5SVXA

Morc3 cw in complex with histone h3k4me3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
49
structure length
49
Chain Sequence
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5svxA00
2L7PA 2E61A 5SVIA 2RR4A 4Z0RA 4Z0OA 4QQ4A 5SVYA 4O62A 5SVXA 5SVIB
chains in the Genus database with same CATH superfamily
1E4UA 5KH9A 5D1LB 5LKXA 4A0CD 4IC2A 2PNXA 3LJUX 4YADA 3ZVYA 4WZ2A 2VPBA 4AP4A 3HCSA 4YABA 2CKLA 2G6QA 4H9DA 3O33A 4ZUXU 2H0DB 4X3GA 3RPGB 5B78A 2XOZA 5LKZA 1JM7A 2CSYA 4CCGX 2CRWA 2L43A 2MNYA 2I50A 4AUQB 1DCQA 5G0FA 4MVTA 3FAOA 3N9QA 3O37A 5AIUA 4ZQLA 2YURA 3H7HA 5H1UA 2G43A 4QF3A 4UP0A 3O34A 5FB1A 2KGIA 2YVRA 2LXPC 1FBVA 1WEUA 4F1PA 2XP0A 4LKAA 2EA6A 2YHNA 1WEPA 4S3OC 1VD4A 2MT5A 3DWDA 1FP0A 3PURA 2JMJA 3SUBA 3SOWA 2L80A 3E2DA 3LQIA 4BHWA 4L7XA 4O64A 1WENA 2K4DA 1T1HA 3FL2A 2YQMA 2E6SA 4R2YA 3LRQA 3SOUA 4F52B 2IDAA 2KYUA 2HYED 4GNGA 2KGGA 5SVIB 2LGLA 4PPEA 5H9MA 5SVXA 3M63A 3N9LA 5G04B 2FUIA 1ZBDB 3L1ZB 4Q6FA 2YHOA 2KIZA 3U5NA 3M99A 5EYAF 5KH3A 1WEVA 5FEYA 2KWOA 4C9ZA 4QQ4A 1G25A 3C6WA 1WEWA 2VPEA 2DX8A 4I7BA 5FERA 1WGMA 3U5OA 2C2VS 1RMDA 2EGPA 4GNFA 4A4CA 5TABA 2LGKA 2UZGA 2MD8C 5TDWA 4IC3A 4I7CA 1F62A 5SVYA 2YUCA 2JUNA 1WEQA 5H1VA 3L1XA 2LV9A 3DPLR 1X4JA 3JUEA 2ECWA 2YSJA 2YYRA 2QICA 4OGEA 4I7DA 2KWJA 2MIQA 2HDPA 2Y1MA 2KFTA 3ASLA 5TDRA 2CRRA 2VJFB 5B79A 2QIZA 1MM2A 2G45A 2OWAA 3FM8C 1N87A 2JMDA 4FIPA 4CA1A 3LDYA 4AYCA 4YAXA 2MKEA 2EGMA 2L7PA 1VFYA 3KDEC 3N9NA 3DQVR 5TBNA 3LQHA 2JRJA 2D8SA 4NN2A 4R7EA 5H1TA 2EXUA 3HCTA 2LGGA 3LVQE 2VJEB 4W4UA 2C2LA 1K2FA 2LN0A 4YBTA 4AVXA 2KU3A 2L5UA 2ECTA 3FANA 1HYJA 2DJAA 2RI7A 2H0DA 2KREA 1V87A 4L58A 4V3LC 5B77A 2YREA 1Z6UA 1LDKC 3SHBA 2RSDA 5AITA 3U5MA 3M62A 3VK6A 5J3XA 3SOXA 3I2DA 5B75A 4TKPB 4LLBA 4FK5A 4V3KC 5C11A 2VJEA 5B8DA 4GNEA 2YT5A 5K3QA 3ZPVE 4B86C 2YU4A 1WESA 1X4UA 3T9KA 5JG6A 2L0BA 3V43A 2ECVA 2QJ0A 1MM3A 4B7YC 2YSMA 4BBQA 3ZVZB 4MSXA 2DSMA 5LKUA 2FSAA 2JM3A 1Z2QA 5KH7A 3KV5A 2LQ6A 2KE1A 4XI1A 4N3WA 5TRBA 2ECNA 4UP5A 4Z0OA 4GNDA 2LGVA 2LXHC 4LADB 2LAUA 5SVIA 2CKLB 4S3OB 3ZYQA 4OGCA 2F42A 3O7AA 2XB1A 3KQIA 2NAAA 5D1MB 3ZTGA 2JMIA 2B0OE 1JM7B 1WILA 4WA6A 