSXA 4EV6A 2X5IA 3HBZA 4X1YE 1S0CA 2X05A 1WCUA 1H2LA 4COZA 3UU6A 2JXAA 4HWHA 4NO4A 2XGXA 2ZGKA 2JMDA 1URXA 1WEWA 2XG3A 2R062 2VVEA 4BDVB 4TKPB 1UOBA 2XDVA 2D0UA 4IDPA 2WZIA 1LOCA 4U36A 4CDXC 1C3HA 4AHZA 3C4ZA 4X6RB 1H2MA 3PNAA 4HFBA 5IUXA 4Y1XA 2PUYA 1NZIA 1YQ2A 3N7JA 4EJRA 4CUGA 2MA6A 2BOIA 1LTEA 2HWC2 2E9XB 3QBQA 3VZJA 3UUMA 1W99A 1I1EA 5K7PA 2FZ2A 4D0QA 3A4UA 4YGBA 3MICA 4WM7B 4LMFA 1NA1C 4MXWA 2LJLA 3C8XA 3UU4A 3RC3A 4I50E 4NE9A 3SH5A 4FTSA 4COYA 2IC6A 3NV4A 3RC8A 1GR3A 1WESA 2MYSA 4U74A 2FCTA 5GM0A 4XYXA 3RQ0A 4GH4A 2LOSA 2CV6A 3PUWF 2YURA 2LSIA 3WD5A 1SPPA 1NLQA 4CCEA 1R083 1J1JA 1T8BA 3FX3A 4OULA 1MZ5A 3I9YA 3ZR5A 4YVWC 1RUI1 4Q0SA 3KCYA 2JIWA 1D2QA 4PLMA 1NQJA 4K0KT 3UGFA 1DZTA 4HOOA 1PIV2 2BBAA 1NWMX 1HF8A 2RR11 5HI0A 2Y6HA 2MD7B 4K3UA 1NXMA 2DCTA 3EAMA 2EHOA 2FHRA 5LG3A 3CZUA 2D6OX 2VZTA 5FBZA 1O7FA 2I59A 4LFCT 5C8CA 4XE9A 2W66A 5I93A 3EXUA 3M70A 4G3YC 4WZCA 3TN91 4QPYA 2ZEZA 3VBOB 1RUE2 2DVDA 2YW8A 2EXHA 2LAUA 2C5KT 3AEGA 5D1IA 3OGSA 4BIOA 1OQ1A 3GN5B 2NP9A 5FZOB 3PVOA 4BQYA 1G8WA 2EIGA 3AAAB 2Y64A 3IA3A 3RPUA 3FBYA 4K1ZA 5FP9A 5KX5E 3DV8A 4FI5A 4TLFA 4V1PA 4XI1A 2FBEA 2NW7A 2FDGA 2IXJA 3NJZA 5KDMC 3AKTA 4W50A 3LSDA 1RUJ3 2ZX2A 4JTOA 4FOQA 2X9YA 2KR2A 2ET1A 5FUIA 3NV3A 2K5BB 2YDQA 4R9CA 4AISA 4V2VA 1OBNA 2RR12 4B86C 5CFDB 5FR3A 2Y6JA 5E89A 1R1A1 2I50A 1AXKA 3C50A 2CT2A 1ZRDA 1YIPA 3R0RA 4D6QA 3AKRA 5FZFA 5A3MA 2FFWA 2GP5A 4XW3A 2JMHA 2JKBA 4RHV1 5JH7E 2BG9C 3OBVE 3GCWA 3C51A 3J8F1 4N3WA 1HDKA 5ABFA 1JHJA 1YI7A 3O12A 5AQSB 3POGA 4IT4A 4YM2A 5C8YE 1HV1A 4KGQA 5LRSA 3K1SA 4H14A 2BG9E 4R9AA 1UL9A 2EALA 1V0AA 3LJUX 1Q5OA 3T1YT 2H3RA 3RI9A 5E1RA 5EZYE 4YBMA 2VXJA 1OLME 4FOVA 