2XEUA

Ring domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
GAMVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING FINGER PROTEIN 4
publication title Mechanism of Ubiquitylation by Dimeric Ring Ligase Rnf4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2xeuA00
2MNYA 2ZETC 2LGKA 3KV6A 3IHPA 1WILA 1E4UA 2YHOA 4IC2A 3HTKC 3U5MA 1JOCA 5LKUA 2PUYA 4FJCA 2K1JA 2KYUA 1BORA 2YSMA 1VFYA 3O34A 4X3GA 3O37A 4V3KC 3C5KA 2NAAA 5B75A 2YQLA 1XWHA 4R8PK 1X4UA 4TKPB 1HYJA 4N3WA 5B79A 1MM3A 3ZVYA 2YYRA 2F6JA 5G0FA 4A49A 2JRJA 2L43A 5FB0A 4GB0A 1V87A 2JMIA 2E6RA 2YHNA 2CSZA 2Y1MA 3HCSA 2ECJA 3ASLA 4FO9A 2JMDA 2VJFB 4GNFA 2LXPC 2OXQC 1WE9A 4LK9A 2D8SA 2KR4A 4GNDA 3NG2A 4W4UA 1CHCA 3O70A 1WEPA 4Q6FA 4QF3A 1LDKC 2I50A 2XEUA 4AUQB 4YABA 2IDAA 2EA6A 1ZBDB 2CKLB 2QJ0A 4A4CA 5B78A 3KQIA 4WA6A 2VJEB 4YC9A 3T6RA 5TDWA 2LQ6A 5AIUA 2VJFA 4YATA 2M6MA 3EB5A 4S3OC 1WEMA 3HCUA 2LGVA 2M1RA 3I2DA 2KWJA 4N4FA 2MIQA 2LN0A 3U5NA 1WEUA 4L58A 2LDRA 4UP5A 1WEEA 2L75A 2YSJA 2FUUA 5AITA 3DQVR 2ECTA 2JMJA 5LKXA 5FERA 2H0DB 2RI7A 4UP0A 3T7LA 2YW8A 3VK6A 2CKLA 5G05B 3O7AA 2YURA 3SOWA 2VJEA 4CA1A 4FK5A 4YAXA 3EB6A 2EODA 5D1KB 2KGIA 1FP0A 3ZTGA 5H9MA 3C6WA 5KH9A 2VPEA 3ZYQA 3DPLR 2G43A 2Y43A 2CSYA 4UI9B 1JM7A 1WEWA 4A4BA 1VYXA 4YBTA 3ZPVE 4P5OB 2AN6A 2YT5A 3HCTA 1T1HA 2H0DA 3N9PA 4GNGA 4YBMA 1WESA 3M63A 1WGMA 4LLBA 2LV9A 1N87A 5KH3A 3LQJA 5JG6A 1DVPA 4ZQLA 2LGGA 4LKAA 3ZPV1 2KWOA 3O35A 4MSXA 2MD7B 3KV5A 5J3XA 3PUQA 2MD8C 4YBSA 4WZ0A 4PPEA 2L0BA 4AYCB 5LKTA 3L11A 1Z2QA 3MHHA 2G6QA 3PHDA 5G04B 2ECIA 3N9LA 1WEQA 2LRIC 3ZVZB 3N9QA 2K17A 1G25A 5B8DA 2UZGA 3L1ZB 4I7BA 5H1TA 3U5OA 1WFKA 1Z6UA 2LGLA 1WIMA 3QZVA 2YREA 4AVXA 5TRBA 2K16A 3RPGB 3MHSA 1LDJB 4I7DA 4FIPA 2EGPA 4C9ZA 5D1LB 5LCWB 2QICA 4YADA 4I7CA 3SHBA 2KE1A 3L1XA 2VPDA 4GNEA 4AYCA 4R2YA 3U5PA 1JM7B 2MA6A 5I3LA 2VNFA 2VP7A 3O36A 5LKZA 2YUCA 4XI1A 1U6GB 2E6SA 4B7YC 4CCGX 1HYIA 2L80A 5C13A 1X4IA 1F62A 3KNVA 4V3LC 5FEYA 2KWKA 2KU3A 2KREA 3ZNIA 2VPBA 1VD4A 2MNZA 2XB1A 4IC3A 1MM2A 4B86C 3N9OA 2K4DA 3GV4A 4MVTA 5FB1A 2ECNA 4L7XA 4AP4A 1K2FA 4F52B 4ZUXU 3RTRB 3PURA 2ECVA 2VPGA 1WEOA 3GL6A 2C2LA 3M99A 3M62A 2BAYA 2F42A 2MUMA 2KFTA 3N9NA 2G45A 5EYAF 3O33A 5TBNA 2L5UA 4S3OB 1IYMA 4A0CD 4PTBA 3RPGC 4BBQA 5B77A 2KIZA 2YQMA 5TABA 2F6NA 2FSAA 3SOXA 1WEVA 2QIZA 2ECGA 1FBVA 5H1UA 1RMDA 4WZ3B 2MA5A 5DKAA 3LQIA 2CT2A 5C11A 3FL2A 5H1VA 5TDRA 5B76A 2M3HA 3LQHA 4O64A 2FUIA 5D1MB 1WENA 4LADB 2MT5A 4QF2A 3V43A 5DINA 2YU4A 3LRQA 2HDPA 4BHWA 3SOUA 2Y1NA 4WZ2A 2M85A 2ECWA 2HYED 1Z60A 5KH7A 2C2VS 4ZDTA 3N9MA 1X4JA 2DX8A 4LJNA 2KWNA 4NN2A 2LXHC 2RSDA 2KGGA 4R7EA 2PNXA