1Z60A 1WE9A 3PUQA 2CSZA 3N9PA 5B76A 3HCUA 1JOCA 3C5KA 1LDJB 4WZ0A 2KWKA 3LQJA 2MA5A 2VPDA 3PLWA 4Z0RA 2ZETC 4O62A 3MHHA 3ZPV1 2CSVA 3O70A 2CONA 2M85A 3KV6A 2Y43A 2KKXA 3DDTA 3FJUB 2LDRA 3ZNIA 3O47A 5FB0A 2KR4A 2YQLA 3FEHA 5LKTA 1CHCA 1WIMA 3N9OA 1WEOA 2K16A 2XOYA 2D8UA 2MNZA 3HTKC 2BAYA 1VYXA 4YBSA 5G05B 2L75A 2E6RA 2AN6A 4A49A 2VJFA 4YC9A 2MUMA 5DINA 3PHDA 2FFWA 4FO9A 2FD4A 4P5OB 2CT2A 2FUUA 2K17A 2M13A 1IYMA 2Y1NA 1XWHA 4FJCA 5DKAA 3MHSA 5LCWB 2VPGA 2LRIC 1WEMA 2M3HA 3U5PA 3MDBC 3LVRE 5D1KB 3M7KA 4N4FA 4YBMA 2MA6A 2YW8A 4YATA 3IHPA 2F6JA 4A4BA 2RR4A 2KKYA 3RPGC 2K1JA 4WZ3B 2ECGA 2PUYA 2P57A 1WEEA 2MD7B 3NG2A 2ECJA 3GV4A 3N9MA 2XOCA 2KWNA 2E61A 4LK9A 2F6NA 2OXQC 3T6RA 3QZVA 3L11A 2IQJA 1U6GB 3O36A 1BORA 1X4IA 3O35A 4R8PK 2VNFA 3RTRB 3KNVA 2EODA 4ZDTA 4AYCB 3EB5A 4PTBA 4QF2A 4LJNA 2M1RA 1HYIA 4GB0A 2XEUA 5I3LA 3EB6A 3Q1DA 3GL6A 2ECIA 3T7LA 2VP7A 2M6MA 5C13A 4UI9B 1MBMA 1WFKA 1DVPA
chains in the Genus database with same CATH topology
2L7PA 2CRWA 2CSVA 2CONA 3DWDA 2B0OE 3MDBC 3LVRE 2KKXA 3DDTA 3SUBA 1DCQA 2XOCA 3KDEC 5SVXA 3JUEA 3H7HA 4OGEA 2E61A 3E2DA 3FJUB 3M7KA 2JM3A 3O47A 3LJUX 3FEHA 3Q1DA 2DJAA 2CRRA 2YVRA 2FFWA 2IQJA 2FD4A 4Z0OA 2EXUA 4H9DA 2YREA 4F1PA 2M13A 2XP0A 3LVQE 2XOYA 3PLWA 5K3QA 2OWAA 2D8UA 2LAUA 3FM8C 2RR4A 5SVIA 2XOZA 2KKYA 4Z0RA 3T9KA 4QQ4A 5SVYA 3LDYA 4O62A 2JUNA 4OGCA 2MKEA 2P57A 2EGMA 5SVIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7P A;  2E61 A;  5SVI A;  2RR4 A;  4Z0R A;  4Z0O A;  4QQ4 A;  5SVY A;  4O62 A;  5SVX A;  5SVI B; 
#chains in the Genus database with same CATH topology
 1E4U A;  5KH9 A;  5D1L B;  5LKX A;  4A0C D;  4IC2 A;  2PNX A;  3LJU X;  4YAD A;  3ZVY A;  4WZ2 A;  2VPB A;  4AP4 A;  3HCS A;  4YAB A;  2CKL A;  2G6Q A;  4H9D A;  3O33 A;  4ZUX U;  2H0D B;  4X3G A;  3RPG B;  5B78 A;  2XOZ A;  5LKZ A;  1JM7 A;  2CSY A;  4CCG X;  2CRW A;  2L43 A;  2MNY A;  2I50 A;  4AUQ B;  1DCQ A;  5G0F A;  4MVT A;  3FAO A;  3N9Q A;  3O37 A;  5AIU A;  4ZQL A;  2YUR A;  3H7H A;  5H1U A;  2G43 A;  4QF3 A;  4UP0 A;  3O34 A;  5FB1 A;  2KGI A;  2YVR A;  2LXP C;  1FBV A;  1WEU A;  4F1P A;  2XP0 A;  4LKA