1MMAA 2JMKA 4JRLA 4L0PA 4PT6A 3TEXA 5F1RA 2LDRA 2UXXB 3UKTA 3SQOA 1VRBA 2JE7A 2MD8C 1G6NA 2BKPA 4S2FA 1JOBA 3I59A 4KH9A 2XBO1 4CN6A 3V0BB 4IE5A 5HWXA 3EHKA 1N1YA 1REEA 3H7YA 1B35A 2R061 2CNAA 3K8PC 3PUGA 2K2SA 5CG8A 4AKIA 1YJLA 2XSBA 3ZXFA 4LFAT 2LM2A 1BCXA 3QUJA 3H3UA 2UUBT 4GH4B 1S0JA 5A7OA 1POV1 2DVAA 4D3WA 3RZZA 1TNFA 3RS6A 3I2IA 2XHKA 1NLRA 4WZ0A 4Z91A 2CWYA 2YMZA 2ARAA 5FPVA 1BBT3 2XH6A 3ZSJA 4UOJA 1U0AA 1W6MB 1OLMA 3H1MA 3P50A 2R073 4GKJT 4DPNA 4H7MA 1ZV4X 5HCHA 2R041 2E5VA 1F62A 4IDQA 4GAZA 5G0FA 5T5LA 4JVAA 5GZCA 2P6CA 5FZMA 2LSYA 4F3JA 2VKDA 2F6JA 2QJ0A 2LN0A 3RYPA 3O1SA 5DQVA 1ZBE1 3FXDB 1MIWA 3ZYBA 1ZX5A 5H9RA 3RZHA 4AVCA 4DV4T 1ODMA 4CTEA 5EQUA 4B1MA 3DP7A 3MXZA 5BNOB 3U11A 3FBLA 2RMU3 1L7RA 1T6GC 3LKJA 3S6PA 2HKXA 4GNGA 3PUVF 5G05B 5FYVA 5I8SA 3KBUA 2ZAAA 2XONA 4NRQA 2Y6LA 2CGPA 5EFUA 1B35B 2LALA 3LK42 4PQQA 3HEIA 3OUHA 3S7EA 3AFKA 4XURA 3B94A 4NOTA 5I0RA 4Q6FA 1LJ7A 1HV0A 2CGOA 3NJXA 4NIAA 3PUAA 5JXHA 1IQDC 1CAUB 2E9XD 5CG9A 3ZKRA 3VHOA 4B4PA 5FY1A 1HRV3 3DPRB 4Y4YA 2K16A 4S3OC 2ZPXA 1RITA 1HNZT 5JIAA 2DWGA 2KWNA 4IQPA 2VPBA 2WWUA 1J5ET 4EN7B 5D1MB 3PV0F 3J7NA 4ZU4A 1BORA 4ERRA 2BOJA 3NRUA 2NW9A 1AR82 4HT1T 4OI2A 4B4RA 5L4EA 2ODUA 5ABJA 2PFWA 5K0UB 2NPIA 2KFTA 2ARXA 2WWVA 3Q9OA 1QLBA 1C8M3 2QTWB 2L43A 1W8NA 4RN5A 3E97A 1MS1A 4KMCA 3H42B 2Y6KA 2EA7A 4FPOB 4NIIA 2CXFA 4JGZB 2ILMA 3J9X1 1Y7BA 4NIHA 1NEKA 3Q8AA 1RUD1 2YSMA 1JNZA 2HYXA 4TWHA 5HXCA 1U4QA 4QXKA 2CA5A 5GZGA 5L7OB 1F9KA 1R64A 4WM7C 2M1RA 1R1ZA 2JQKA 1QJX1 2KGIA 3AKSA 5E88A 3WNOA 4X5TA 1TQ5A 2UU8A 3KQIA 4LIVA 4BU2A 5I0TA 4JHTA 5AQUB 3KF3A 4AEDB 4OMDA 2WP9A 3LB9A 5KHKA 1IS6A 2VKJA 2QJVA 3JZVA 4TZ4C 5L47A 2G9ZA 