chains in the Genus database with same CATH superfamily
2MNYA 2ZETC 2LGKA 3KV6A 4OGEA 2FD4A 3IHPA 1WILA 1E4UA 2YHOA 4IC2A 4QQ4A 3HTKC 3U5MA 1JOCA 4O62A 5LKUA 2PUYA 4FJCA 2K1JA 2KYUA 1BORA 2YSMA 1VFYA 2XOCA 2RR4A 2IQJA 3O34A 4X3GA 3O37A 3LDYA 4V3KC 3C5KA 2NAAA 5B75A 2YQLA 1XWHA 2YVRA 4R8PK 1X4UA 2E61A 4TKPB 1HYJA 4N3WA 5B79A 1MM3A 3ZVYA 2YYRA 2F6JA 2MKEA 5G0FA 4A49A 2JRJA 2L43A 5FB0A 4GB0A 1V87A 2JMIA 2E6RA 2YHNA 2CSZA 2Y1MA 3DWDA 2M13A 3HCSA 5SVYA 2ECJA 3ASLA 4FO9A 2JMDA 2VJFB 4GNFA 2LXPC 2OXQC 2LAUA 1WE9A 4LK9A 2D8SA 2KR4A 4GNDA 2P57A 3NG2A 4W4UA 1CHCA 2XP0A 2XOZA 3O70A 5SVIB 1WEPA 4Q6FA 3Q1DA 4QF3A 1DCQA 1LDKC 2I50A 2XEUA 4AUQB 4YABA 2IDAA 2EA6A 1ZBDB 2CKLB 2D8UA 2QJ0A 4A4CA 5B78A 3KQIA 4WA6A 2VJEB 4YC9A 2KKXA 4Z0OA 3T6RA 5TDWA 2LQ6A 5AIUA 2VJFA 4YATA 2M6MA 3EB5A 4S3OC 1WEMA 3HCUA 2LGVA 2M1RA 2XOYA 3I2DA 2KWJA 4N4FA 2MIQA 2LN0A 3U5NA 1WEUA 4L58A 2LDRA 4UP5A 1WEEA 5SVIA 2L75A 2YSJA 2FUUA 5AITA 3DQVR 2ECTA 2JMJA 5LKXA 5FERA 2H0DB 2RI7A 4UP0A 3T7LA 2YW8A 3VK6A 2CKLA 3E2DA 5G05B 3O7AA 2CONA 2YURA 3SOWA 2VJEA 4CA1A 4FK5A 4YAXA 3FAOA 3EB6A 2EODA 5D1KB 2KGIA 3LVRE 1FP0A 3ZTGA 5H9MA 2DJAA 3C6WA 5KH9A 2VPEA 3ZYQA 3DPLR 4H9DA 2G43A 2Y43A 2CSYA 3LVQE 4UI9B 1JM7A 1WEWA 4A4BA 1VYXA 4YBTA 3ZPVE 4P5OB 2AN6A 2YT5A 4OGCA 4GNGA 3HCTA 1T1HA 2H0DA 3N9PA 2JUNA 4YBMA 1WESA 3M63A 1WGMA 4LLBA 3O47A 2LV9A 1N87A 5KH3A 3LQJA 5JG6A 1DVPA 2B0OE 4ZQLA 2LGGA 4LKAA 2OWAA 3ZPV1 2KWOA 2JM3A 3O35A 4MSXA 2CRRA 2MD7B 3KV5A 5J3XA 2FFWA 3PUQA 2MD8C 4YBSA 4WZ0A 4PPEA 2EGMA 2L0BA 4AYCB 5LKTA 3L11A 1Z2QA 3MHHA 2G6QA 3PHDA 5G04B 2ECIA 3N9LA 1WEQA 2LRIC 3ZVZB 3M7KA 3DDTA 3N9QA 2K17A 1G25A 5B8DA 2UZGA 3L1ZB 4I7BA 5H1TA 3U5OA 1WFKA 1Z6UA 2LGLA 1WIMA 3H7HA 3QZVA 2YREA 4AVXA 5TRBA 2K16A 3RPGB 3MHSA 1LDJB 4I7DA 4FIPA 2EGPA 4C9ZA 2L7PA 5D1LB 5LCWB 2QICA 4YADA 4I7CA 3SHBA 2KE1A 3L1XA 2VPDA 4GNEA 4AYCA 4R2YA 3U5PA 1JM7B 2MA6A 5I3LA 2VNFA 2VP7A 3O36A 5LKZA 2YUCA 4XI1A 3FJUB 3MDBC 1U6GB 2E6SA 4B7YC 4CCGX 1HYIA 2L80A 5C13A 4F1PA 1X4IA 1F62A 4Z0RA 3KNVA 4V3LC 