5SVXA

Morc3 cw in complex with histone h3k4me3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
49
structure length
49
Chain Sequence
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
total genus 7
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5svxA00
4Z0RA 4O62A 5SVIA 4Z0OA 5SVYA 5SVXA 4QQ4A 2E61A 5SVIB 2RR4A 2L7PA
chains in the Genus database with same CATH superfamily
3T9KA 5JG6A 3HCUA 5TRBA 2L5UA 1VYXA 3FAOA 4LADB 3KNVA 4CCGX 2YU4A 1Z60A 1Z6UA 1WEMA 3KDEC 2MIQA 1LDKC 2VPEA 4Z0RA 2F6NA 3N9QA 1WFKA 4I7DA 4QQ4A 5B77A 2LDRA 3U5MA 4B7YC 3HTKC 2PNXA 4IC3A 3ZPV1 3ZVZB 5LCWB 3LRQA 3KQIA 1MBMA 3L1XA 2CONA 4WZ2A 2XOCA 3E2DA 3O34A 2FD4A 1WIMA 4A4CA 1G25A 2LGGA 3MHSA 1U6GB 1WEPA 3U5OA 2L7PA 2ZETC 5AIUA 4P5OB 2Y1MA 2YVRA 1RMDA 3ZPVE 3N9MA 5G0FA 3O36A 2JMIA 5B79A 5D1KB 2B0OE 2LAUA 1LDJB 1WEWA 5LKUA 2ECIA 2MKEA 2YREA 5SVYA 5AITA 4FK5A 5K3QA 4MVTA 4L58A 4IC2A 3O70A 2JMDA 3N9LA 1T1HA 4ZUXU 1VFYA 2MNYA 2Y43A 4BHWA 4R7EA 2OXQC 3MHHA 4YBMA 1WEOA 2G6QA 3LJUX 5G05B 5FB0A 2CT2A 5TDRA 2D8SA 5SVIB 4TKPB 2ECWA 2MT5A 5C11A 2OWAA 4V3LC 2QJ0A 4AYCB 3C5KA 3RPGC 2ECNA 3SOUA 2UZGA 4AVXA 2CRRA 4AYCA 1WE9A 2K1JA 1X4UA 2L75A 3ZTGA 4CA1A 1DCQA 4OGEA 5KH9A 2VJFB 2MUMA 2LQ6A 4I7BA 2YW8A 5H9MA 2YT5A 1Z2QA 2EGPA 2L0BA 4BBQA 4O64A 5B75A 4B86C 2EXUA 2ECGA 3L11A 5G04B 3FANA 2K4DA 2XOYA 1CHCA 1BORA 5B76A 3O33A 1HYJA 3N9PA 3LQHA 4LKAA 5FB1A 2QICA 3LVRE 1FP0A 4WA6A 4A49A 5H1VA 4A4BA 2DSMA 2KGGA 4GB0A 3M63A 5FEYA 4S3OB 4C9ZA 5B78A 2QIZA 3SOXA 3Q1DA 2KWKA 2YUCA 5TBNA 3PUQA 2KREA 4XI1A 2MA6A 2KWJA 4YBTA 2LRIC 4NN2A 2RSDA 2JM3A 2MNZA 1WGMA 3PHDA 2HDPA 5KH7A 3N9OA 3EB6A 2VPBA 2VJEB 2LGVA 4V3KC 3FJUB 2YSJA 3SHBA 2XB1A 5DINA 1WILA 4YAXA 4S3OC 3M7KA 2IDAA 3HCTA 5FERA 2EODA 4ZDTA 3ASLA 2YYRA 2K16A 3JUEA 1JM7B 2M3HA 2YSMA 2XP0A 1JOCA 4H9DA 4GNEA 3GV4A 4F52B 2DJAA 1K2FA 3PURA 1ZBDB 2I50A 3V43A 4X3GA 1VD4A 4LK9A 5D1MB 1WEQA 2ECTA 2VJFA 3O35A 3DDTA 5LKZA 2CKLA 4A0CD 3RTRB 2EA6A 5DKAA 5B8DA 2KKXA 2VPDA 4AUQB 1WEEA 4N4FA 3EB5A 4YC9A 3MDBC 3KV6A 5EYAF 4GNGA 2BAYA 3SUBA 5I3LA 3DPLR 2MA5A 2H0DB 3C6WA 4WZ0A 2CRWA 1MM2A 4UP5A 5SVIA 5D1LB 2FUUA 3VK6A 2CSYA 3N9NA 5LKXA 3FEHA 3RPGB 