5SVXA

Morc3 cw in complex with histone h3k4me3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
49
structure length
49
Chain Sequence
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5svxA00
2L7PA 2RR4A 5SVXA 5SVIA 4QQ4A 5SVYA 4Z0OA 2E61A 4O62A 4Z0RA 5SVIB
chains in the Genus database with same CATH superfamily
4YBSA 2VP7A 5SVYA 2K1JA 3O47A 4WZ2A 3FM8C 2G43A 4I7BA 2KWJA 2E6RA 2JMIA 5G05B 3Q1DA 1MBMA 4X3GA 2JMDA 2XOZA 2ECNA 4O64A 3DQVR 2ECIA 4AYCA 1VFYA 3O35A 3IHPA 5FERA 4S3OB 1WFKA 2MD7B 5LKXA 2YHOA 2CSZA 3NG2A 2EXUA 4P5OB 1K2FA 2F42A 2KGIA 5LKTA 3FJUB 4LKAA 2LDRA 2XOCA 5FB0A 4B86C 3HCSA 4QQ4A 4NN2A 2CSVA 3FAOA 3C6WA 2EGPA 3U5NA 3L1ZB 1LDKC 4I7DA 2VPDA 4CCGX 4C9ZA 3ZVYA 2VJFA 3T9KA 3MDBC 4GNFA 2L5UA 3HCUA 3SUBA 2D8SA 2YSJA 2M6MA 2MIQA 1U6GB 2MKEA 4R8PK 2I50A 4LK9A 5FEYA 2JMJA 1WENA 1X4JA 4H9DA 2YHNA 1CHCA 4N3WA 3KV5A 4FJCA 2LAUA 4AUQB 2H0DB 2FD4A 4WA6A 1X4IA 4Q6FA 4YBTA 2DJAA 3ZYQA 2E61A 3FANA 2KIZA 4GNEA 3LQIA 4IC2A 2KKYA 3ASLA 2YQMA 2JM3A 1WEEA 4L7XA 4YATA 2LN0A 4MVTA 2CT2A 2CRRA 4I7CA 4ZQLA 5TBNA 1Z2QA 1ZBDB 3EB6A 2L43A 3FL2A 4AP4A 2K17A 2K16A 3KV6A 3ZTGA 1X4UA 3L11A 5LKZA 2M3HA 4ZDTA 3PUQA 2YREA 1WEMA 1VYXA 4BBQA 2CKLB 3V43A 2ECTA 2YT5A 3VK6A 5SVXA 2HYED 2FUIA 2XEUA 2VPEA 1RMDA 2JRJA 2EA6A 3M7KA 4GNGA 2KWNA 4R2YA 3PHDA 2ECJA 2HDPA 5KH3A 2NAAA 3O34A 4PTBA 2MT5A 2L75A 1FP0A 2OXQC 2CONA 2H0DA 2VPBA 2BAYA 2ECWA 2G45A 5K3QA 2VPGA 4Z0OA 3U5PA 2YSMA 2Y1MA 3E2DA 3DPLR 4XI1A 5H1VA 1N87A 5I3LA 2DSMA 2VNFA 3O7AA 1T1HA 4AVXA 2YYRA 1WESA 2Y43A 5AIUA 1IYMA 3KQIA 3QZVA 2LXHC 2YUCA 2KYUA 3I2DA 3KDEC 4A4BA 5B76A 2KR4A 2ECVA 2M85A 1WGMA 2M13A 2LRIC 1WIMA 2B0OE 4ZUXU 5B8DA 1HYIA 2MA6A 4B7YC 2XP0A 2MA5A 2YURA 5G0FA 3N9MA 4UI9B 4A49A 3RTRB 3ZNIA 4PPEA 2KWKA 1WE9A 4YABA 2DX8A 5C11A 4UP5A 5D1KB 5H1TA 5TRBA 2UZGA 5SVIB 2CKLA 5B78A 2KFTA 2AN6A 3GL6A 3DWDA 2EGMA 2QJ0A 2L80A 5EYAF 3C5KA 3LQHA 5TABA 2C2VS 3RPGB 3SOXA 2FUUA 4N4FA 1G25A 4W4UA 2RSDA 4IC3A 2LGGA 2K4DA 1WEOA 4A4CA 2VJEA 2QIZA 4S3OC 3FEHA 3MHSA 2KU3A 3PURA 3M62A 4FO9A 2D8UA 2IDAA 2MD8C 5B75A 2ZETC 2YQLA 2KE1A 3T6RA 4YC9A 2FFWA 1BORA 2KGGA 2YU4A 3ZVZB 1Z6UA 1XWHA 2XB1A 