2EHOD 4UYBA 3KV6A 1CJPA 4I4TE 2XJUA 3NWKA 5BNOA 4W4UA 4CI2B 2XAHB 3LEMA 4JLEA 3PJAA 2WNEA 1WGMA 4OI4A 3THPA 3OUJA 3H3LA 3AZXA 4K9SA 5LEKA 3RYIE 3TB0A 3VBSC 1WLDA 1BKZA 3RJRA 4AXPA 3WF4A 2IAKA 4PJYA 1M06G 4YYOA 4LMJA 4AGGA 1U5XA 1XE0A 2WO7A 1OH3A 2WWSA 3HNMA 2G0UA 5KHHA 4HWFA 4M1PA 2B8MA 4NWVA 5C3OA 1L0VA 4DVDA 1XNTA 3KWVA 1ODNA 5ABGA 5FREA 1RUI2 1CPNA 2OIIA 4XUTA 2VZRA 4YLHA 2PAMA 1W8ZA 4XBQA 4B3NA 3T4VA 3GL6A 5L19A 5GJ6A 5LXTE 5AQHB 4YJ3E 2WFF1 5LKUA 4HPKA 3M3ZB 2KXPB 1GV9A 4AF9A 3QH6A 1YXRA 1GQEA 3KHBA 4C1WA 4NXMT 2RJLA 2DVFA 4LITA 3PUSA 1JODA 5LB7B 2XAQB 2P1BA 2PBIA 2GZWA 4JI0T 3KDSE 3OEAA 3HQXA 4IERA 2XJVA 4IIJE 2R1BA 2VMDA 4QQ4A 1UU5A 2XM1A 3OF1A 5FMOS 3N7MA 1HYIA 2V26A 4QH5A 2VMHA 4LE3A 5DABA 3ZYHA 2OLTA 1AR63 2WR9A 3WLUA 3H8RA 1FT9A 1OOPB 1KGYA 2AACA 4A2UA 1GZ9A 1WKYA 3TN92 2WO2A 4EZHA 4AI1A 4RGGA 1JZ3A 3CMLA 2VPVA 3RMXA 3UUXB 3MIDA 3ZN5A 2VVNA 2WO1A 1WMXA 2KWHA 1NCRC 1N87A 4YSZA 3WDUA 1GQPA 5AQPB 5JR9C 5J36A 2YC4A 3E6BA 4FSJA 5HBAA 4N9IA 2WFF2 4WBBA 4AVAA 1IAPA 3O1RA 1SA0E 3O35A 2D98A 2WAUA 4N43B 3LGRA 3JADA 1J58A 5JREA 1UYPA 4PF1A 3Q5EA 3P4SA 1RUI3 3MGUA 3E5QA 4QX7A 4IUGA 1U6GB 2QVAA 3DJBA 2ARCA 2O14A 3TLVA 2CEAA 5FUNA 5CGMA 2GSYA 3NRYA 2V8SV 1WRDA 3HCUA 4LOTA 5FZAA 2DTYA 1BVP1 1JN2P 1CIWA 1RUD3 3TYJA 4EWDA 1W2OA 4AW7A 1MS0A 5DAXA 2WS3A 3NAPA 3SOXA 1YI9A 1WMFA 2BS2A 4A7YA 3U78A 4M4RA 4H63H 5CA0E 5IK4A 3JQWA 5FDBA 3CX6B 2OXBA 2C9KA 2YDEA 1Y64B 5GZDA 4Y20A 4M01A 5I91A 4CDUB 5F3CA 3VD4A 1FPN1 2E8IA 4NIDA 1H4HA 3ZT6A 4QX2A 2MBGA 4AEDA 5FO7B 3VKLA 1ZRFA 4HWIB 3V0BA 2IVIB 2XJ7A 1RUH3 3UGGA 3RIAA 5LBFA 3QK6A 4ZU7A 3UU5A 3TBDA 2XL9A 4LT5A 1S2BA 2VQ0A 1TMF2 5FQ0B 2VTXJ 1H1AA 5T5JA 