5FEYA 2KWKA 2KU3A 2CRWA 2KREA 3ZNIA 2VPBA 1VD4A 2MNZA 2XB1A 4IC3A 1MM2A 4B86C 3N9OA 2K4DA 2DSMA 3GV4A 4MVTA 5FB1A 2ECNA 4L7XA 4AP4A 1K2FA 4F52B 4ZUXU 2EXUA 3RTRB 3PURA 2ECVA 2VPGA 1WEOA 3GL6A 2C2LA 3M99A 3M62A 2BAYA 2F42A 2MUMA 2KFTA 2KKYA 3N9NA 3FANA 2G45A 5EYAF 3O33A 1MBMA 3FEHA 5TBNA 2L5UA 4S3OB 3SUBA 1IYMA 4A0CD 4PTBA 2CSVA 3RPGC 4BBQA 5B77A 2KIZA 2YQMA 5TABA 3KDEC 2F6NA 2FSAA 3SOXA 1WEVA 2QIZA 2ECGA 1FBVA 5H1UA 1RMDA 4WZ3B 2MA5A 5DKAA 3LQIA 2CT2A 5C11A 3FL2A 5K3QA 5H1VA 5TDRA 5B76A 2M3HA 3LQHA 3JUEA 4O64A 2FUIA 5D1MB 1WENA 4LADB 2MT5A 4QF2A 5SVXA 3V43A 5DINA 2YU4A 3LRQA 2HDPA 4BHWA 3LJUX 3SOUA 2Y1NA 3FM8C 4WZ2A 2M85A 2ECWA 2HYED 3PLWA 1Z60A 5KH7A 2C2VS 4ZDTA 3N9MA 1X4JA 3T9KA 2DX8A 4LJNA 2KWNA 4NN2A 2LXHC 2RSDA 2KGGA 4R7EA 2PNXA
chains in the Genus database with same CATH topology
2MNYA 2ZETC 2LGKA 3KV6A 3IHPA 1WILA 1E4UA 2YHOA 4IC2A 3HTKC 3U5MA 1JOCA 5LKUA 2PUYA 4FJCA 2K1JA 2KYUA 1BORA 2YSMA 1VFYA 3O34A 4X3GA 3O37A 4V3KC 3C5KA 2NAAA 5B75A 2YQLA 1XWHA 4R8PK 1X4UA 4TKPB 1HYJA 4N3WA 5B79A 1MM3A 3ZVYA 2YYRA 2F6JA 5G0FA 4A49A 2JRJA 2L43A 5FB0A 4GB0A 1V87A 2JMIA 2E6RA 2YHNA 2CSZA 2Y1MA 3HCSA 2ECJA 3ASLA 4FO9A 2JMDA 2VJFB 4GNFA 2LXPC 2OXQC 1WE9A 4LK9A 2D8SA 2KR4A 4GNDA 3NG2A 4W4UA 1CHCA 3O70A 1WEPA 4Q6FA 4QF3A 1LDKC 2I50A 2XEUA 4AUQB 4YABA 2IDAA 2EA6A 1ZBDB 2CKLB 2QJ0A 4A4CA 5B78A 3KQIA 4WA6A 2VJEB 4YC9A 3T6RA 5TDWA 2LQ6A 5AIUA 2VJFA 4YATA 2M6MA 3EB5A 4S3OC 1WEMA 3HCUA 2LGVA 2M1RA 3I2DA 2KWJA 4N4FA 2MIQA 2LN0A 3U5NA 1WEUA 4L58A 2LDRA 4UP5A 1WEEA 2L75A 2YSJA 2FUUA 5AITA 3DQVR 2ECTA 2JMJA 5LKXA 5FERA 2H0DB 2RI7A 4UP0A 3T7LA 2YW8A 3VK6A 2CKLA 5G05B 3O7AA 2YURA 3SOWA 2VJEA 4CA1A 4FK5A 4YAXA 3EB6A 2EODA 5D1KB 2KGIA 1FP0A 3ZTGA 5H9MA 3C6WA 5KH9A 2VPEA 3ZYQA 3DPLR 2G43A 2Y43A 2CSYA 4UI9B 1JM7A 1WEWA 4A4BA 1VYXA 4YBTA 3ZPVE 4P5OB 2AN6A 2YT5A 3HCTA 1T1HA 2H0DA 3N9PA 4GNGA 4YBMA 1WESA 3M63A 1WGMA 4LLBA 2LV9A 1N87A 5KH3A 3LQJA 5JG6A 1DVPA 4ZQLA 2LGGA 4LKAA 3ZPV1 2KWOA 3O35A 4MSXA 2MD7B 3KV5A 5J3XA 3PUQA 2MD8C 4YBSA 4WZ0A 4PPEA 2L0BA 4AYCB 5LKTA 3L11A 1Z2QA 3MHHA 2G6QA 3PHDA 5G04B 2ECIA 3N9LA 1WEQA 2LRIC 3ZVZB 3N9QA 2K17A 1G25A 5B8DA 2UZGA 3L1ZB 4I7BA 5H1TA 3U5OA 1WFKA 1Z6UA 2LGLA 1WIMA 3QZVA 2YREA 4AVXA 5TRBA 2K16A 3RPGB 3MHSA 1LDJB 4I7DA 4FIPA 2EGPA 4C9ZA 5D1LB 5LCWB 2QICA 4YADA 4I7CA 3SHBA 