5SVXA

Morc3 cw in complex with histone h3k4me3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
49
structure length
49
Chain Sequence
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
total genus 7
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5svxA00
2RR4A 5SVXA 5SVYA 4Z0RA 4O62A 4Z0OA 5SVIB 5SVIA 4QQ4A 2E61A 2L7PA
chains in the Genus database with same CATH superfamily
2XOYA 3GV4A 1LDKC 1XWHA 4GNFA 5FEYA 2KWOA 3O33A 2ECGA 2FUUA 2JMIA 3O37A 2L75A 2Y43A 1WE9A 3T7LA 2ECJA 4A4BA 5B78A 2KGIA 5B79A 4A0CD 3FAOA 3L11A 3N9MA 2K1JA 2VJEB 4LJNA 1VYXA 2M1RA 2EGMA 3KDEC 5B8DA 2CSYA 2KWKA 1T1HA 4FIPA 2ZETC 3M62A 4CCGX 5AIUA 2AN6A 1WEOA 2LXPC 2LAUA 2YSMA 2YU4A 4BHWA 2JM3A 2OXQC 2KGGA 2JMJA 4I7BA 2IDAA 4ZQLA 4X3GA 2KE1A 3RPGC 5H1TA 3ZNIA 3LQJA 2K16A 5H9MA 4XI1A 3FANA 5I3LA 2I50A 4LLBA 2OWAA 2PUYA 3Q1DA 4B86C 5SVIA 1CHCA 3E2DA 1MM3A 5LKXA 1FBVA 3O34A 4B7YC 2C2VS 2HDPA 3KNVA 3SUBA 2QIZA 2M6MA 1Z60A 3MHSA 3C6WA 4AVXA 2Y1NA 5G0FA 1WFKA 5G04B 2KR4A 3N9LA 2VPBA 2CONA 5LCWB 3MDBC 3DPLR 4LKAA 2ECVA 2H0DA 5DINA 2LGVA 4AP4A 4F1PA 4UI9B 2VJFA 4IC3A 1K2FA 3SOXA 2KYUA 4YABA 5SVYA 4Q6FA 4WZ0A 3GL6A 1WEUA 1F62A 3LJUX 2KFTA 1Z6UA 2FUIA 3C5KA 2YURA 3SOWA 4R8PK 2CT2A 3PUQA 3V43A 2KIZA 4YATA 2MA6A 4R7EA 3ZTGA 3LRQA 1X4UA 2CKLA 3ZVZB 4I7DA 2LN0A 4Z0OA 3M7KA 1WEWA 3O35A 4YBMA 2RSDA 3PURA 5AITA 2XOZA 2VPDA 3PLWA 4C9ZA 2E61A 5LKUA 5TBNA 1X4JA 4YADA 3LDYA 2FSAA 2CSVA 1U6GB 2G43A 2MKEA 2VJFB 4MSXA 2Y1MA 5D1LB 3ZVYA 4A49A 1WGMA 5J3XA 4NN2A 5LKTA 3O70A 2EGPA 2CRRA 5JG6A 3FEHA 2MD7B 4YAXA 3KV6A 2EODA 1WEEA 3LVRE 2DSMA 5TRBA 2M85A 2YT5A 5B77A 1DVPA 4ZUXU 1RMDA 4QF2A 4YC9A 2XEUA 4QF3A 4S3OC 3ZPVE 5D1MB 5KH7A 4OGCA 2D8SA 3FJUB 2B0OE 2ECTA 2QICA 3JUEA 1HYJA 3PHDA 2DX8A 2CRWA 4AYCA 1LDJB 4WZ3B 2YVRA 5TDRA 3ZYQA 2D8UA 2FFWA 4GNDA 2JUNA 3RTRB 4BBQA 3HTKC 1V87A 1WENA 2FD4A 2YW8A 2KU3A 1BORA 2RI7A 4YBSA 1WIMA 3FM8C 4OGEA 2K4DA 4IC2A 3SOUA 4QQ4A 4H9DA 2YSJA 3LQHA 1N87A 4O64A 2H0DB 4LK9A 3N9PA 3M99A 4FO9A 3H7HA 5DKAA 2CKLB 2LGLA 4ZDTA 3SHBA 2KKXA 3N9NA 4L7XA 4I7CA 2YQMA 4CA1A 1MM2A 5SVXA 2HYED 3U5MA 3QZVA 2ECIA 4Z0RA 2EA6A 2F42A 2F6NA 3HCSA 1FP0A 1JM7B 1WEQA 4UP5A 2MD8C 