2XOYA 4O62A 1VD4A 4OGCA 3LQJA 4R7EA 5H1UA 3LJUX 2YW8A 2QICA 1JM7B 1LDJB 4OGEA 4F52B 2F6JA 5D1MB 3SHBA 3O36A 3U5OA 3O33A 1WILA 3O70A 2LV9A 5D1LB 3LVQE 2CRWA 2ECGA 4LLBA 4BHWA 5TDRA 3N9OA 3U5MA 2EODA 4QF3A 1FBVA 2PUYA 3GV4A 2KREA 2KKXA 1WEUA 2MNZA 4YADA 3DDTA 2VJEB 2OWAA 4YBMA 3SOUA 5SVIA 2G6QA 3MHHA 1DVPA 2E6SA 4WZ0A 1WEPA 3LRQA 5KH9A 4Z0RA 4TKPB 2MNYA 4LADB 4WZ3B 2IQJA 3N9LA 5DINA 3HCTA 1WEWA 3SOWA 2LGVA 5JG6A 2C2LA 2P57A 3ZPVE 3ZPV1 3RPGC 4F1PA 4QF2A 1DCQA 4L58A 4UP0A 4V3KC 2F6NA 3LVRE 3EB5A 2RI7A 2KWOA 3PLWA 2LXPC 3N9PA 4GNDA 1E4UA 2FSAA 3M63A 2MUMA 1WEQA 4GB0A 4V3LC 5DKAA 1HYJA 1Z60A 4AYCB 3N9NA 1JM7A 3H7HA 5J3XA 5LCWB 5H9MA 5B79A 1MM2A 5C13A 5B77A 5LKUA 2YVRA 3M99A 2RR4A 4LJNA 4YAXA 3KNVA 4FIPA 4FK5A 2LGLA 2JUNA 2LGKA 3L1XA 2CSYA 2L0BA 4A0CD 1V87A 3T7LA 4MSXA 5AITA 3N9QA 3JUEA 2LQ6A 2VJFB 3HTKC 5KH7A 1MM3A 2M1RA 4CA1A 1F62A 5FB1A 2Y1NA 3LDYA 5TDWA 1JOCA 2L7PA 1WEVA 2PNXA 3O37A 5G04B
chains in the Genus database with same CATH topology
1DCQA 2D8UA 2B0OE 2KKYA 3JUEA 5SVYA 3LVRE 3M7KA 3O47A 4Z0RA 4F1PA 2XP0A 4H9DA 3FM8C 3PLWA 3LVQE 2CRWA 2FFWA 2JM3A 2IQJA 2YREA 2XOYA 4O62A 3T9KA 4OGCA 2YVRA 3MDBC 2KKXA 3Q1DA 2EXUA 2RR4A 3LJUX 2LAUA 3FEHA 2CRRA 2FD4A 3SUBA 3KDEC 2JUNA 3DDTA 5SVIB 3LDYA 2XOZA 4OGEA 3FJUB 2OWAA 2CONA 2L7PA 2XOCA 2P57A 5SVXA 5SVIA 2DJAA 2MKEA 4QQ4A 4Z0OA 5K3QA 2E61A 3H7HA 3DWDA 2CSVA 2M13A 3E2DA 2EGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7P A;  2RR4 A;  5SVX A;  5SVI A;  4QQ4 A;  5SVY A;  4Z0O A;  2E61 A;  4O62 A;  4Z0R A;  5SVI B; 
#chains in the Genus database with same CATH topology
 4YBS A;  2VP7 A;  5SVY A;  2K1J A;  3O47 A;  4WZ2 A;  3FM8 C;  2G43 A;  4I7B A;  2KWJ A;  2E6R A;  2JMI A;  5G05 B;  3Q1D A;  1MBM A;  4X3G A;  2JMD A;  2XOZ A;  2ECN A;  4O64 A;  3DQV R;  2ECI A;  4AYC A;  1VFY A;  3O35 A;  3IHP A;  5FER A;  4S3O B;  1WFK A;  2MD7 B;  5LKX A;  2YHO A;  2CSZ A;  3NG2 A;  2EXU A;  4P5O B;  1K2F A;  2F42 A;  2KGI A;  5LKT A;  3FJU B;  4LKA A;  2LDR A;  2XOC A;  5FB0 A;  4B86 C;  3HCS A;  4QQ4 A;  4NN2 A;  2CSV A;  3FAO A;  3C6W A;  2EGP A;  3U5N A;  3L1Z B;  1LDK C;  4I7D A;  2VPD