2KE1A 3L1XA 2VPDA 4GNEA 4AYCA 4R2YA 3U5PA 1JM7B 2MA6A 5I3LA 2VNFA 2VP7A 3O36A 5LKZA 2YUCA 4XI1A 1U6GB 2E6SA 4B7YC 4CCGX 1HYIA 2L80A 5C13A 1X4IA 1F62A 3KNVA 4V3LC 5FEYA 2KWKA 2KU3A 2KREA 3ZNIA 2VPBA 1VD4A 2MNZA 2XB1A 4IC3A 1MM2A 4B86C 3N9OA 2K4DA 3GV4A 4MVTA 5FB1A 2ECNA 4L7XA 4AP4A 1K2FA 4F52B 4ZUXU 3RTRB 3PURA 2ECVA 2VPGA 1WEOA 3GL6A 2C2LA 3M99A 3M62A 2BAYA 2F42A 2MUMA 2KFTA 3N9NA 2G45A 5EYAF 3O33A 5TBNA 2L5UA 4S3OB 1IYMA 4A0CD 4PTBA 3RPGC 4BBQA 5B77A 2KIZA 2YQMA 5TABA 2F6NA 2FSAA 3SOXA 1WEVA 2QIZA 2ECGA 1FBVA 5H1UA 1RMDA 4WZ3B 2MA5A 5DKAA 3LQIA 2CT2A 5C11A 3FL2A 5H1VA 5TDRA 5B76A 2M3HA 3LQHA 4O64A 2FUIA 5D1MB 1WENA 4LADB 2MT5A 4QF2A 3V43A 5DINA 2YU4A 3LRQA 2HDPA 4BHWA 3SOUA 2Y1NA 4WZ2A 2M85A 2ECWA 2HYED 1Z60A 5KH7A 2C2VS 4ZDTA 3N9MA 1X4JA 2DX8A 4LJNA 2KWNA 4NN2A 2LXHC 2RSDA 2KGGA 4R7EA 2PNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNY A;  2ZET C;  2LGK A;  3KV6 A;  3IHP A;  1WIL A;  1E4U A;  2YHO A;  4IC2 A;  3HTK C;  3U5M A;  1JOC A;  5LKU A;  2PUY A;  4FJC A;  2K1J A;  2KYU A;  1BOR A;  2YSM A;  1VFY A;  3O34 A;  4X3G A;  3O37 A;  4V3K C;  3C5K A;  2NAA A;  5B75 A;  2YQL A;  1XWH A;  4R8P K;  1X4U A;  4TKP B;  1HYJ A;  4N3W A;  5B79 A;  1MM3 A;  3ZVY A;  2YYR A;  2F6J A;  5G0F A;  4A49 A;  2JRJ A;  2L43 A;  5FB0 A;  4GB0 A;  1V87 A;  2JMI A;  2E6R A;  2YHN A;  2CSZ A;  2Y1M A;  3HCS A;  2ECJ A;  3ASL A;  4FO9 A;  2JMD A;  2VJF B;  4GNF A;  2LXP C;  2OXQ C;  1WE9 A;  4LK9 A;  2D8S A;  2KR4 A;  4GND A;  3NG2 A;  4W4U A;  1CHC A;  3O70 A;  1WEP A;  4Q6F A;  4QF3 A;  1LDK C;  2I50 A;  2XEU A;  4AUQ B;  4YAB A;  2IDA A;  2EA6 A;  1ZBD B;  2CKL B;  2QJ0 A;  4A4C A;  5B78 A;  3KQI A;  4WA6 A;  2VJE B;  4YC9 A;  3T6R A;  5TDW A;  2LQ6 A;  5AIU A;  2VJF A;  4YAT A;  2M6M A;  3EB5 A;  4S3O C;  1WEM A;  3HCU A;  2LGV A;  2M1R A;  3I2D A;  2KWJ A;  4N4F A;  2MIQ A;  2LN0 A;  3U5N A;  1WEU A;  4L58 A;  2LDR A;  4UP5 A;  1WEE A;  2L75 A;  2YSJ A;  2FUU A;  5AIT A;  3DQV R;  2ECT A;  2JMJ A;  5LKX A;  5FER A;  2H0D B;  2RI7 A;  4UP0 A;  3T7L A;  2YW8 A;  3VK6 A;  2CKL A;  5G05 B;  3O7A A;  2YUR A;  3SOW A;  2VJE A;  4CA1 A;  4FK5 A;  4YAX A;  3EB6 A;  2EOD A;  5D1K B;  2KGI A;  1FP0 A;  3ZTG A;  5H9M A;  3C6W A;  5KH9 A;  2VPE A;  3ZYQ A;  3DPL R;  2G43 A;  2Y43 A;  2CSY A;  4UI9 B;  1JM7 