1WEVA 2UZGA 1MBMA 2L7PA 2LDRA 5C11A 2F6JA 3ASLA 5EYAF 5SVIB 5KH3A 3L1ZB 2L43A 2MNZA 2KREA 2G6QA 5H1UA 4F52B 3LQIA 2MA5A 4AYCB 2C2LA 2P57A 3FL2A 2KWJA 5TABA 2NAAA 3DWDA 1WEMA 3DDTA 1X4IA 3MHHA 4TKPB 3I2DA 3VK6A 3M63A 4O62A 4WZ2A 3EB5A 2YHOA 2L80A 5FB1A 2LXHC 1IYMA 2XOCA 2IQJA 3T6RA 2XB1A 5G05B 2E6SA 2LQ6A 1WEPA 4P5OB 2JRJA 3DQVR 3LVQE 4N4FA 2MUMA 4MVTA 3U5NA 3U5PA 5B76A 3T9KA 2MNYA 3ZPV1 2DJAA 2YUCA 1E4UA 2M3HA 2LV9A 1WILA 2ECWA 3IHPA 5K3QA 4LADB 2XP0A 1ZBDB 5D1KB 2VPEA 2YREA 4R2YA 3O47A 2K17A 1G25A 5B75A 4GNEA 2YHNA 3KV5A 4WA6A 4YBTA 1JM7A 2RR4A 2E6RA 4UP0A 2YYRA 1WESA 1HYIA 2KKYA 5FERA 4V3LC 1JOCA 4V3KC 5LKZA 4A4CA 2MT5A 1VFYA 1VD4A 2PNXA 5TDWA 3RPGB 3N9QA 2VNFA 3N9OA 2LRIC 2LGKA 4L58A 2YQLA 5FB0A 3KQIA 4S3OB 2KWNA 2VPGA 4W4UA 3HCUA 2G45A 2QJ0A 3O7AA 3EB6A 5C13A 4PTBA 4AUQB 3HCTA 4GNGA 2L5UA 4FJCA 2VJEA 2VP7A 1DCQA 5KH9A 3O36A 2MIQA 2L0BA 2ECNA 3L1XA 2EXUA 4N3WA 4PPEA 2JMDA 2CSZA 2LGGA 3NG2A 5H1VA 3U5OA 4GB0A 4FK5A 2BAYA 1Z2QA 2M13A
chains in the Genus database with same CATH topology
2RR4A 3LVRE 4F1PA 3JUEA 2DJAA 3SUBA 4Z0RA 2CRWA 2KKYA 2YVRA 2XOCA 2IQJA 2MKEA 2XOYA 3DWDA 4H9DA 3DDTA 2D8UA 2FFWA 3E2DA 5SVYA 4Z0OA 5K3QA 2EGMA 2JUNA 3M7KA 3H7HA 3KDEC 2L7PA 1DCQA 2XP0A 3LVQE 2FD4A 3LJUX 5SVIB 4O62A 2XOZA 2YREA 3O47A 3PLWA 2KKXA 2EXUA 2E61A 2CRRA 2OWAA 2CONA 3MDBC 3FM8C 3Q1DA 5SVXA 3FEHA 4OGEA 3LDYA 4OGCA 2LAUA 3T9KA 5SVIA 3FJUB 4QQ4A 2JM3A 2P57A 2M13A 2B0OE 2CSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RR4 A;  5SVX A;  5SVY A;  4Z0R A;  4O62 A;  4Z0O A;  5SVI B;  5SVI A;  4QQ4 A;  2E61 A;  2L7P A; 
#chains in the Genus database with same CATH topology
 2XOY A;  3GV4 A;  1LDK C;  1XWH A;  4GNF A;  5FEY A;  2KWO A;  3O33 A;  2ECG A;  2FUU A;  2JMI A;  3O37 A;  2L75 A;  2Y43 A;  1WE9 A;  3T7L A;  2ECJ A;  4A4B A;  5B78 A;  2KGI A;  5B79 A;  4A0C D;  3FAO A;  3L11 A;  3N9M A;  2K1J A;  2VJE B;  4LJN A;  1VYX A;  2M1R A;  2EGM A;  3KDE C;  5B8D A;  2CSY A;  2KWK A;  1T1H A;  4FIP A;  2ZET C;  3M62 A;  4CCG X;  5AIU A;  2AN6 A;  1WEO A;  2LXP C;  2LAU A;  2YSM A;  2YU4 A;  4BHW A;  2JM3 A;  2OXQ C;  2KGG A;  2JMJ A;  4I7B A;  2IDA