A;  4CCG X;  4C9Z A;  3ZVY A;  2VJF A;  3T9K A;  3MDB C;  4GNF A;  2L5U A;  3HCU A;  3SUB A;  2D8S A;  2YSJ A;  2M6M A;  2MIQ A;  1U6G B;  2MKE A;  4R8P K;  2I50 A;  4LK9 A;  5FEY A;  2JMJ A;  1WEN A;  1X4J A;  4H9D A;  2YHN A;  1CHC A;  4N3W A;  3KV5 A;  4FJC A;  2LAU A;  4AUQ B;  2H0D B;  2FD4 A;  4WA6 A;  1X4I A;  4Q6F A;  4YBT A;  2DJA A;  3ZYQ A;  2E61 A;  3FAN A;  2KIZ A;  4GNE A;  3LQI A;  4IC2 A;  2KKY A;  3ASL A;  2YQM A;  2JM3 A;  1WEE A;  4L7X A;  4YAT A;  2LN0 A;  4MVT A;  2CT2 A;  2CRR A;  4I7C A;  4ZQL A;  5TBN A;  1Z2Q A;  1ZBD B;  3EB6 A;  2L43 A;  3FL2 A;  4AP4 A;  2K17 A;  2K16 A;  3KV6 A;  3ZTG A;  1X4U A;  3L11 A;  5LKZ A;  2M3H A;  4ZDT A;  3PUQ A;  2YRE A;  1WEM A;  1VYX A;  4BBQ A;  2CKL B;  3V43 A;  2ECT A;  2YT5 A;  3VK6 A;  5SVX A;  2HYE D;  2FUI A;  2XEU A;  2VPE A;  1RMD A;  2JRJ A;  2EA6 A;  3M7K A;  4GNG A;  2KWN A;  4R2Y A;  3PHD A;  2ECJ A;  2HDP A;  5KH3 A;  2NAA A;  3O34 A;  4PTB A;  2MT5 A;  2L75 A;  1FP0 A;  2OXQ C;  2CON A;  2H0D A;  2VPB A;  2BAY A;  2ECW A;  2G45 A;  5K3Q A;  2VPG A;  4Z0O A;  3U5P A;  2YSM A;  2Y1M A;  3E2D A;  3DPL R;  4XI1 A;  5H1V A;  1N87 A;  5I3L A;  2DSM A;  2VNF A;  3O7A A;  1T1H A;  4AVX A;  2YYR A;  1WES A;  2Y43 A;  5AIU A;  1IYM A;  3KQI A;  3QZV A;  2LXH C;  2YUC A;  2KYU A;  3I2D A;  3KDE C;  4A4B A;  5B76 A;  2KR4 A;  2ECV A;  2M85 A;  1WGM A;  2M13 A;  2LRI C;  1WIM A;  2B0O E;  4ZUX U;  5B8D A;  1HYI A;  2MA6 A;  4B7Y C;  2XP0 A;  2MA5 A;  2YUR A;  5G0F A;  3N9M A;  4UI9 B;  4A49 A;  3RTR B;  3ZNI A;  4PPE A;  2KWK A;  1WE9 A;  4YAB A;  2DX8 A;  5C11 A;  4UP5 A;  5D1K B;  5H1T A;  5TRB A;  2UZG A;  5SVI B;  2CKL A;  5B78 A;  2KFT A;  2AN6 A;  3GL6 A;  3DWD A;  2EGM A;  2QJ0 A;  2L80 A;  5EYA F;  3C5K A;  3LQH A;  5TAB A;  2C2V S;  3RPG B;  3SOX A;  2FUU A;  4N4F A;  1G25 A;  4W4U A;  2RSD A;  4IC3 A;  2LGG A;  2K4D A;  1WEO A;  4A4C A;  2VJE A;  2QIZ A;  4S3O C;  3FEH A;  3MHS A;  2KU3 A;  3PUR A;  3M62 A;  4FO9 A;  2D8U A;  2IDA A;  2MD8 C;  5B75 A;  2ZET C;  2YQL A;  2KE1 A;  3T6R A;  4YC9 A;  2FFW A;  1BOR A;  2KGG A;  2YU4 A;  3ZVZ B;  1Z6U