2XEUA

Ring domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
b'GAMVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING FINGER PROTEIN 4
publication title Mechanism of Ubiquitylation by Dimeric Ring Ligase Rnf4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2xeuA00
2MD8C 2MA5A 2M85A 2MNYA 3LQIA 4W4UA 2ECIA 4GNFA 2G43A 2YT5A 2LDRA 2YQLA 2MT5A 1K2FA 2F42A 3QZVA 5TBNA 4LKAA 2UZGA 5H1UA 3DPLR 2KREA 3M99A 2VJFA 3O34A 4YABA 1WEPA 2H0DB 5FB0A 3MHSA 2LRIC 3ZNIA 4FK5A 4I7DA 3SOWA 5C13A 1JOCA 4UP5A 3LQHA 2CSYA 4N4FA 2F6JA 2QIZA 2L43A 3N9OA 4FJCA 4GNEA 2KFTA 4AYCB 1G25A 2KWOA 5FEYA 4YBTA 3GV4A 1LDKC 1X4UA 1WEOA 2G6QA 4YBSA 2ECGA 2RSDA 3O36A 3RPGC 5DINA 5AIUA 4NN2A 2LGVA 1MM2A 3C6WA 2JMJA 1MM3A 2JMIA 4LJNA 1T1HA 5KH7A 2Y1MA 2VP7A 4YAXA 3ZPV1 2ZETC 1VFYA 4GB0A 2OXQC 2CKLA 5TRBA 2C2LA 2M3HA 2BAYA 5TDRA 4AP4A 2AN6A 2MD7B 2LQ6A 2YURA 3KV5A 3N9LA 2MUMA 3ZTGA 3SOXA 5LKUA 3U5OA 2LN0A 5B8DA 4QF3A 2KWJA 3HCUA 2KR4A 2G45A 3L11A 4WZ2A 1WE9A 3MHHA 3N9NA 5H1VA 4R7EA 3I2DA 3O35A 2QJ0A 2CT2A 4ZQLA 2EODA 2KWNA 2JRJA 2HDPA 4I7BA 5LKTA 1BORA 4WA6A 4R8PK 4IC3A 4A0CD 2MA6A 2L5UA 2ECVA 2K1JA 5J3XA 3U5MA 3O7AA 3VK6A 5TDWA 4YBMA 5EYAF 3SHBA 1CHCA 5D1LB 3M63A 4CA1A 5TABA 2EA6A 5I3LA 4YATA 2FUIA 4MSXA 1WILA 2VJEA 2E6RA 2MNZA 1Z2QA 1WEQA 2KE1A 2XEUA 4V3LC 3T6RA 1X4JA 2M1RA 4BBQA 2YSMA 2FSAA 2ECTA 4AVXA 5G04B 1JM7A 1F62A 4PTBA 2K4DA 5G05B 4ZUXU 1WEVA 3O70A 4ZDTA 2YHOA 4V3KC 4R2YA 5B76A 2LV9A 2VPBA 4I7CA 4FIPA 1Z6UA 2L0BA 4LLBA 5JG6A 3SOUA 4GNDA 2K17A 4GNGA 3M62A 2NAAA 2VJFB 2PUYA 2LGKA 3ZVYA 2VPEA 3KV6A 3LRQA 5D1MB 3DQVR 3HCSA 1VD4A 5D1KB 1HYIA 2HYED 2JMDA 2Y1NA 2LGGA 1DVPA 3N9PA 4L7XA 5FB1A 1HYJA 3L1ZB 2YW8A 5H9MA 1VYXA 3U5NA 2D8SA 2K16A 2H0DA 5H1TA 2YHNA 2XB1A 1RMDA 1WGMA 4A4BA 1LDJB 4X3GA 4N3WA 2IDAA 2KU3A 3IHPA 4MVTA 5AITA 2YYRA 3U5PA 1WEUA 2VPGA 4P5OB 5LKXA 3N9MA 3T7LA 3ZVZB 3EB6A 5C11A 2YUCA 3NG2A 1WFKA 1FBVA 5LKZA 2C2VS 3FL2A 1ZBDB 2KGGA 2CKLB 1WIMA 3O33A 2YQMA 3ZPVE 2YREA 1WESA 1E4UA 4PPEA 5KH9A 3RTRB 4IC2A 3PUQA 4WZ3B 2VPDA 3EB5A 4UP0A 3GL6A 5KH3A 2FUUA 3ASLA 4S3OB 4B7YC 4QF2A 2LXHC 1Z60A 2M6MA 1X4IA 2DX8A 4Q6FA 3C5KA 4AUQB 2KIZA 2KGIA 2Y43A 2I50A 2EGPA 2KWKA 1WENA 3ZYQA 4BHWA 2ECNA 3HCTA 1N87A 4LADB 1U6GB 1XWHA 3L1XA 2L75A 3KNVA 2LXPC 3V43A 1WEWA 4TKPB 4C9ZA 2LGLA 2F6NA 4UI9B 3O37A 1WEMA 1FP0A 2YSJA 2E6SA 5DKAA 2MIQA 4WZ0A 3HTKC 1V87A 5LCWB 3LQJA 5G0FA 3KQIA 2ECJA 3PURA 2VJEB 3N9QA 2L80A 4LK9A 5B75A 2RI7A 4B86C 4FO9A 4A49A 4S3OC 2KYUA 5B79A 4CCGX 4O64A 4YADA 4L58A 2PNXA 4F52B 2QICA 2ECWA 4XI1A 5FERA 1IYMA 4YC9A 5B77A 2VNFA 1JM7B 4AYCA 5B78A 2CSZA 1WEEA 3RPGB 3PHDA 4A4CA 2YU4A