A;  4ZQL A;  4X3G A;  2KE1 A;  3RPG C;  5H1T A;  3ZNI A;  3LQJ A;  2K16 A;  5H9M A;  4XI1 A;  3FAN A;  5I3L A;  2I50 A;  4LLB A;  2OWA A;  2PUY A;  3Q1D A;  4B86 C;  5SVI A;  1CHC A;  3E2D A;  1MM3 A;  5LKX A;  1FBV A;  3O34 A;  4B7Y C;  2C2V S;  2HDP A;  3KNV A;  3SUB A;  2QIZ A;  2M6M A;  1Z60 A;  3MHS A;  3C6W A;  4AVX A;  2Y1N A;  5G0F A;  1WFK A;  5G04 B;  2KR4 A;  3N9L A;  2VPB A;  2CON A;  5LCW B;  3MDB C;  3DPL R;  4LKA A;  2ECV A;  2H0D A;  5DIN A;  2LGV A;  4AP4 A;  4F1P A;  4UI9 B;  2VJF A;  4IC3 A;  1K2F A;  3SOX A;  2KYU A;  4YAB A;  5SVY A;  4Q6F A;  4WZ0 A;  3GL6 A;  1WEU A;  1F62 A;  3LJU X;  2KFT A;  1Z6U A;  2FUI A;  3C5K A;  2YUR A;  3SOW A;  4R8P K;  2CT2 A;  3PUQ A;  3V43 A;  2KIZ A;  4YAT A;  2MA6 A;  4R7E A;  3ZTG A;  3LRQ A;  1X4U A;  2CKL A;  3ZVZ B;  4I7D A;  2LN0 A;  4Z0O A;  3M7K A;  1WEW A;  3O35 A;  4YBM A;  2RSD A;  3PUR A;  5AIT A;  2XOZ A;  2VPD A;  3PLW A;  4C9Z A;  2E61 A;  5LKU A;  5TBN A;  1X4J A;  4YAD A;  3LDY A;  2FSA A;  2CSV A;  1U6G B;  2G43 A;  2MKE A;  2VJF B;  4MSX A;  2Y1M A;  5D1L B;  3ZVY A;  4A49 A;  1WGM A;  5J3X A;  4NN2 A;  5LKT A;  3O70 A;  2EGP A;  2CRR A;  5JG6 A;  3FEH A;  2MD7 B;  4YAX A;  3KV6 A;  2EOD A;  1WEE A;  3LVR E;  2DSM A;  5TRB A;  2M85 A;  2YT5 A;  5B77 A;  1DVP A;  4ZUX U;  1RMD A;  4QF2 A;  4YC9 A;  2XEU A;  4QF3 A;  4S3O C;  3ZPV E;  5D1M B;  5KH7 A;  4OGC A;  2D8S A;  3FJU B;  2B0O E;  2ECT A;  2QIC A;  3JUE A;  1HYJ A;  3PHD A;  2DX8 A;  2CRW A;  4AYC A;  1LDJ B;  4WZ3 B;  2YVR A;  5TDR A;  3ZYQ A;  2D8U A;  2FFW A;  4GND A;  2JUN A;  3RTR B;  4BBQ A;  3HTK C;  1V87 A;  1WEN A;  2FD4 A;  2YW8 A;  2KU3 A;  1BOR A;  2RI7 A;  4YBS A;  1WIM A;  3FM8 C;  4OGE A;  2K4D A;  4IC2 A;  3SOU A;  4QQ4 A;  4H9D A;  2YSJ A;  3LQH A;  1N87 A;  4O64 A;  2H0D B;  4LK9 A;  3N9P A;  3M99 A;  4FO9 A;  3H7H A;  5DKA A;  2CKL B;  2LGL A;  4ZDT A;  3SHB A;  2KKX A;  3N9N A;  4L7X A;  4I7C A;  2YQM A;  4CA1 A;  1MM2 A;  5SVX A;  2HYE D;  3U5M A;  3QZV A;  2ECI A;  4Z0R A;  2EA6 A;  2F42 A;  2F6N A;  3HCS A;  1FP0 A;  1JM7 B;  1WEQ A;  4UP5 A;  2MD8 C;  1WEV A;  2UZG A;  1MBM A;  2L7P