2OVUA 2Q1ZB 3WP5A 1FOD1 3QLQA 5LA1A 3PMSA 2AR6A 3JU9A 3GHNA 2ZGTA 2XOMA 2BFUL 4CEWC 4MHUA 2VMCA 1CJDA 1VBA1 5FZLA 3C2UA 1Z0PA 3J7MA 2HWB1 1PMHX 3RYKA 2WKKA 1DGLA 2DHRA 4CCKA 1IZNB 2WAOA 2Q1MA 3G06A 4KGGA 4HG6B 1PMIA 1SEFA 3SXWA 4XXAA 5JZGB 2CKLB 2I0MA 2QQJA 3NNGA 3KLSA 1T1HA 4PI2A 2GH2A 4ARXA 4MZUA 1CHCA 1RHI2 4JBWF 3HL6A 2PHDA 5D21A 1ZRIA 4F8AA 2FJAA 3OGGA 3GNEA 4WA6A 5EIYB 2YREA 4BQ4A 3QOFA 2VKOA 4CZZB 3FHQA 1C5IA 4A97A 1G8XA 3ORJA 3ZM8A 3NNJA 2E7AA 1OA3A 5K9YA 5J96B 3CVRA 1KJLA 4C0HA 2KGGA 3OKQA 2JDUA 5EJ1B 1RJ7A 2ODVA 2RG4A 3HJRA 3IWZA 4W6XA 1AF9A 2GNBA 4DIDB 4WM7A 2E6SA 4AQSA 3RMYA 4Z8XA 2DBNA 1M62A 4CZSA 1PK6C 1H1IA 2E53A 4K8FA 5E6HA 3BTYA 1F4HA 2HBTA 4E7ZA 1SHWB 3HN1A 4GNFA 3AYEA 1XYPA 3KT7A 3AA0B 4YVSC 4HLTA 4HONA 2G4IA 5IVYA 2XB1A 3K3NA 4B3TT 1EV11 4MSXA 1Q8VA 3KZ4C 2A6WA 5TABA 2CM0A 5J2UE 4NIQA 4UP0A 3AE4A 1OKOA 3NV2A 2CDOA 1F15A 4LBQA 3AA6B 3M3QA 2EXKA 1C8NA 2OZ6A 3VL9A 3HCTA 1RVF1 4YVWA 2VOKA 1WCRA 5L7OC 3L2YA 2I2SA 5DAPA 4QKNA 2BWCA 5FKYA 2AENA 5C9AA 5KC5A 2JDNA 1RIRA 3N2OA 2DDUA 4PLOA 3CQXC 3PUQA 1YQ6A 2MTQA 5DQWA 5GONE 4WBNE 3KMHA 4OQ8A 1DVPA 1I6XA 5LJMA 4LE4A 1FMVA 2WINB 1ZYBA 1S2KA 3N9PA 3IDEA 4N4FA 4LIUA 1XDOA 1ENSA 4W65A 5IYYA 1QNWA 2J1TA 1RUNA 4OYKA 2PJQA 3VBSB 3VL8A 3ZXDA 5JOXA 1MQTC 3D0SA 1IQAA 5FMOL 4PK5A 3C4WA 1AR71 4GB33 5HCFA 4YWAA 4AFAA 1S55A 2NQYA 1XNDA 1R8IA 4A6SA 4AL9A 3Q5WA 1GQGA 1XBFA 1B35C 1XE8A 5JDFA 2YV8A 5B77A 3MI8A 2QQVA 1UMZA 1Y9GA 1DF0A 2I6HA 4GULA 1FV3A 2NP0A 3ZDVA 2UWAA 4O62A 4AI3A 2OT7A 4LR4A 1EP0A 4NVPA 1VB4A 1D7PM 3S0MA 2GN3A 1J5WA 4G4FA 3T4HB 2QQKA 3ZN6A 3ZXAC 5L3FB 4DIQA 2KNDA 4XUNA 2A75A 4YRDA 4MV2A 3P3PA 5LKTA 4JV5T 1UYXA 1D0ZA 1QJEA 