chains in the Genus database with same CATH superfamily
2MD8C 2MA5A 2M85A 2MNYA 3LQIA 4W4UA 2ECIA 4GNFA 2G43A 2OWAA 2YT5A 2LDRA 2YQLA 4Z0RA 2MT5A 3FM8C 1K2FA 5K3QA 3LVQE 2F42A 3QZVA 5TBNA 4LKAA 2UZGA 5H1UA 3DPLR 2KREA 3M99A 2VJFA 4F1PA 3O34A 4YABA 1WEPA 2H0DB 2B0OE 2E61A 3MHSA 5FB0A 2LRIC 2YVRA 3ZNIA 4FK5A 4I7DA 3SOWA 5C13A 1JOCA 3FJUB 4UP5A 3LQHA 2CSYA 4N4FA 2F6JA 2QIZA 2L43A 3N9OA 4FJCA 4GNEA 2KFTA 4AYCB 1G25A 2KWOA 5FEYA 4YBTA 3GV4A 1LDKC 1X4UA 3Q1DA 1WEOA 2G6QA 4YBSA 2ECGA 2RSDA 3O36A 3RPGC 5DINA 2DJAA 5AIUA 4NN2A 2LGVA 1MM2A 2JM3A 3C6WA 2JMJA 1MM3A 2JMIA 4LJNA 1T1HA 2DSMA 5KH7A 2Y1MA 2VP7A 4YAXA 2CRWA 3ZPV1 2ZETC 5SVIA 1VFYA 4GB0A 3M7KA 2OXQC 2CKLA 5TRBA 2C2LA 2M3HA 2CRRA 2BAYA 5TDRA 1MBMA 4AP4A 2AN6A 5SVXA 2MD7B 2LQ6A 2YURA 3KV5A 3N9LA 2MUMA 2XOCA 3ZTGA 3SOXA 5LKUA 3U5OA 2LN0A 5B8DA 4QF3A 2FFWA 2KWJA 3HCUA 2KR4A 2G45A 3L11A 4WZ2A 1WE9A 3MHHA 3N9NA 5H1VA 2CONA 5SVYA 4R7EA 3I2DA 3O35A 2QJ0A 2CT2A 4ZQLA 2EODA 2KWNA 2JRJA 3LJUX 2HDPA 4I7BA 4O62A 2EXUA 5LKTA 1BORA 3DWDA 4WA6A 3LVRE 2IQJA 4OGCA 4R8PK 1DCQA 4IC3A 4A0CD 2MA6A 2L5UA 2ECVA 2K1JA 5J3XA 3U5MA 3O7AA 3VK6A 5TDWA 4YBMA 5EYAF 3SHBA 1CHCA 5D1LB 3M63A 4CA1A 5TABA 2EA6A 5I3LA 2M13A 4YATA 2FUIA 4MSXA 1WILA 3FEHA 2CSVA 2VJEA 2XP0A 3T9KA 2E6RA 2MNZA 1Z2QA 1WEQA 2KE1A 2XEUA 4V3LC 3T6RA 1X4JA 2M1RA 4BBQA 2XOYA 2P57A 2YSMA 2FSAA 2ECTA 2MKEA 4AVXA 5G04B 1JM7A 1F62A 4PTBA 2K4DA 5G05B 4ZUXU 1WEVA 3O70A 4ZDTA 2YHOA 4V3KC 4R2YA 5B76A 4OGEA 2LV9A 2VPBA 4I7CA 4FIPA 1Z6UA 2L0BA 4LLBA 5JG6A 4GNDA 3SOUA 2K17A 3E2DA 4GNGA 3M62A 2NAAA 2VJFB 2PUYA 2LGKA 3ZVYA 2VPEA 3KV6A 3LRQA 5D1MB 3DQVR 3HCSA 1VD4A 5D1KB 2L7PA 1HYIA 2HYED 2JMDA 2Y1NA 2LGGA 1DVPA 3N9PA 4L7XA 5FB1A 2RR4A 1HYJA 3L1ZB 2YW8A 5H9MA 1VYXA 3U5NA 3PLWA 2D8SA 2K16A 2H0DA 5H1TA 2YHNA 2XB1A 1RMDA 1WGMA 4A4BA 1LDJB 4X3GA 2XOZA 4N3WA 2IDAA 2KU3A 3IHPA 4MVTA 5AITA 2YYRA 3U5PA 1WEUA 2VPGA 4P5OB 5LKXA 3N9MA 3T7LA 2JUNA 2LAUA 4QQ4A 2D8UA 3ZVZB 3H7HA 3EB6A 5C11A 3MDBC 2YUCA 3NG2A 1WFKA 1FBVA 5LKZA 2C2VS 3FL2A 5SVIB 1ZBDB 2KGGA 2CKLB 1WIMA 3O33A 2YQMA 3ZPVE 2YREA 1WESA 1E4UA 4PPEA 5KH9A 3RTRB 4IC2A 3PUQA 4WZ3B 2VPDA 3EB5A 4UP0A 3GL6A 3O47A 5KH3A 