3SOWA 2RI7A 4R8PK 1V87A 2H0DA 3T7LA 1WEVA 2FSAA 2KE1A 1X4JA 2K17A 3QZVA 4LJNA 2M1RA 2L80A 4I7CA 3FM8C 4L7XA 3O7AA 4O62A 4GNFA 2M6MA 4LLBA 2F42A 2HYED 4F1PA 2LGLA 2F6JA 5TDWA 3PLWA 2JMJA 2XEUA 2CSVA 2KWNA 2PUYA 2FFWA 2KGIA 4QF2A 3M62A 1X4IA 3DWDA 3ZVYA 2E61A 4PPEA 2KU3A 2KFTA 2E6SA 2EGMA 2YHOA 3I2DA 2LXHC 4UP0A 2YURA 2YQLA 5C13A 4GNDA 3ZYQA 4Z0OA 4R2YA 2C2LA 2MD8C 1WEUA 5J3XA 3LDYA 2VNFA 2LGKA 1XWHA 2AN6A 2KR4A 2VPGA 3LVQE 3GL6A 1F62A 2FUIA 3U5NA 2KKYA 3HCSA 1HYIA 1FBVA 3IHPA 2KIZA 2C2VS 4YATA 4FO9A 2YQMA 5KH3A 2D8UA 4FIPA 2LXPC 1IYMA 3U5PA 2CSZA 3M99A 5LKTA 4Q6FA 5H1UA 2KWOA 2CKLB 2ECVA 2JRJA 1WESA 1N87A 2YHNA 3O47A 2L43A 2XOZA 2LN0A 2KYUA 2NAAA 4MSXA 2MD7B 2VP7A 4YABA 5H1TA 4QF3A 3H7HA 1WENA 3ZNIA 5SVXA 5TABA 3KV5A 2G43A 2G45A 2Y1NA 4W4UA 2DX8A 4YBSA 2ECJA 3FL2A 2LV9A 1DVPA 2RR4A 4UI9B 4ZQLA 3LQIA 3LQJA 2M85A 2IQJA 2M13A 3L1ZB 3T6RA 4WZ3B 3NG2A 4OGCA 4N3WA 3DQVR 1E4UA 1MM3A 2E6RA 4FJCA 4AP4A 4YADA 2P57A 1JM7A 2VJEA 3O37A 4PTBA 2JUNA
chains in the Genus database with same CATH topology
3T9KA 2CRWA 4O62A 2EGMA 5SVIA 2CRRA 3DDTA 2JM3A 3JUEA 2B0OE 2LAUA 2CONA 4F1PA 2RR4A 1DCQA 4OGEA 2XOCA 3FEHA 2XP0A 3E2DA 3LJUX 2MKEA 2FD4A 4H9DA 2XOYA 2IQJA 2M13A 2YREA 4Z0OA 5SVYA 2D8UA 3PLWA 2KKXA 5SVIB 3KDEC 3O47A 4OGCA 2CSVA 2XOZA 3FJUB 3Q1DA 4Z0RA 2DJAA 5K3QA 3LDYA 2FFWA 3MDBC 4QQ4A 2OWAA 3LVQE 3DWDA 2L7PA 3H7HA 3M7KA 2P57A 3LVRE 3SUBA 5SVXA 3FM8C 2E61A 2KKYA 2YVRA 2EXUA 2JUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0R A;  4O62 A;  5SVI A;  4Z0O A;  5SVY A;  5SVX A;  4QQ4 A;  2E61 A;  5SVI B;  2RR4 A;  2L7P A; 
#chains in the Genus database with same CATH topology
 3T9K A;  5JG6 A;  3HCU A;  5TRB A;  2L5U A;  1VYX A;  3FAO A;  4LAD B;  3KNV A;  4CCG X;  2YU4 A;  1Z60 A;  1Z6U A;  1WEM A;  3KDE C;  2MIQ A;  1LDK C;  2VPE A;  4Z0R A;  2F6N A;  3N9Q A;  1WFK A;  4I7D A;  4QQ4 A;  5B77 A;  2LDR A;  3U5M A;  4B7Y C;  3HTK C;  2PNX A;  4IC3 A;  3ZPV 1;  3ZVZ B;  5LCW B;  3LRQ A;  3KQI A;  1MBM A;  3L1X A;  2CON A;  4WZ2 A;  2XOC A;  3E2D A;  3O34 A;  2FD4 A;  1WIM A;  4A4C A;  1G25 A;  2LGG A;  3MHS A;  1U6G B;  1WEP A;  3U5O A;  2L7P A;  2ZET