A;  2LDR A;  5C11 A;  2F6J A;  3ASL A;  5EYA F;  5SVI B;  5KH3 A;  3L1Z B;  2L43 A;  2MNZ A;  2KRE A;  2G6Q A;  5H1U A;  4F52 B;  3LQI A;  2MA5 A;  4AYC B;  2C2L A;  2P57 A;  3FL2 A;  2KWJ A;  5TAB A;  2NAA A;  3DWD A;  1WEM A;  3DDT A;  1X4I A;  3MHH A;  4TKP B;  3I2D A;  3VK6 A;  3M63 A;  4O62 A;  4WZ2 A;  3EB5 A;  2YHO A;  2L80 A;  5FB1 A;  2LXH C;  1IYM A;  2XOC A;  2IQJ A;  3T6R A;  2XB1 A;  5G05 B;  2E6S A;  2LQ6 A;  1WEP A;  4P5O B;  2JRJ A;  3DQV R;  3LVQ E;  4N4F A;  2MUM A;  4MVT A;  3U5N A;  3U5P A;  5B76 A;  3T9K A;  2MNY A;  3ZPV 1;  2DJA A;  2YUC A;  1E4U A;  2M3H A;  2LV9 A;  1WIL A;  2ECW A;  3IHP A;  5K3Q A;  4LAD B;  2XP0 A;  1ZBD B;  5D1K B;  2VPE A;  2YRE A;  4R2Y A;  3O47 A;  2K17 A;  1G25 A;  5B75 A;  4GNE A;  2YHN A;  3KV5 A;  4WA6 A;  4YBT A;  1JM7 A;  2RR4 A;  2E6R A;  4UP0 A;  2YYR A;  1WES A;  1HYI A;  2KKY A;  5FER A;  4V3L C;  1JOC A;  4V3K C;  5LKZ A;  4A4C A;  2MT5 A;  1VFY A;  1VD4 A;  2PNX A;  5TDW A;  3RPG B;  3N9Q A;  2VNF A;  3N9O A;  2LRI C;  2LGK A;  4L58 A;  2YQL A;  5FB0 A;  3KQI A;  4S3O B;  2KWN A;  2VPG A;  4W4U A;  3HCU A;  2G45 A;  2QJ0 A;  3O7A A;  3EB6 A;  5C13 A;  4PTB A;  4AUQ B;  3HCT A;  4GNG A;  2L5U A;  4FJC A;  2VJE A;  2VP7 A;  1DCQ A;  5KH9 A;  3O36 A;  2MIQ A;  2L0B A;  2ECN A;  3L1X A;  2EXU A;  4N3W A;  4PPE A;  2JMD A;  2CSZ A;  2LGG A;  3NG2 A;  5H1V A;  3U5O A;  4GB0 A;  4FK5 A;  2BAY A;  1Z2Q A;  2M13 A; 
#chains in the Genus database with same CATH homology
 2RR4 A;  3LVR E;  4F1P A;  3JUE A;  2DJA A;  3SUB A;  4Z0R A;  2CRW A;  2KKY A;  2YVR A;  2XOC A;  2IQJ A;  2MKE A;  2XOY A;  3DWD A;  4H9D A;  3DDT A;  2D8U A;  2FFW A;  3E2D A;  5SVY A;  4Z0O A;  5K3Q A;  2EGM A;  2JUN A;  3M7K A;  3H7H A;  3KDE C;  2L7P A;  1DCQ A;  2XP0 A;  3LVQ E;  2FD4 A;  3LJU X;  5SVI B;  4O62 A;  2XOZ A;  2YRE A;  3O47 A;  3PLW A;  2KKX A;  2EXU A;  2E61 A;  2CRR A;  2OWA A;  2CON A;  3MDB C;  3FM8 C;  3Q1D A;  5SVX A;  3FEH A;  4OGE A;  3LDY A;  4OGC A;  2LAU A;  3T9K A;  5SVI A;  3FJU B;  4QQ4 A;  2JM3 A;  2P57 A;  2M13 A;  2B0O E;  2CSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...