A;  1WEW A;  4A4B A;  1VYX A;  4YBT A;  3ZPV E;  4P5O B;  2AN6 A;  2YT5 A;  3HCT A;  1T1H A;  2H0D A;  3N9P A;  4GNG A;  4YBM A;  1WES A;  3M63 A;  1WGM A;  4LLB A;  2LV9 A;  1N87 A;  5KH3 A;  3LQJ A;  5JG6 A;  1DVP A;  4ZQL A;  2LGG A;  4LKA A;  3ZPV 1;  2KWO A;  3O35 A;  4MSX A;  2MD7 B;  3KV5 A;  5J3X A;  3PUQ A;  2MD8 C;  4YBS A;  4WZ0 A;  4PPE A;  2L0B A;  4AYC B;  5LKT A;  3L11 A;  1Z2Q A;  3MHH A;  2G6Q A;  3PHD A;  5G04 B;  2ECI A;  3N9L A;  1WEQ A;  2LRI C;  3ZVZ B;  3N9Q A;  2K17 A;  1G25 A;  5B8D A;  2UZG A;  3L1Z B;  4I7B A;  5H1T A;  3U5O A;  1WFK A;  1Z6U A;  2LGL A;  1WIM A;  3QZV A;  2YRE A;  4AVX A;  5TRB A;  2K16 A;  3RPG B;  3MHS A;  1LDJ B;  4I7D A;  4FIP A;  2EGP A;  4C9Z A;  5D1L B;  5LCW B;  2QIC A;  4YAD A;  4I7C A;  3SHB A;  2KE1 A;  3L1X A;  2VPD A;  4GNE A;  4AYC A;  4R2Y A;  3U5P A;  1JM7 B;  2MA6 A;  5I3L A;  2VNF A;  2VP7 A;  3O36 A;  5LKZ A;  2YUC A;  4XI1 A;  1U6G B;  2E6S A;  4B7Y C;  4CCG X;  1HYI A;  2L80 A;  5C13 A;  1X4I A;  1F62 A;  3KNV A;  4V3L C;  5FEY A;  2KWK A;  2KU3 A;  2KRE A;  3ZNI A;  2VPB A;  1VD4 A;  2MNZ A;  2XB1 A;  4IC3 A;  1MM2 A;  4B86 C;  3N9O A;  2K4D A;  3GV4 A;  4MVT A;  5FB1 A;  2ECN A;  4L7X A;  4AP4 A;  1K2F A;  4F52 B;  4ZUX U;  3RTR B;  3PUR A;  2ECV A;  2VPG A;  1WEO A;  3GL6 A;  2C2L A;  3M99 A;  3M62 A;  2BAY A;  2F42 A;  2MUM A;  2KFT A;  3N9N A;  2G45 A;  5EYA F;  3O33 A;  5TBN A;  2L5U A;  4S3O B;  1IYM A;  4A0C D;  4PTB A;  3RPG C;  4BBQ A;  5B77 A;  2KIZ A;  2YQM A;  5TAB A;  2F6N A;  2FSA A;  3SOX A;  1WEV A;  2QIZ A;  2ECG A;  1FBV A;  5H1U A;  1RMD A;  4WZ3 B;  2MA5 A;  5DKA A;  3LQI A;  2CT2 A;  5C11 A;  3FL2 A;  5H1V A;  5TDR A;  5B76 A;  2M3H A;  3LQH A;  4O64 A;  2FUI A;  5D1M B;  1WEN A;  4LAD B;  2MT5 A;  4QF2 A;  3V43 A;  5DIN A;  2YU4 A;  3LRQ A;  2HDP A;  4BHW A;  3SOU A;  2Y1N A;  4WZ2 A;  2M85 A;  2ECW A;  2HYE D;  1Z60 A;  5KH7 A;  2C2V S;  4ZDT A;  3N9M A;  1X4J A;  2DX8 A;  4LJN A;  2KWN A;  4NN2 A;  2LXH C;  2RSD A;  2KGG A;  4R7E A;  2PNX A; 
#chains in the Genus database with same CATH topology