1PIV1 2XUEA 2Y48B 1R092 4YT0A 2NOXA 1DGRA 2AGSA 1PVC1 1HJGA 5FZDA 2YHNA 4GQ7A 2PAEA 3AEBA 4TWTA 3ACHA 2WA4A 3SOUA 3VBFC 3GA8A 1FP0A 3ETPA 3ZPYA 5HAXA 3SUBA 4H9NC 1SFYA 4Q1PA 5F37A 2W0GA 4LBQD 3ONLC 4GNDA 2YUEA 2BGPA 5AQIB 4PQ9A 3MIFA 1RINA 3P5BA 4XCBA 5CFDA 1HFAA 4C90A 3NNLA 3MO4A 4WVMA 2UZGA 3GBWA 4UFIA 3JAFA 1OF3A 3RI5A 4ILBA 2WIIB 3J4UH 5EJ3A 2ZBJA 3KHCA 5F5QA 5BNPA 1ULOA 4TZDA 2CL2A 5GLZA 3DXTA 3VHNA 3TLWA 3LBXB 5IVFA 3APBA 3UNPA 1S0IA 5FZ9A 3B02A 2WN3A 2JJ6A 1LRZA 2AH2A 4FPHA 1X8EA 4XQWA 1W8UA 4IV3B 3N9OA 3BB6A 2YU4A 1CWPA 1YKEB 4LBOA 1RUE3 2VZSA 4HK8A 4JX0A 2FD4A 2YZ4A 5JCTA 5EP9A 5IAVA 5BR8T 3KVBA 1O59A 3WNPA 5IAXA 2MNGA 1XNKA 2VMGA 2XEUA 1CAUA 3OY8B 4H9DA 3AMPA 3RVHA 1W6NA 1MR5A 1RHI3 2YSJA 5G04L 3QC9A 4XZUG 4QDRA 2LKGA 1EZ3A 3VRAA 2AEYA 4YGDA 1UZZA 4KHZF 1FATA 2UUCT 4MO3M 2VQFT 5H1UA 3O7OA 1YFWA 2E61A 1OH4A 3ZVZB 3H8UA 1Z60A 3ECQA 1XU1A 3KQ4B 5HXMA 2RJ2A 3T3YA 4NR1A 4TNVA 2VKHA 5C7GA 1C28A 1R081 2BU9A 4M0HA 1DG6A 2BZDA 3QB5A 4I01A 2ZHNA 4CEWB 5JDNA 2H7VC 4I09A 2WABA 2XMLA 1UAIA 4CVUA 3U5MA 4DZGA 1A8DA 2X67A 2BTVC 4JI4T 1AJKA 2BBVA 2JE9A 4I0WB 2VL8A 2VNRA 4OUMA 5F2WA 5ACA3 3POJA 1MS9A 2VJEA 2WRAA 1MM3A 2TNFA 3GMIA 4COWA 1Z6UA 4HFSA 4D8MA 2D9DA 5AITA 5FZCA 2H89A 2OA5A 4R8HA 4BISA 1N34T 4Q4Y3 2WZEA 2MA5A 2X9WA 4GOUA 3T2OA 1GOGA 3Q5XA 1SDWA 4LF6T 3FJUB 5LG4A 1BMV1 1YRZA 2BGCA 5IVJA 2HDPA 1GMMA 1PM4A 5FRAA 3UK9A 3QZVA 1UZYA 2GMEA 1SG3A 1NG0A 2NWBA 1STMA 1U5YA 1BEV1 4YC9A 1LKNA 1CUNA 3I2GA 1QQP1 4CDXA 3I3MA 2VZQA 1REDA 1UK5A 2VOXA 1W6QB 4J2CA 1XWHA 4ZI7E 4IV1B 3DTOA 2KKXA 4AKGA 4D7TA 2CWOA 4FK5A 2ZM2A 2CONA 3OPWA 2PMWB 3WV6A 2V7IA 1MS5A 5I8TA 4NPMA 5DUVA 5H9MA 3PU8A 3MYXA 