A;  2EA6 A;  2YHN A;  1WEP A;  4S3O C;  1VD4 A;  2MT5 A;  3DWD A;  1FP0 A;  3PUR A;  2JMJ A;  3SUB A;  3SOW A;  2L80 A;  3E2D A;  3LQI A;  4BHW A;  4L7X A;  4O64 A;  1WEN A;  2K4D A;  1T1H A;  3FL2 A;  2YQM A;  2E6S A;  4R2Y A;  3LRQ A;  3SOU A;  4F52 B;  2IDA A;  2KYU A;  2HYE D;  4GNG A;  2KGG A;  5SVI B;  2LGL A;  4PPE A;  5H9M A;  5SVX A;  3M63 A;  3N9L A;  5G04 B;  2FUI A;  1ZBD B;  3L1Z B;  4Q6F A;  2YHO A;  2KIZ A;  3U5N A;  3M99 A;  5EYA F;  5KH3 A;  1WEV A;  5FEY A;  2KWO A;  4C9Z A;  4QQ4 A;  1G25 A;  3C6W A;  1WEW A;  2VPE A;  2DX8 A;  4I7B A;  5FER A;  1WGM A;  3U5O A;  2C2V S;  1RMD A;  2EGP A;  4GNF A;  4A4C A;  5TAB A;  2LGK A;  2UZG A;  2MD8 C;  5TDW A;  4IC3 A;  4I7C A;  1F62 A;  5SVY A;  2YUC A;  2JUN A;  1WEQ A;  5H1V A;  3L1X A;  2LV9 A;  3DPL R;  1X4J A;  3JUE A;  2ECW A;  2YSJ A;  2YYR A;  2QIC A;  4OGE A;  4I7D A;  2KWJ A;  2MIQ A;  2HDP A;  2Y1M A;  2KFT A;  3ASL A;  5TDR A;  2CRR A;  2VJF B;  5B79 A;  2QIZ A;  1MM2 A;  2G45 A;  2OWA A;  3FM8 C;  1N87 A;  2JMD A;  4FIP A;  4CA1 A;  3LDY A;  4AYC A;  4YAX A;  2MKE A;  2EGM A;  2L7P A;  1VFY A;  3KDE C;  3N9N A;  3DQV R;  5TBN A;  3LQH A;  2JRJ A;  2D8S A;  4NN2 A;  4R7E A;  5H1T A;  2EXU A;  3HCT A;  2LGG A;  3LVQ E;  2VJE B;  4W4U A;  2C2L A;  1K2F A;  2LN0 A;  4YBT A;  4AVX A;  2KU3 A;  2L5U A;  2ECT A;  3FAN A;  1HYJ A;  2DJA A;  2RI7 A;  2H0D A;  2KRE A;  1V87 A;  4L58 A;  4V3L C;  5B77 A;  2YRE A;  1Z6U A;  1LDK C;  3SHB A;  2RSD A;  5AIT A;  3U5M A;  3M62 A;  3VK6 A;  5J3X A;  3SOX A;  3I2D A;  5B75 A;  4TKP B;  4LLB A;  4FK5 A;  4V3K C;  5C11 A;  2VJE A;  5B8D A;  4GNE A;  2YT5 A;  5K3Q A;  3ZPV E;  4B86 C;  2YU4 A;  1WES A;  1X4U A;  3T9K A;  5JG6 A;  2L0B A;  3V43 A;  2ECV A;  2QJ0 A;  1MM3 A;  4B7Y C;  2YSM A;  4BBQ A;  3ZVZ B;  4MSX A;  2DSM A;  5LKU A;  2FSA A;  2JM3 A;  1Z2Q A;  5KH7 A;  3KV5 A;  2LQ6 A;  2KE1 A;  4XI1 A;  4N3W A;  5TRB A;  2ECN A;  4UP5 A;  4Z0O A;  4GND A;  2LGV A;  2LXH C;  4LAD B;  2LAU A;  5SVI A;  2CKL B;  4S3O B;  3ZYQ A;  4OGC A;  2F42 A;  3O7A A;  2XB1 A;  3KQI A;  2NAA A;  5D1M B;  3ZTG A;  2JMI A;  2B0O