 2MNY A;  2ZET C;  2LGK A;  3KV6 A;  4OGE A;  2FD4 A;  3IHP A;  1WIL A;  1E4U A;  2YHO A;  4IC2 A;  4QQ4 A;  3HTK C;  3U5M A;  1JOC A;  4O62 A;  5LKU A;  2PUY A;  4FJC A;  2K1J A;  2KYU A;  1BOR A;  2YSM A;  1VFY A;  2XOC A;  2RR4 A;  2IQJ A;  3O34 A;  4X3G A;  3O37 A;  3LDY A;  4V3K C;  3C5K A;  2NAA A;  5B75 A;  2YQL A;  1XWH A;  2YVR A;  4R8P K;  1X4U A;  2E61 A;  4TKP B;  1HYJ A;  4N3W A;  5B79 A;  1MM3 A;  3ZVY A;  2YYR A;  2F6J A;  2MKE A;  5G0F A;  4A49 A;  2JRJ A;  2L43 A;  5FB0 A;  4GB0 A;  1V87 A;  2JMI A;  2E6R A;  2YHN A;  2CSZ A;  2Y1M A;  3DWD A;  2M13 A;  3HCS A;  5SVY A;  2ECJ A;  3ASL A;  4FO9 A;  2JMD A;  2VJF B;  4GNF A;  2LXP C;  2OXQ C;  2LAU A;  1WE9 A;  4LK9 A;  2D8S A;  2KR4 A;  4GND A;  2P57 A;  3NG2 A;  4W4U A;  1CHC A;  2XP0 A;  2XOZ A;  3O70 A;  5SVI B;  1WEP A;  4Q6F A;  3Q1D A;  4QF3 A;  1DCQ A;  1LDK C;  2I50 A;  2XEU A;  4AUQ B;  4YAB A;  2IDA A;  2EA6 A;  1ZBD B;  2CKL B;  2D8U A;  2QJ0 A;  4A4C A;  5B78 A;  3KQI A;  4WA6 A;  2VJE B;  4YC9 A;  2KKX A;  4Z0O A;  3T6R A;  5TDW A;  2LQ6 A;  5AIU A;  2VJF A;  4YAT A;  2M6M A;  3EB5 A;  4S3O C;  1WEM A;  3HCU A;  2LGV A;  2M1R A;  2XOY A;  3I2D A;  2KWJ A;  4N4F A;  2MIQ A;  2LN0 A;  3U5N A;  1WEU A;  4L58 A;  2LDR A;  4UP5 A;  1WEE A;  5SVI A;  2L75 A;  2YSJ A;  2FUU A;  5AIT A;  3DQV R;  2ECT A;  2JMJ A;  5LKX A;  5FER A;  2H0D B;  2RI7 A;  4UP0 A;  3T7L A;  2YW8 A;  3VK6 A;  2CKL A;  3E2D A;  5G05 B;  3O7A A;  2CON A;  2YUR A;  3SOW A;  2VJE A;  4CA1 A;  4FK5 A;  4YAX A;  3FAO A;  3EB6 A;  2EOD A;  5D1K B;  2KGI A;  3LVR E;  1FP0 A;  3ZTG A;  5H9M A;  2DJA A;  3C6W A;  5KH9 A;  2VPE A;  3ZYQ A;  3DPL R;  4H9D A;  2G43 A;  2Y43 A;  2CSY A;  3LVQ E;  4UI9 B;  1JM7 A;  1WEW A;  4A4B A;  1VYX A;  4YBT A;  3ZPV E;  4P5O B;  2AN6 A;  2YT5 A;  4OGC A;  4GNG A;  3HCT A;  1T1H A;  2H0D A;  3N9P A;  2JUN A;  4YBM A;  1WES A;  3M63 A;  1WGM A;  4LLB A;  3O47 A;  2LV9 A;  1N87 A;  5KH3 A;  3LQJ A;  5JG6 A;  1DVP A;  2B0O E;  4ZQL A;  2LGG A;  4LKA A;  2OWA A;  3ZPV 1;  2KWO A;  2JM3 A;  3O35 A;  4MSX A;  2CRR A;  2MD7 B;  3KV5 A;  5J3X A;  2FFW A;  3PUQ A;  2MD8 C;  4YBS A;  4WZ0 A;  4PPE A;  2EGM A;  2L0B A;  4AYC B;  5LKT A;  3L11 A;  1Z2Q A;  3MHH A;  2G6Q A;  3PHD A;  5G04 B;  2ECI A;  3N9L A;  1WEQ A;  2LRI C;  3ZVZ B;  3M7K A;  3DDT A;  3N9Q A;  2K17 A;  1G25 A;  5B8D A;  2UZG A;  3L1Z B;  4I7B A;  5H1T A;  3U5O A;  1WFK A;  1Z6U A;  2LGL A;  1WIM A;  3H7H A;  3QZV A;  2YRE A;  4AVX A;  5TRB A;  2K16 A;  