C;  5AIU A;  4P5O B;  2Y1M A;  2YVR A;  1RMD A;  3ZPV E;  3N9M A;  5G0F A;  3O36 A;  2JMI A;  5B79 A;  5D1K B;  2B0O E;  2LAU A;  1LDJ B;  1WEW A;  5LKU A;  2ECI A;  2MKE A;  2YRE A;  5SVY A;  5AIT A;  4FK5 A;  5K3Q A;  4MVT A;  4L58 A;  4IC2 A;  3O70 A;  2JMD A;  3N9L A;  1T1H A;  4ZUX U;  1VFY A;  2MNY A;  2Y43 A;  4BHW A;  4R7E A;  2OXQ C;  3MHH A;  4YBM A;  1WEO A;  2G6Q A;  3LJU X;  5G05 B;  5FB0 A;  2CT2 A;  5TDR A;  2D8S A;  5SVI B;  4TKP B;  2ECW A;  2MT5 A;  5C11 A;  2OWA A;  4V3L C;  2QJ0 A;  4AYC B;  3C5K A;  3RPG C;  2ECN A;  3SOU A;  2UZG A;  4AVX A;  2CRR A;  4AYC A;  1WE9 A;  2K1J A;  1X4U A;  2L75 A;  3ZTG A;  4CA1 A;  1DCQ A;  4OGE A;  5KH9 A;  2VJF B;  2MUM A;  2LQ6 A;  4I7B A;  2YW8 A;  5H9M A;  2YT5 A;  1Z2Q A;  2EGP A;  2L0B A;  4BBQ A;  4O64 A;  5B75 A;  4B86 C;  2EXU A;  2ECG A;  3L11 A;  5G04 B;  3FAN A;  2K4D A;  2XOY A;  1CHC A;  1BOR A;  5B76 A;  3O33 A;  1HYJ A;  3N9P A;  3LQH A;  4LKA A;  5FB1 A;  2QIC A;  3LVR E;  1FP0 A;  4WA6 A;  4A49 A;  5H1V A;  4A4B A;  2DSM A;  2KGG A;  4GB0 A;  3M63 A;  5FEY A;  4S3O B;  4C9Z A;  5B78 A;  2QIZ A;  3SOX A;  3Q1D A;  2KWK A;  2YUC A;  5TBN A;  3PUQ A;  2KRE A;  4XI1 A;  2MA6 A;  2KWJ A;  4YBT A;  2LRI C;  4NN2 A;  2RSD A;  2JM3 A;  2MNZ A;  1WGM A;  3PHD A;  2HDP A;  5KH7 A;  3N9O A;  3EB6 A;  2VPB A;  2VJE B;  2LGV A;  4V3K C;  3FJU B;  2YSJ A;  3SHB A;  2XB1 A;  5DIN A;  1WIL A;  4YAX A;  4S3O C;  3M7K A;  2IDA A;  3HCT A;  5FER A;  2EOD A;  4ZDT A;  3ASL A;  2YYR A;  2K16 A;  3JUE A;  1JM7 B;  2M3H A;  2YSM A;  2XP0 A;  1JOC A;  4H9D A;  4GNE A;  3GV4 A;  4F52 B;  2DJA A;  1K2F A;  3PUR A;  1ZBD B;  2I50 A;  3V43 A;  4X3G A;  1VD4 A;  4LK9 A;  5D1M B;  1WEQ A;  2ECT A;  2VJF A;  3O35 A;  3DDT A;  5LKZ A;  2CKL A;  4A0C D;  3RTR B;  2EA6 A;  5DKA A;  5B8D A;  2KKX A;  2VPD A;  4AUQ B;  1WEE A;  4N4F A;  3EB5 A;  4YC9 A;  3MDB C;  3KV6 A;  5EYA F;  4GNG A;  2BAY A;  3SUB A;  5I3L A;  3DPL R;  2MA5 A;  2H0D B;  3C6W A;  4WZ0 A;  2CRW A;  1MM2 A;  4UP5 A;  5SVI A;  5D1L B;  2FUU A;  3VK6 A;  2CSY A;  3N9N A;  5LKX A;  3FEH A;  3RPG B;  3SOW A;  2RI7 A;  4R8P K;  1V87 