E;  1JM7 B;  1WIL A;  4WA6 A;  1Z60 A;  1WE9 A;  3PUQ A;  2CSZ A;  3N9P A;  5B76 A;  3HCU A;  1JOC A;  3C5K A;  1LDJ B;  4WZ0 A;  2KWK A;  3LQJ A;  2MA5 A;  2VPD A;  3PLW A;  4Z0R A;  2ZET C;  4O62 A;  3MHH A;  3ZPV 1;  2CSV A;  3O70 A;  2CON A;  2M85 A;  3KV6 A;  2Y43 A;  2KKX A;  3DDT A;  3FJU B;  2LDR A;  3ZNI A;  3O47 A;  5FB0 A;  2KR4 A;  2YQL A;  3FEH A;  5LKT A;  1CHC A;  1WIM A;  3N9O A;  1WEO A;  2K16 A;  2XOY A;  2D8U A;  2MNZ A;  3HTK C;  2BAY A;  1VYX A;  4YBS A;  5G05 B;  2L75 A;  2E6R A;  2AN6 A;  4A49 A;  2VJF A;  4YC9 A;  2MUM A;  5DIN A;  3PHD A;  2FFW A;  4FO9 A;  2FD4 A;  4P5O B;  2CT2 A;  2FUU A;  2K17 A;  2M13 A;  1IYM A;  2Y1N A;  1XWH A;  4FJC A;  5DKA A;  3MHS A;  5LCW B;  2VPG A;  2LRI C;  1WEM A;  2M3H A;  3U5P A;  3MDB C;  3LVR E;  5D1K B;  3M7K A;  4N4F A;  4YBM A;  2MA6 A;  2YW8 A;  4YAT A;  3IHP A;  2F6J A;  4A4B A;  2RR4 A;  2KKY A;  3RPG C;  2K1J A;  4WZ3 B;  2ECG A;  2PUY A;  2P57 A;  1WEE A;  2MD7 B;  3NG2 A;  2ECJ A;  3GV4 A;  3N9M A;  2XOC A;  2KWN A;  2E61 A;  4LK9 A;  2F6N A;  2OXQ C;  3T6R A;  3QZV A;  3L11 A;  2IQJ A;  1U6G B;  3O36 A;  1BOR A;  1X4I A;  3O35 A;  4R8P K;  2VNF A;  3RTR B;  3KNV A;  2EOD A;  4ZDT A;  4AYC B;  3EB5 A;  4PTB A;  4QF2 A;  4LJN A;  2M1R A;  1HYI A;  4GB0 A;  2XEU A;  5I3L A;  3EB6 A;  3Q1D A;  3GL6 A;  2ECI A;  3T7L A;  2VP7 A;  2M6M A;  5C13 A;  4UI9 B;  1MBM A;  1WFK A;  1DVP A; 
#chains in the Genus database with same CATH homology
 2L7P A;  2CRW A;  2CSV A;  2CON A;  3DWD A;  2B0O E;  3MDB C;  3LVR E;  2KKX A;  3DDT A;  3SUB A;  1DCQ A;  2XOC A;  3KDE C;  5SVX A;  3JUE A;  3H7H A;  4OGE A;  2E61 A;  3E2D A;  3FJU B;  3M7K A;  2JM3 A;  3O47 A;  3LJU X;  3FEH A;  3Q1D A;  2DJA A;  2CRR A;  2YVR A;  2FFW A;  2IQJ A;  2FD4 A;  4Z0O A;  2EXU A;  4H9D A;  2YRE A;  4F1P A;  2M13 A;  2XP0 A;  3LVQ E;  2XOY A;  3PLW A;  5K3Q A;  2OWA A;  2D8U A;  2LAU A;  3FM8 C;  2RR4 A;  5SVI A;  2XOZ A;  2KKY A;  4Z0R A;  3T9K A;  4QQ4 A;  5SVY A;  3LDY A;  4O62 A;  2JUN A;  4OGC A;  2MKE A;  2P57 A;  2EGM A;  5SVI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...