4K21A 2VNFA 4ZKTB 1OHFA 5CKQA 1IZ3A 3NJVA 4I43B 3NSTA 1H8TA 2CE7A 4DV7T 5IHRA 3ZNIA 3T30A 5CJ5A 2L8KA 5IK5A 2BNNA 3VBUB 3I2JA 5LKXA 1XSQA 4XDQA 1BMV2 1IS5A 4WZ2A 2VGDA 5T5PA 2XVGA 4D6SA 3ZN6B 2ZM0A 2XQ5A 3E22E 1MNDA 1XU2A 5FUPA 4H9RC 1SUMB 4LBNA 4JUYA 2ZS6B 4YFWA 1H9PA 5FVLA 4JGZA 4MADA 3PTRB 1Y4WA 1OFSA 5JXIA 1MQTA 1MMNA 1S0DA 4BLJA 1J84A 1LGBA 4OZXA 1HRI1 4JQTA 4RL7A 2HWE3 3AE7A 2R7EB 1RUG1 3MDPA 3DYMA 2LSKA 1GZCA 2OQ7A 3VDDB 4HVRA 4E9KA 3RYHE 2WA3A 3VZNA 1UW8A 3RZLA 5LGUB 3OJAA 2F6BA 5HCAA 1ENXA 3DPRA 1DQ4A 1DLCA 3CF6E 3NNMA 4R52A 2FCVA 4AGVA 4MGQA 2DYCA 2VUDA 5LWBA 4QF2A 2QQMA 4P9WA 3RHWA 2ZCWA 2JQ9A 4CUCA 1QXJA 4TLGA 3WOGA 2VY0A 2NW8A 1AR93 3KBTA 4QHBA 4UV9B 3GCXA 4Q0QA 2NTYA 2PAKA 4HETA 4CEYB 2MEV1 1IS3A 3HQRA 2J1SA 3JBG2 4XAEA 4P00B 3HPNA 3OSDA 2OXQC 4QXHB 2LROA 3DYPA 4OI1A 4TV8E 4I2OA 1B09A 2R30A 2XJRA 1UYZA 5C13A 4N7UA 2D6LX 2AN6A 5A6YA 4IE0A 3FBMA 1G25A 1OUXA 3KVAA 5LCYA 4IV3A 3I2OA 1UKRA 2LGGA 5LK5A 1CN1A 1DLLA 3MLKA 4HN0A 2PHUA 2BG9A 1YHFA 5DDJ2 4Y3OA 5C3PA 3SCHA 2XWBB 1CD3G 2Q1FA 1YXWA 1VBE1 4JTNA 2KZ7B 3V64A 4QB2A 1CZSA 1PO22 1APNA 1BBT1 2X0LB 5FCCA 3ZSSA 1WLWA 4C0BA 1G9FA 1S35A 2WQ4A 5GKAC 2BVMA 1UX6A 4QGNA 4TN7B 1HRI2 2GNDA 5DKAA 4GWMA 1DQ5A 1OD5A 1WMEA 4ISRA 3LSEA 1PZ7A 3ES4A 2XM2A 2R063 4EYYR 1UXXX 1V6LA 2ZGUA 4GB0A 2W3JA 2XAGB 5ETWA 4LULA 3DXUA 3I97A 1SMVA 4H9SE 3RDIA 4MH0E 2NMOA 1S0BA 2O0OA 2VUJA 4Z8BA 3DGTA 4YM3A 4KX6A 2V09A 4ET7A 2JE8A 2SLIA 3EB6A 4LO5B 5LASA 3VU7H 1U5ZA 3V0AB 3UFGA 1VMHA 3VKNA 3TNQA 5LMUT 3SH4A 2CY6A 5EYAF 4CEYC 5A33A 2RE9A 2Y8KA 4BH9A 2GALA 1OEDA 5JDBA 3OVUA 3IPVB 1VR3A 5DN2A 1H0BA 2JENA 2E5LT 3BN6A 3WF2A 4DB5A 5KH3A 1GP4A 2WB5A 3NBXX 4Q1RA 