3RPG B;  3MHS A;  1LDJ B;  4I7D A;  4FIP A;  2EGP A;  4C9Z A;  2L7P A;  5D1L B;  5LCW B;  2QIC A;  4YAD A;  4I7C A;  3SHB A;  2KE1 A;  3L1X A;  2VPD A;  4GNE A;  4AYC A;  4R2Y A;  3U5P A;  1JM7 B;  2MA6 A;  5I3L A;  2VNF A;  2VP7 A;  3O36 A;  5LKZ A;  2YUC A;  4XI1 A;  3FJU B;  3MDB C;  1U6G B;  2E6S A;  4B7Y C;  4CCG X;  1HYI A;  2L80 A;  5C13 A;  4F1P A;  1X4I A;  1F62 A;  4Z0R A;  3KNV A;  4V3L C;  5FEY A;  2KWK A;  2KU3 A;  2CRW A;  2KRE A;  3ZNI A;  2VPB A;  1VD4 A;  2MNZ A;  2XB1 A;  4IC3 A;  1MM2 A;  4B86 C;  3N9O A;  2K4D A;  2DSM A;  3GV4 A;  4MVT A;  5FB1 A;  2ECN A;  4L7X A;  4AP4 A;  1K2F A;  4F52 B;  4ZUX U;  2EXU A;  3RTR B;  3PUR A;  2ECV A;  2VPG A;  1WEO A;  3GL6 A;  2C2L A;  3M99 A;  3M62 A;  2BAY A;  2F42 A;  2MUM A;  2KFT A;  2KKY A;  3N9N A;  3FAN A;  2G45 A;  5EYA F;  3O33 A;  1MBM A;  3FEH A;  5TBN A;  2L5U A;  4S3O B;  3SUB A;  1IYM A;  4A0C D;  4PTB A;  2CSV A;  3RPG C;  4BBQ A;  5B77 A;  2KIZ A;  2YQM A;  5TAB A;  3KDE C;  2F6N A;  2FSA A;  3SOX A;  1WEV A;  2QIZ A;  2ECG A;  1FBV A;  5H1U A;  1RMD A;  4WZ3 B;  2MA5 A;  5DKA A;  3LQI A;  2CT2 A;  5C11 A;  3FL2 A;  5K3Q A;  5H1V A;  5TDR A;  5B76 A;  2M3H A;  3LQH A;  3JUE A;  4O64 A;  2FUI A;  5D1M B;  1WEN A;  4LAD B;  2MT5 A;  4QF2 A;  5SVX A;  3V43 A;  5DIN A;  2YU4 A;  3LRQ A;  2HDP A;  4BHW A;  3LJU X;  3SOU A;  2Y1N A;  3FM8 C;  4WZ2 A;  2M85 A;  2ECW A;  2HYE D;  3PLW A;  1Z60 A;  5KH7 A;  2C2V S;  4ZDT A;  3N9M A;  1X4J A;  3T9K A;  2DX8 A;  4LJN A;  2KWN A;  4NN2 A;  2LXH C;  2RSD A;  2KGG A;  4R7E A;  2PNX A; 
#chains in the Genus database with same CATH homology
 2MNY A;  2ZET C;  2LGK A;  3KV6 A;  3IHP A;  1WIL A;  1E4U A;  2YHO A;  4IC2 A;  3HTK C;  3U5M A;  1JOC A;  5LKU A;  2PUY A;  4FJC A;  2K1J A;  2KYU A;  1BOR A;  2YSM A;  1VFY A;  3O34 A;  4X3G A;  3O37 A;  4V3K C;  3C5K A;  2NAA A;  5B75 A;  2YQL A;  1XWH A;  4R8P K;  1X4U A;  4TKP B;  1HYJ A;  4N3W A;  5B79 A;  1MM3 A;  3ZVY A;  2YYR A;  2F6J A;  5G0F A;  4A49 A;  2JRJ A;  2L43 A;  5FB0 A;  4GB0 A;  1V87 A;  2JMI A;  2E6R A;  2YHN A;  2CSZ A;  2Y1M A;  3HCS A;  2ECJ A;  3ASL A;  4FO9 A;  2JMD A;  2VJF B;  4GNF A;  2LXP C;  2OXQ C;  1WE9 A;  4LK9 A;  2D8S A;  2KR4 A;  4GND A;  3NG2 A;  4W4U A;  1CHC A;  3O70 A;  1WEP A;  4Q6F A;  4QF3 A;  