2FUUA 3ASLA 4S3OB 4B7YC 4QF2A 2LXHC 1Z60A 2M6MA 3JUEA 1X4IA 2DX8A 4Q6FA 3C5KA 4AUQB 2KIZA 2KGIA 2Y43A 2I50A 3FANA 3DDTA 2EGPA 2KWKA 1WENA 3ZYQA 4BHWA 2ECNA 3HCTA 1N87A 4Z0OA 4LADB 1U6GB 2KKYA 1XWHA 3L1XA 2L75A 3KNVA 2LXPC 3KDEC 3V43A 1WEWA 3LDYA 4TKPB 4C9ZA 2LGLA 2F6NA 3FAOA 4UI9B 3O37A 1WEMA 3SUBA 1FP0A 2YSJA 2E6SA 5DKAA 2MIQA 4WZ0A 3HTKC 1V87A 4H9DA 5LCWB 3LQJA 5G0FA 3KQIA 2ECJA 3PURA 2VJEB 2FD4A 3N9QA 2L80A 4LK9A 5B75A 2RI7A 4B86C 4FO9A 4A49A 4S3OC 2KYUA 5B79A 4CCGX 4O64A 4YADA 4L58A 2PNXA 4F52B 2QICA 2ECWA 2KKXA 2EGMA 4XI1A 5FERA 1IYMA 4YC9A 5B77A 2VNFA 1JM7B 4AYCA 5B78A 2CSZA 1WEEA 3RPGB 3PHDA 4A4CA 2YU4A
chains in the Genus database with same CATH topology
2MD8C 2MA5A 2M85A 2MNYA 3LQIA 4W4UA 2ECIA 4GNFA 2G43A 2YT5A 2LDRA 2YQLA 2MT5A 1K2FA 2F42A 3QZVA 5TBNA 4LKAA 2UZGA 5H1UA 3DPLR 2KREA 3M99A 2VJFA 3O34A 4YABA 1WEPA 2H0DB 5FB0A 3MHSA 2LRIC 3ZNIA 4FK5A 4I7DA 3SOWA 5C13A 1JOCA 4UP5A 3LQHA 2CSYA 4N4FA 2F6JA 2QIZA 2L43A 3N9OA 4FJCA 4GNEA 2KFTA 4AYCB 1G25A 2KWOA 5FEYA 4YBTA 3GV4A 1LDKC 1X4UA 1WEOA 2G6QA 4YBSA 2ECGA 2RSDA 3O36A 3RPGC 5DINA 5AIUA 4NN2A 2LGVA 1MM2A 3C6WA 2JMJA 1MM3A 2JMIA 4LJNA 1T1HA 5KH7A 2Y1MA 2VP7A 4YAXA 3ZPV1 2ZETC 1VFYA 4GB0A 2OXQC 2CKLA 5TRBA 2C2LA 2M3HA 2BAYA 5TDRA 4AP4A 2AN6A 2MD7B 2LQ6A 2YURA 3KV5A 3N9LA 2MUMA 3ZTGA 3SOXA 5LKUA 3U5OA 2LN0A 5B8DA 4QF3A 2KWJA 3HCUA 2KR4A 2G45A 3L11A 4WZ2A 1WE9A 3MHHA 3N9NA 5H1VA 4R7EA 3I2DA 3O35A 2QJ0A 2CT2A 4ZQLA 2EODA 2KWNA 2JRJA 2HDPA 4I7BA 5LKTA 1BORA 4WA6A 4R8PK 4IC3A 4A0CD 2MA6A 2L5UA 2ECVA 2K1JA 5J3XA 3U5MA 3O7AA 3VK6A 5TDWA 4YBMA 5EYAF 3SHBA 1CHCA 5D1LB 3M63A 4CA1A 5TABA 2EA6A 5I3LA 4YATA 2FUIA 4MSXA 1WILA 2VJEA 2E6RA 2MNZA 1Z2QA 1WEQA 2KE1A 2XEUA 4V3LC 3T6RA 1X4JA 2M1RA 4BBQA 2YSMA 2FSAA 2ECTA 4AVXA 5G04B 1JM7A 1F62A 4PTBA 2K4DA 5G05B 4ZUXU 1WEVA 3O70A 4ZDTA 2YHOA 4V3KC 4R2YA 5B76A 2LV9A 2VPBA 4I7CA 4FIPA 1Z6UA 2L0BA 4LLBA 5JG6A 3SOUA 4GNDA 2K17A 4GNGA 3M62A 2NAAA 2VJFB 2PUYA 2LGKA 3ZVYA 2VPEA 3KV6A 3LRQA 5D1MB 3DQVR 3HCSA 1VD4A 5D1KB 1HYIA 2HYED 2JMDA 2Y1NA 2LGGA 1DVPA 3N9PA 4L7XA 5FB1A 1HYJA 3L1ZB 2YW8A 5H9MA 1VYXA 3U5NA 2D8SA 2K16A 2H0DA 5H1TA 2YHNA 2XB1A 1RMDA 1WGMA 4A4BA 1LDJB 4X3GA 4N3WA 2IDAA 2KU3A 3IHPA 4MVTA 5AITA 2YYRA 3U5PA 1WEUA 2VPGA 4P5OB 5LKXA 3N9MA 3T7LA 3ZVZB 3EB6A 5C11A 2YUCA 3NG2A 1WFKA 1FBVA 5LKZA 2C2VS 3FL2A 1ZBDB 2KGGA 2CKLB 1WIMA 3O33A 2YQMA 3ZPVE 2YREA 1WESA 