A;  1XWH A;  2XB1 A;  2XOY A;  4O62 A;  1VD4 A;  4OGC A;  3LQJ A;  4R7E A;  5H1U A;  3LJU X;  2YW8 A;  2QIC A;  1JM7 B;  1LDJ B;  4OGE A;  4F52 B;  2F6J A;  5D1M B;  3SHB A;  3O36 A;  3U5O A;  3O33 A;  1WIL A;  3O70 A;  2LV9 A;  5D1L B;  3LVQ E;  2CRW A;  2ECG A;  4LLB A;  4BHW A;  5TDR A;  3N9O A;  3U5M A;  2EOD A;  4QF3 A;  1FBV A;  2PUY A;  3GV4 A;  2KRE A;  2KKX A;  1WEU A;  2MNZ A;  4YAD A;  3DDT A;  2VJE B;  2OWA A;  4YBM A;  3SOU A;  5SVI A;  2G6Q A;  3MHH A;  1DVP A;  2E6S A;  4WZ0 A;  1WEP A;  3LRQ A;  5KH9 A;  4Z0R A;  4TKP B;  2MNY A;  4LAD B;  4WZ3 B;  2IQJ A;  3N9L A;  5DIN A;  3HCT A;  1WEW A;  3SOW A;  2LGV A;  5JG6 A;  2C2L A;  2P57 A;  3ZPV E;  3ZPV 1;  3RPG C;  4F1P A;  4QF2 A;  1DCQ A;  4L58 A;  4UP0 A;  4V3K C;  2F6N A;  3LVR E;  3EB5 A;  2RI7 A;  2KWO A;  3PLW A;  2LXP C;  3N9P A;  4GND A;  1E4U A;  2FSA A;  3M63 A;  2MUM A;  1WEQ A;  4GB0 A;  4V3L C;  5DKA A;  1HYJ A;  1Z60 A;  4AYC B;  3N9N A;  1JM7 A;  3H7H A;  5J3X A;  5LCW B;  5H9M A;  5B79 A;  1MM2 A;  5C13 A;  5B77 A;  5LKU A;  2YVR A;  3M99 A;  2RR4 A;  4LJN A;  4YAX A;  3KNV A;  4FIP A;  4FK5 A;  2LGL A;  2JUN A;  2LGK A;  3L1X A;  2CSY A;  2L0B A;  4A0C D;  1V87 A;  3T7L A;  4MSX A;  5AIT A;  3N9Q A;  3JUE A;  2LQ6 A;  2VJF B;  3HTK C;  5KH7 A;  1MM3 A;  2M1R A;  4CA1 A;  1F62 A;  5FB1 A;  2Y1N A;  3LDY A;  5TDW A;  1JOC A;  2L7P A;  1WEV A;  2PNX A;  3O37 A;  5G04 B; 
#chains in the Genus database with same CATH homology
 1DCQ A;  2D8U A;  2B0O E;  2KKY A;  3JUE A;  5SVY A;  3LVR E;  3M7K A;  3O47 A;  4Z0R A;  4F1P A;  2XP0 A;  4H9D A;  3FM8 C;  3PLW A;  3LVQ E;  2CRW A;  2FFW A;  2JM3 A;  2IQJ A;  2YRE A;  2XOY A;  4O62 A;  3T9K A;  4OGC A;  2YVR A;  3MDB C;  2KKX A;  3Q1D A;  2EXU A;  2RR4 A;  3LJU X;  2LAU A;  3FEH A;  2CRR A;  2FD4 A;  3SUB A;  3KDE C;  2JUN A;  3DDT A;  5SVI B;  3LDY A;  2XOZ A;  4OGE A;  3FJU B;  2OWA A;  2CON A;  2L7P A;  2XOC A;  2P57 A;  5SVX A;  5SVI A;  2DJA A;  2MKE A;  4QQ4 A;  4Z0O A;  5K3Q A;  2E61 A;  3H7H A;  3DWD A;  2CSV A;  2M13 A;  3E2D A;  2EGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...