A;  2H0D A;  3T7L A;  1WEV A;  2FSA A;  2KE1 A;  1X4J A;  2K17 A;  3QZV A;  4LJN A;  2M1R A;  2L80 A;  4I7C A;  3FM8 C;  4L7X A;  3O7A A;  4O62 A;  4GNF A;  2M6M A;  4LLB A;  2F42 A;  2HYE D;  4F1P A;  2LGL A;  2F6J A;  5TDW A;  3PLW A;  2JMJ A;  2XEU A;  2CSV A;  2KWN A;  2PUY A;  2FFW A;  2KGI A;  4QF2 A;  3M62 A;  1X4I A;  3DWD A;  3ZVY A;  2E61 A;  4PPE A;  2KU3 A;  2KFT A;  2E6S A;  2EGM A;  2YHO A;  3I2D A;  2LXH C;  4UP0 A;  2YUR A;  2YQL A;  5C13 A;  4GND A;  3ZYQ A;  4Z0O A;  4R2Y A;  2C2L A;  2MD8 C;  1WEU A;  5J3X A;  3LDY A;  2VNF A;  2LGK A;  1XWH A;  2AN6 A;  2KR4 A;  2VPG A;  3LVQ E;  3GL6 A;  1F62 A;  2FUI A;  3U5N A;  2KKY A;  3HCS A;  1HYI A;  1FBV A;  3IHP A;  2KIZ A;  2C2V S;  4YAT A;  4FO9 A;  2YQM A;  5KH3 A;  2D8U A;  4FIP A;  2LXP C;  1IYM A;  3U5P A;  2CSZ A;  3M99 A;  5LKT A;  4Q6F A;  5H1U A;  2KWO A;  2CKL B;  2ECV A;  2JRJ A;  1WES A;  1N87 A;  2YHN A;  3O47 A;  2L43 A;  2XOZ A;  2LN0 A;  2KYU A;  2NAA A;  4MSX A;  2MD7 B;  2VP7 A;  4YAB A;  5H1T A;  4QF3 A;  3H7H A;  1WEN A;  3ZNI A;  5SVX A;  5TAB A;  3KV5 A;  2G43 A;  2G45 A;  2Y1N A;  4W4U A;  2DX8 A;  4YBS A;  2ECJ A;  3FL2 A;  2LV9 A;  1DVP A;  2RR4 A;  4UI9 B;  4ZQL A;  3LQI A;  3LQJ A;  2M85 A;  2IQJ A;  2M13 A;  3L1Z B;  3T6R A;  4WZ3 B;  3NG2 A;  4OGC A;  4N3W A;  3DQV R;  1E4U A;  1MM3 A;  2E6R A;  4FJC A;  4AP4 A;  4YAD A;  2P57 A;  1JM7 A;  2VJE A;  3O37 A;  4PTB A;  2JUN A; 
#chains in the Genus database with same CATH homology
 3T9K A;  2CRW A;  4O62 A;  2EGM A;  5SVI A;  2CRR A;  3DDT A;  2JM3 A;  3JUE A;  2B0O E;  2LAU A;  2CON A;  4F1P A;  2RR4 A;  1DCQ A;  4OGE A;  2XOC A;  3FEH A;  2XP0 A;  3E2D A;  3LJU X;  2MKE A;  2FD4 A;  4H9D A;  2XOY A;  2IQJ A;  2M13 A;  2YRE A;  4Z0O A;  5SVY A;  2D8U A;  3PLW A;  2KKX A;  5SVI B;  3KDE C;  3O47 A;  4OGC A;  2CSV A;  2XOZ A;  3FJU B;  3Q1D A;  4Z0R A;  2DJA A;  5K3Q A;  3LDY A;  2FFW A;  3MDB C;  4QQ4 A;  2OWA A;  3LVQ E;  3DWD A;  2L7P A;  3H7H A;  3M7K A;  2P57 A;  3LVR E;  3SUB A;  5SVX A;  3FM8 C;  2E61 A;  2KKY A;  2YVR A;  2EXU A;  2JUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...