1E4UA 4PPEA 5KH9A 3RTRB 4IC2A 3PUQA 4WZ3B 2VPDA 3EB5A 4UP0A 3GL6A 5KH3A 2FUUA 3ASLA 4S3OB 4B7YC 4QF2A 2LXHC 1Z60A 2M6MA 1X4IA 2DX8A 4Q6FA 3C5KA 4AUQB 2KIZA 2KGIA 2Y43A 2I50A 2EGPA 2KWKA 1WENA 3ZYQA 4BHWA 2ECNA 3HCTA 1N87A 4LADB 1U6GB 1XWHA 3L1XA 2L75A 3KNVA 2LXPC 3V43A 1WEWA 4TKPB 4C9ZA 2LGLA 2F6NA 4UI9B 3O37A 1WEMA 1FP0A 2YSJA 2E6SA 5DKAA 2MIQA 4WZ0A 3HTKC 1V87A 5LCWB 3LQJA 5G0FA 3KQIA 2ECJA 3PURA 2VJEB 3N9QA 2L80A 4LK9A 5B75A 2RI7A 4B86C 4FO9A 4A49A 4S3OC 2KYUA 5B79A 4CCGX 4O64A 4YADA 4L58A 2PNXA 4F52B 2QICA 2ECWA 4XI1A 5FERA 1IYMA 4YC9A 5B77A 2VNFA 1JM7B 4AYCA 5B78A 2CSZA 1WEEA 3RPGB 3PHDA 4A4CA 2YU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD8 C;  2MA5 A;  2M85 A;  2MNY A;  3LQI A;  4W4U A;  2ECI A;  4GNF A;  2G43 A;  2YT5 A;  2LDR A;  2YQL A;  2MT5 A;  1K2F A;  2F42 A;  3QZV A;  5TBN A;  4LKA A;  2UZG A;  5H1U A;  3DPL R;  2KRE A;  3M99 A;  2VJF A;  3O34 A;  4YAB A;  1WEP A;  2H0D B;  5FB0 A;  3MHS A;  2LRI C;  3ZNI A;  4FK5 A;  4I7D A;  3SOW A;  5C13 A;  1JOC A;  4UP5 A;  3LQH A;  2CSY A;  4N4F A;  2F6J A;  2QIZ A;  2L43 A;  3N9O A;  4FJC A;  4GNE A;  2KFT A;  4AYC B;  1G25 A;  2KWO A;  5FEY A;  4YBT A;  3GV4 A;  1LDK C;  1X4U A;  1WEO A;  2G6Q A;  4YBS A;  2ECG A;  2RSD A;  3O36 A;  3RPG C;  5DIN A;  5AIU A;  4NN2 A;  2LGV A;  1MM2 A;  3C6W A;  2JMJ A;  1MM3 A;  2JMI A;  4LJN A;  1T1H A;  5KH7 A;  2Y1M A;  2VP7 A;  4YAX A;  3ZPV 1;  2ZET C;  1VFY A;  4GB0 A;  2OXQ C;  2CKL A;  5TRB A;  2C2L A;  2M3H A;  2BAY A;  5TDR A;  4AP4 A;  2AN6 A;  2MD7 B;  2LQ6 A;  2YUR A;  3KV5 A;  3N9L A;  2MUM A;  3ZTG A;  3SOX A;  5LKU A;  3U5O A;  2LN0 A;  5B8D A;  4QF3 A;  2KWJ A;  3HCU A;  2KR4 A;  2G45 A;  3L11 A;  4WZ2 A;  1WE9 A;  3MHH A;  3N9N A;  5H1V A;  4R7E A;  3I2D A;  3O35 A;  2QJ0 A;  2CT2 A;  4ZQL A;  2EOD A;  2KWN A;  2JRJ A;  2HDP A;  4I7B A;  5LKT A;  1BOR A;  4WA6 A;  4R8P K;  4IC3 A;  4A0C D;  2MA6 A;  2L5U A;  2ECV A;  2K1J A;  5J3X A;  3U5M A;  3O7A A;  3VK6 A;  5TDW A;  4YBM A;  5EYA F;  3SHB A;  1CHC A;  5D1L B;  3M63 A;  4CA1 A;  5TAB A;  2EA6 A;  5I3L A;  4YAT A;  2FUI A;  4MSX A;  1WIL A;  2VJE A;  2E6R A;  2MNZ A;  1Z2Q A;  1WEQ A;  2KE1 A;  2XEU A;  4V3L C;  3T6R A;  1X4J A;  2M1R A;  4BBQ A;  2YSM A;  2FSA A;  2ECT A;  4AVX A;  5G04 B;  1JM7 A;  1F62 A;  4PTB A;  2K4D A;  5G05 B;  4ZUX U;  1WEV A;  3O70 A;  4ZDT A;  2YHO A;  