5JSOA 4FPCA 4YABA 2DU1A 3NJYA 5JUVA 2HPJA 4DV0T 2Y6GA 1JTZX 5KC6A 2D43A 3LRQA 3BIEA 2DVBA 5DAQA 3WQ7A 1O5UA 1LOFC 2FZ1A 3W15B 4NUUA 5TSWA 1HKDA 3ANWB 3O1MA 5LGNB 3RZGA 2FUPA 4UEMA 2P57A 4CI1B 5FLIA 2RMU2 4IV1C 5ABFB 4LK6A 5A1LA 2IXKA 3C6WA 3PHMA 4EWEA 4AHWA 1ZRCA 4PNIA 1RUC2 3LA3A 3DYOA 2D44A 5FKCA 2ZKNA 3TN93 3OTOT 3N5LA 4TXWA 4GKKT 5T50A 1DBNA 3VKMA 3TNPB 2WO3A 1DFQA 3IHRA 4QU1A 4ZI2D 3SHRA 5B4NA 3RH3A 2VD7A 1UX5A 2A3YA 1AYN1 3L2HA 1SE7A 5IUQA 1NQDA 1W0BA 1P8JA 3D82A 4O2AE 1SQ4A 4YSYA 1EUTA 2ZTNA 5JTGA 1S4CA 2GC2A 4PI0A 3WCSA 1COV1 1W9YA 5F3EA 2BQPA 5AQJB 3GZTB 3EB5A 4FJOA 4N53C 1AL21 4ZEYA 3GF6A 4YVSA 1XMOT 1JI6A 2VECA 3U0ZA 2LGLA 2R16A 1US3A 4N8MA 3E1F1 3HBKA 2Y0IA 3ZYFA 1HRI3 1TME1 1V9U3 3B5MA 2OPWA 1VAVA 3HKEE 1RUG3 2JWPA 4CP2A 1QH6A 2LRPA 3C7OA 4HVOA 4JAAA 3UU3A 1FOD2 5AQRB 1GOFA 1HRV2 3OCPA 4Z0OA 3VN4A 1WYBA 1PNFA 4CCGX 2BFUS 3WQBA 3LIGA 3L09A 2KKYA 1F8VA 5FXVA 4FXGB 5FMNA 1ULGA 2CHHA 4Y26A 3RPGB 1I9RA 3CLPA 5FY8A 4S2DA 4JCKA 3FZMB 4QPIC 3TRSB 4YLZA 2QQOA 4PLNA 3NG2A 2CWMA 1QJY3 2K48A 4KBBA 4W6YA 3OPTA 5IFPA 3CO2A 5KMGP 3MW2A 3E08A 4AVTA 2HWB2 3BU7A 4META 5CFBA 2PN5A 2VJFA 4IEVA 4XZPA 2HWD2 5DZGA 3X1DA 4IEXA 1QJU3 1CESA 1RHI1 5B78A 4ZXEA 3LIHA 1KDKA 4X65T 2FSAA 2E9XA 4QU2A 2XQ4A 5KXEA 4CN1A 5SV8A 2D40A 1E57A 4NPRA 2XBO3 1PGW2 5CFCA 5DJQC 1ZM1A 4AHYA 4QQLA 4E2QA 2P34A 3ZYLA 1JUHA 5FAXA 4NUBA 5EK3A 3T08A 1KJRA 3ETVA 1WENA 1MIVA 2VWAA 4BZ4A 4EE2A 3LA7A 1PO13 3BTAA 3FZKB 2XQ7A 3USUB 5ACA2 2HWF2 4ANJA 1ZNPA 2YC0A 3Q2MA 2XLGA 4IDNA 4AQFA 2D93A 2FUUA 2KSRA 1ZBA3 3ZO0B 3ZYKA 3KD4A 4H63V 1D2SA 1VBB1 3VGIA 3POYA 4OYUA 4FP2A 1E5IA 5A70A 4YTNA 1MS8A 4URAA 3UKNA 2P37A 4FPKA 5FXXA 3EQEA 5JR9B 2HWD1 2ORXA 4RSUA 4DR1T 3C98B 4Q4Y1 1EAH1 5IFTA 3WNLA 1NUKA 2E31A 3M3IA 1TE1B 2NTXA 1LGCA 4IESA 2GH8A 3ABVA 2BEOA 4TUYE 4PHZA 5BNNC 1K5JA 4G9SB 1XMQT 2HLEA 2O1QA 2E9QA 3K3OA 2ZAHA 1H4GA 4I3PA 4YG6A 2WBKA 4A45A 4R7EA 5F3GA 4QPWA 1LEMA 5AFUL 1NY72 1D0XA 5LA6E 3UJQA 4U2ZA 3GV4A 3T9KA 4QXCB 5J3UA 1QXPA 3ACIA 1N47A 1PGL1 2VMEA 4CI3B 5A7WA 4NAMA 1HJFA 2DU0A 5CB4E 3EI0A 3IF8B 3OBTA 1R091 2AE9A 2VP7A 4AYCB 4UR9A 5L9BA 5CFDC 4IETA 4OLLA 2CBJA 3FLPA 1MM2A 3ZMOA 4AHXA 3DDTA 4N53A 4U2AA 3VKGA 4CDUC 1LHOA 1OEDB 2R6GF 2IWGB 1YQCA 4IEPA 4DXZA 2OX0A 5FXZA 1XNCA 2B42B 4GK5E 5JDHA 2WT1A 1H8TB 3B57A 2LHNA 3FLTA 3LDQB 5A1FA 4FT8A 2X5IC 3ZTGA 2YHJA 1CR7A 1LOGA 3GALA 2KWIB 4ILUA 5LBCA 1ULPA 2IXHA 1WBLA 3H37A 2W1WA 3A23A 3P8CD 5LHHB 3P3NA 1COV3 1JZ2A 2N1GA 5HCBA 3FAOA 4IEQA 3IBPA 3WHTA 2WMNA 2BDRA 1CAWA 5HEGA 3T2PA 3I4IA 1JW6A 1MZFA 2FDJA 3MKDA 1ENRA 1E7PA 2KWJA 1W0PA 2JDZA 1LRHA 3ZSLA 1N1SA 2WZPP 3ILFA 3NZQA 4BQ3A 2DV9A 3VUOA 1E4UA 4N90A 1BBT2 2QQWA 3BODA 3R4UA 1DGWA 2M6BA 3KSCA 4CCDA 4YG3A 2VW1A 5L3BB 2VH9A 3LEIA 3GBGA 3O0XA 2ECIA 2CPTA 2ZGMA 3BI3A 5IWAT 2V6YA 3L3PA 1UIKA 4X66T 1JYWA 4BJMA 1NYWA 1GQHA 2QQPA 1W2NA 4D69A 4O4IE 3S7IA 4GH4C 3LCPA 2WZR1 2HEVF 5ANQA 2DF7A 3SKJE 2C6SA 4Z92B 2YGLA 2X66A 2D6NA 4BWOA 2PTMA 5AQQB 2VB6A 4A4AA 4XJWA 2Y8DA 4AQTA 3I1AA 4KHPT 2DCJA 1PZ8A 2HYED 4B3MT 4DR5T 1SCSA 1UX4A 5BYNA 1V6NA 1PHMA 4BQWA 2H6CA 3TLSA 3AMHA 4ZI3C 1GSLA 3BIWE 1XSRA 4MHCA 3L9JT 5IVEA 4QH4A 4Q25A 1NAEA 1HIXA 4XF1A 4JI7T 2DWRA 4L9IA 3ZXGA 5FP4A 1QDCA 4ASLA 1VP6A 5F32A 4Q0PA 2HWD3 3BQIA 4F1PA 3VBRA 5BUVA 2UYAA 1ZZ7A 5LATA 4K0UA 3VDDC 2ECNA 4OI0A 1EPWA 4IEOA 2XUMA 5F5CA 2LGKA 2OS2A 5JOZA 1G9DA 3RSJA