4V3K C;  4R2Y A;  5B76 A;  2LV9 A;  2VPB A;  4I7C A;  4FIP A;  1Z6U A;  2L0B A;  4LLB A;  5JG6 A;  3SOU A;  4GND A;  2K17 A;  4GNG A;  3M62 A;  2NAA A;  2VJF B;  2PUY A;  2LGK A;  3ZVY A;  2VPE A;  3KV6 A;  3LRQ A;  5D1M B;  3DQV R;  3HCS A;  1VD4 A;  5D1K B;  1HYI A;  2HYE D;  2JMD A;  2Y1N A;  2LGG A;  1DVP A;  3N9P A;  4L7X A;  5FB1 A;  1HYJ A;  3L1Z B;  2YW8 A;  5H9M A;  1VYX A;  3U5N A;  2D8S A;  2K16 A;  2H0D A;  5H1T A;  2YHN A;  2XB1 A;  1RMD A;  1WGM A;  4A4B A;  1LDJ B;  4X3G A;  4N3W A;  2IDA A;  2KU3 A;  3IHP A;  4MVT A;  5AIT A;  2YYR A;  3U5P A;  1WEU A;  2VPG A;  4P5O B;  5LKX A;  3N9M A;  3T7L A;  3ZVZ B;  3EB6 A;  5C11 A;  2YUC A;  3NG2 A;  1WFK A;  1FBV A;  5LKZ A;  2C2V S;  3FL2 A;  1ZBD B;  2KGG A;  2CKL B;  1WIM A;  3O33 A;  2YQM A;  3ZPV E;  2YRE A;  1WES A;  1E4U A;  4PPE A;  5KH9 A;  3RTR B;  4IC2 A;  3PUQ A;  4WZ3 B;  2VPD A;  3EB5 A;  4UP0 A;  3GL6 A;  5KH3 A;  2FUU A;  3ASL A;  4S3O B;  4B7Y C;  4QF2 A;  2LXH C;  1Z60 A;  2M6M A;  1X4I A;  2DX8 A;  4Q6F A;  3C5K A;  4AUQ B;  2KIZ A;  2KGI A;  2Y43 A;  2I50 A;  2EGP A;  2KWK A;  1WEN A;  3ZYQ A;  4BHW A;  2ECN A;  3HCT A;  1N87 A;  4LAD B;  1U6G B;  1XWH A;  3L1X A;  2L75 A;  3KNV A;  2LXP C;  3V43 A;  1WEW A;  4TKP B;  4C9Z A;  2LGL A;  2F6N A;  4UI9 B;  3O37 A;  1WEM A;  1FP0 A;  2YSJ A;  2E6S A;  5DKA A;  2MIQ A;  4WZ0 A;  3HTK C;  1V87 A;  5LCW B;  3LQJ A;  5G0F A;  3KQI A;  2ECJ A;  3PUR A;  2VJE B;  3N9Q A;  2L80 A;  4LK9 A;  5B75 A;  2RI7 A;  4B86 C;  4FO9 A;  4A49 A;  4S3O C;  2KYU A;  5B79 A;  4CCG X;  4O64 A;  4YAD A;  4L58 A;  2PNX A;  4F52 B;  2QIC A;  2ECW A;  4XI1 A;  5FER A;  1IYM A;  4YC9 A;  5B77 A;  2VNF A;  1JM7 B;  4AYC A;  5B78 A;  2CSZ A;  1WEE A;  3RPG B;  3PHD A;  4A4C A;  2YU4 A; 
#chains in the Genus database with same CATH topology
 2MD8 C;  2MA5 A;  2M85 A;  2MNY A;  3LQI A;  4W4U A;  2ECI A;  4GNF A;  2G43 A;  2OWA A;  2YT5 A;  2LDR A;  2YQL A;  4Z0R A;  2MT5 A;  3FM8 C;  1K2F A;  5K3Q A;  3LVQ E;  2F42 A;  3QZV A;  5TBN A;  4LKA A;  2UZG A;  5H1U A;  3DPL R;  2KRE A;  3M99 A;  2VJF A;  4F1P A;  3O34 A;  4YAB A;  1WEP A;  2H0D B;  2B0O E;  2E61 A;  3MHS A;  5FB0 A;  2LRI C;  2YVR A;  3ZNI A;  4FK5 A;  4I7D A;  3SOW A;  5C13 A;  1JOC A;  3FJU B;  4UP5 A;  3LQH A;  2CSY A;  4N4F A;  2F6J A;  2QIZ A;  2L43 A;  3N9O A;  4FJC A;  4GNE A;  2KFT A;  4AYC B;  1G25 A;  2KWO A;  5FEY A;  4YBT A;  3GV4 A;  1LDK C;  1X4U A;  3Q1D A;  1WEO A;  2G6Q A;  4YBS A;  2ECG A;  2RSD A;  3O36 A;  3RPG C;  5DIN A;  2DJA A;  5AIU A;  4NN2 A;  2LGV A;  1MM2 A;  2JM3 A;  3C6W A;  2JMJ A;  1MM3 A;  2JMI A;  4LJN A;  1T1H A;  2DSM A;  5KH7 A;  2Y1M A;  2VP7 A;  4YAX A;  2CRW A;  3ZPV 1;  2ZET C;  5SVI A;  1VFY A;  4GB0 A;  3M7K A;  2OXQ C;  2CKL A;  5TRB A;  2C2L A;  2M3H A;  2CRR A;  2BAY A;  5TDR A;  1MBM A;  4AP4 A;  2AN6 A;  5SVX A;  2MD7 B;  2LQ6 A;  2YUR A;  3KV5 A;  3N9L A;  2MUM A;  2XOC A;  3ZTG A;  3SOX A;  5LKU A;  3U5O A;  2LN0 A;  5B8D A;  4QF3 A;  2FFW A;  2KWJ A;  3HCU A;  2KR4 A;  2G45 A;  3L11 A;  4WZ2 A;  1WE9 A;  3MHH A;  3N9N A;  5H1V A;  2CON A;  5SVY A;  4R7E A;  3I2D A;  3O35 A;  2QJ0 A;  2CT2 A;  4ZQL A;  2EOD A;  2KWN A;  2JRJ A;  3LJU X;  2HDP A;  4I7B A;  4O62 A;  2EXU A;  5LKT A;  1BOR A;  3DWD A;  4WA6 A;  3LVR E;  2IQJ A;  4OGC A;  4R8P K;  1DCQ A;  4IC3 A;  4A0C D;  2MA6 A;  2L5U A;  2ECV A;  2K1J A;  5J3X A;  3U5M A;  3O7A A;  3VK6 A;  5TDW A;  4YBM A;  5EYA F;  3SHB A;  1CHC A;  5D1L B;  3M63 A;  4CA1 A;  5TAB A;  2EA6 A;  5I3L A;  2M13 A;  4YAT A;  2FUI A;  4MSX A;  1WIL A;  3FEH A;  2CSV A;  2VJE A;  2XP0 A;  3T9K A;  2E6R A;  2MNZ A;  1Z2Q A;  1WEQ A;  2KE1 A;  2XEU A;  4V3L C;  3T6R A;  1X4J A;  2M1R A;  4BBQ A;  2XOY A;  2P57 A;  2YSM A;  2FSA A;  2ECT A;  2MKE A;  4AVX A;  5G04 B;  1JM7 A;  1F62 A;  4PTB A;  2K4D A;  5G05 B;  4ZUX U;  1WEV A;  3O70 A;  4ZDT A;  2YHO A;  4V3K C;  4R2Y A;  5B76 A;  4OGE A;  2LV9 A;  2VPB A;  4I7C A;  4FIP A;  1Z6U A;  2L0B A;  4LLB A;  5JG6 A;  4GND A;  3SOU A;  2K17 A;  3E2D A;  4GNG A;  3M62 A;  2NAA A;  2VJF B;  2PUY A;  2LGK A;  3ZVY A;  2VPE A;  3KV6 A;  3LRQ A;  5D1M B;  3DQV R;  3HCS A;  1VD4 A;  5D1K B;  2L7P A;  1HYI A;  2HYE D;  2JMD A;  2Y1N A;  2LGG A;  1DVP A;  3N9P A;  4L7X A;  5FB1 A;  2RR4 A;  1HYJ A;  3L1Z B;  2YW8 A;  5H9M A;  1VYX A;  3U5N A;  3PLW A;  2D8S A;  2K16 A;  2H0D A;  5H1T A;  2YHN A;  2XB1 A;  1RMD A;  1WGM A;  4A4B A;  1LDJ B;  4X3G A;  2XOZ A;  4N3W A;  2IDA A;  2KU3 A;  3IHP A;  4MVT A;  5AIT A;  2YYR A;  3U5P A;  1WEU A;  2VPG A;  4P5O B;  5LKX A;  3N9M A;  3T7L A;  2JUN A;  2LAU A;  4QQ4 A;  2D8U A;  3ZVZ B;  3H7H A;  3EB6 A;  5C11 A;  3MDB C;  2YUC A;  3NG2 A;  1WFK A;  1FBV A;  5LKZ A;  2C2V S;  3FL2 A;  5SVI B;  1ZBD B;  2KGG A;  2CKL B;  1WIM A;  3O33 A;  2YQM A;  3ZPV E;  2YRE A;  1WES A;  1E4U A;  4PPE A;  5KH9 A;  3RTR B;  4IC2 A;  3PUQ A;  4WZ3 B;  2VPD A;  3EB5 A;  4UP0 A;  3GL6 A;  3O47 A;  5KH3 A;  2FUU A;  3ASL A;  4S3O B;  4B7Y C;  4QF2 A;  2LXH C;  1Z60 A;  2M6M A;  3JUE A;  1X4I A;  2DX8 A;  4Q6F A;  3C5K A;  4AUQ B;  2KIZ A;  2KGI A;  2Y43 A;  2I50 A;  3FAN A;  3DDT A;  2EGP A;  2KWK A;  1WEN A;  3ZYQ A;  4BHW A;  2ECN A;  3HCT A;  1N87 A;  4Z0O A;  4LAD B;  1U6G B;  2KKY A;  1XWH A;  3L1X A;  2L75 A;  3KNV A;  2LXP C;  3KDE C;  3V43 A;  1WEW A;  3LDY A;  4TKP B;  4C9Z A;  2LGL A;  2F6N A;  3FAO A;  4UI9 B;  3O37 A;  1WEM A;  3SUB A;  1FP0 A;  2YSJ A;  2E6S A;  5DKA A;  2MIQ A;  4WZ0 A;  3HTK C;  1V87 A;  4H9D A;  5LCW B;  3LQJ A;  5G0F A;  3KQI A;  2ECJ A;  3PUR A;  2VJE B;  2FD4 A;  3N9Q A;  2L80 A;  4LK9 A;  5B75 A;  2RI7 A;  4B86 C;  4FO9 A;  4A49 A;  4S3O C;  2KYU A;  5B79 A;  4CCG X;  4O64 A;  4YAD A;  4L58 A;  2PNX A;  4F52 B;  2QIC A;  2ECW A;  2KKX A;  2EGM A;  4XI1 A;  5FER A;  1IYM A;  4YC9 A;  5B77 A;  2VNF A;  1JM7 B;  4AYC A;  5B78 A;  2CSZ A;  1WEE A;  3RPG B;  3PHD A;  4A4C A;  2YU4 A; 
#chains in the Genus database with same CATH homology
 2MD8 C;  2MA5 A;  2M85 A;  2MNY A;  3LQI A;  4W4U A;  2ECI A;  4GNF A;  2G43 A;  2YT5 A;  2LDR A;  2YQL A;  2MT5 A;  1K2F A;  2F42 A;  3QZV A;  5TBN A;  4LKA A;  2UZG A;  5H1U A;  3DPL R;  2KRE A;  3M99 A;  2VJF A;  3O34 A;  4YAB A;  1WEP A;  2H0D B;  5FB0 A;  3MHS A;  2LRI C;  3ZNI A;  4FK5 A;  4I7D A;  3SOW A;  5C13 A;  1JOC A;  4UP5 A;  3LQH A;  2CSY A;  4N4F A;  2F6J A;  2QIZ A;  2L43 A;  3N9O A;  4FJC A;  4GNE A;  2KFT A;  4AYC B;  1G25 A;  2KWO A;  5FEY A;  4YBT A;  3GV4 A;  1LDK C;  1X4U A;  1WEO A;  2G6Q A;  4YBS A;  2ECG A;  2RSD A;  3O36 A;  3RPG C;  5DIN A;  5AIU A;  4NN2 A;  2LGV A;  1MM2 A;  3C6W A;  2JMJ A;  1MM3 A;  2JMI A;  4LJN A;  1T1H A;  5KH7 A;  2Y1M A;  2VP7 A;  4YAX A;  3ZPV 1;  2ZET C;  1VFY A;  4GB0 A;  2OXQ C;  2CKL A;  5TRB A;  2C2L A;  2M3H A;  2BAY A;  5TDR A;  4AP4 A;  2AN6 A;  2MD7 B;  2LQ6 A;  2YUR A;  3KV5 A;  3N9L A;  2MUM A;  3ZTG A;  3SOX A;  5LKU A;  3U5O A;  2LN0 A;  5B8D A;  4QF3 A;  2KWJ A;  3HCU A;  2KR4 A;  2G45 A;  3L11 A;  4WZ2 A;  1WE9 A;  3MHH A;  3N9N A;  5H1V A;  4R7E A;  3I2D A;  3O35 A;  2QJ0 A;  2CT2 A;  4ZQL A;  2EOD A;  2KWN A;  2JRJ A;  2HDP A;  4I7B A;  5LKT A;  1BOR A;  4WA6 A;  4R8P K;  4IC3 A;  4A0C D;  2MA6 A;  2L5U A;  2ECV A;  2K1J A;  5J3X A;  3U5M A;  3O7A A;  3VK6 A;  5TDW A;  4YBM A;  5EYA F;  3SHB A;  1CHC A;  5D1L B;  3M63 A;  4CA1 A;  5TAB A;  2EA6 A;  5I3L A;  4YAT A;  2FUI A;  4MSX A;  1WIL A;  2VJE A;  2E6R A;  2MNZ A;  1Z2Q A;  1WEQ A;  2KE1 A;  2XEU A;  4V3L C;  3T6R A;  1X4J A;  2M1R A;  4BBQ A;  2YSM A;  2FSA A;  2ECT A;  4AVX A;  5G04 B;  1JM7 A;  1F62 A;  4PTB A;  2K4D A;  5G05 B;  4ZUX U;  1WEV A;  3O70 A;  4ZDT A;  2YHO A;  4V3K C;  4R2Y A;  5B76 A;  2LV9 A;  2VPB A;  4I7C A;  4FIP A;  1Z6U A;  2L0B A;  4LLB A;  5JG6 A;  3SOU A;  4GND A;  2K17 A;  4GNG A;  3M62 A;  2NAA A;  2VJF B;  2PUY A;  2LGK A;  3ZVY A;  2VPE A;  3KV6 A;  3LRQ A;  5D1M B;  3DQV R;  3HCS A;  1VD4 A;  5D1K B;  1HYI A;  2HYE D;  2JMD A;  2Y1N A;  2LGG A;  1DVP A;  3N9P A;  4L7X A;  5FB1 A;  1HYJ A;  3L1Z B;  2YW8 A;  5H9M A;  1VYX A;  3U5N A;  2D8S A;  2K16 A;  2H0D A;  5H1T A;  2YHN A;  2XB1 A;  1RMD A;  1WGM A;  4A4B A;  1LDJ B;  4X3G A;  4N3W A;  2IDA A;  2KU3 A;  3IHP A;  4MVT A;  5AIT A;  2YYR A;  3U5P A;  1WEU A;  2VPG A;  4P5O B;  5LKX A;  3N9M A;  3T7L A;  3ZVZ B;  3EB6 A;  5C11 A;  2YUC A;  3NG2 A;  1WFK A;  1FBV A;  5LKZ A;  2C2V S;  3FL2 A;  1ZBD B;  2KGG A;  2CKL B;  1WIM A;  3O33 A;  2YQM A;  3ZPV E;  2YRE A;  1WES A;  1E4U A;  4PPE A;  5KH9 A;  3RTR B;  4IC2 A;  3PUQ A;  4WZ3 B;  2VPD A;  3EB5 A;  4UP0 A;  3GL6 A;  5KH3 A;  2FUU A;  3ASL A;  4S3O B;  4B7Y C;  4QF2 A;  2LXH C;  1Z60 A;  2M6M A;  1X4I A;  2DX8 A;  4Q6F A;  3C5K A;  4AUQ B;  2KIZ A;  2KGI A;  2Y43 A;  2I50 A;  2EGP A;  2KWK A;  1WEN A;  3ZYQ A;  4BHW A;  2ECN A;  3HCT A;  1N87 A;  4LAD B;  1U6G B;  1XWH A;  3L1X A;  2L75 A;  3KNV A;  2LXP C;  3V43 A;  1WEW A;  4TKP B;  4C9Z A;  2LGL A;  2F6N A;  4UI9 B;  3O37 A;  1WEM A;  1FP0 A;  2YSJ A;  2E6S A;  5DKA A;  2MIQ A;  4WZ0 A;  3HTK C;  1V87 A;  5LCW B;  3LQJ A;  5G0F A;  3KQI A;  2ECJ A;  3PUR A;  2VJE B;  3N9Q A;  2L80 A;  4LK9 A;  5B75 A;  2RI7 A;  4B86 C;  4FO9 A;  4A49 A;  4S3O C;  2KYU A;  5B79 A;  4CCG X;  4O64 A;  4YAD A;  4L58 A;  2PNX A;  4F52 B;  2QIC A;  2ECW A;  4XI1 A;  5FER A;  1IYM A;  4YC9 A;  5B77 A;  2VNF A;  1JM7 B;  4AYC A;  5B78 A;  2CSZ A;  1WEE A;  3RPG B;  3PHD A;  4A4C A;  2YU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...