1LDK C;  2I50 A;  2XEU A;  4AUQ B;  4YAB A;  2IDA A;  2EA6 A;  1ZBD B;  2CKL B;  2QJ0 A;  4A4C A;  5B78 A;  3KQI A;  4WA6 A;  2VJE B;  4YC9 A;  3T6R A;  5TDW A;  2LQ6 A;  5AIU A;  2VJF A;  4YAT A;  2M6M A;  3EB5 A;  4S3O C;  1WEM A;  3HCU A;  2LGV A;  2M1R A;  3I2D A;  2KWJ A;  4N4F A;  2MIQ A;  2LN0 A;  3U5N A;  1WEU A;  4L58 A;  2LDR A;  4UP5 A;  1WEE A;  2L75 A;  2YSJ A;  2FUU A;  5AIT A;  3DQV R;  2ECT A;  2JMJ A;  5LKX A;  5FER A;  2H0D B;  2RI7 A;  4UP0 A;  3T7L A;  2YW8 A;  3VK6 A;  2CKL A;  5G05 B;  3O7A A;  2YUR A;  3SOW A;  2VJE A;  4CA1 A;  4FK5 A;  4YAX A;  3EB6 A;  2EOD A;  5D1K B;  2KGI A;  1FP0 A;  3ZTG A;  5H9M A;  3C6W A;  5KH9 A;  2VPE A;  3ZYQ A;  3DPL R;  2G43 A;  2Y43 A;  2CSY A;  4UI9 B;  1JM7 A;  1WEW A;  4A4B A;  1VYX A;  4YBT A;  3ZPV E;  4P5O B;  2AN6 A;  2YT5 A;  3HCT A;  1T1H A;  2H0D A;  3N9P A;  4GNG A;  4YBM A;  1WES A;  3M63 A;  1WGM A;  4LLB A;  2LV9 A;  1N87 A;  5KH3 A;  3LQJ A;  5JG6 A;  1DVP A;  4ZQL A;  2LGG A;  4LKA A;  3ZPV 1;  2KWO A;  3O35 A;  4MSX A;  2MD7 B;  3KV5 A;  5J3X A;  3PUQ A;  2MD8 C;  4YBS A;  4WZ0 A;  4PPE A;  2L0B A;  4AYC B;  5LKT A;  3L11 A;  1Z2Q A;  3MHH A;  2G6Q A;  3PHD A;  5G04 B;  2ECI A;  3N9L A;  1WEQ A;  2LRI C;  3ZVZ B;  3N9Q A;  2K17 A;  1G25 A;  5B8D A;  2UZG A;  3L1Z B;  4I7B A;  5H1T A;  3U5O A;  1WFK A;  1Z6U A;  2LGL A;  1WIM A;  3QZV A;  2YRE A;  4AVX A;  5TRB A;  2K16 A;  3RPG B;  3MHS A;  1LDJ B;  4I7D A;  4FIP A;  2EGP A;  4C9Z A;  5D1L B;  5LCW B;  2QIC A;  4YAD A;  4I7C A;  3SHB A;  2KE1 A;  3L1X A;  2VPD A;  4GNE A;  4AYC A;  4R2Y A;  3U5P A;  1JM7 B;  2MA6 A;  5I3L A;  2VNF A;  2VP7 A;  3O36 A;  5LKZ A;  2YUC A;  4XI1 A;  1U6G B;  2E6S A;  4B7Y C;  4CCG X;  1HYI A;  2L80 A;  5C13 A;  1X4I A;  1F62 A;  3KNV A;  4V3L C;  5FEY A;  2KWK A;  2KU3 A;  2KRE A;  3ZNI A;  2VPB A;  1VD4 A;  2MNZ A;  2XB1 A;  4IC3 A;  1MM2 A;  4B86 C;  3N9O A;  2K4D A;  3GV4 A;  4MVT A;  5FB1 A;  2ECN A;  4L7X A;  4AP4 A;  1K2F A;  4F52 B;  4ZUX U;  3RTR B;  3PUR A;  2ECV A;  2VPG A;  1WEO A;  3GL6 A;  2C2L A;  3M99 A;  3M62 A;  2BAY A;  2F42 A;  2MUM A;  2KFT A;  3N9N A;  2G45 A;  5EYA F;  3O33 A;  5TBN A;  2L5U A;  4S3O B;  1IYM A;  4A0C D;  4PTB A;  3RPG C;  4BBQ A;  5B77 A;  2KIZ A;  2YQM A;  5TAB A;  2F6N A;  2FSA A;  3SOX A;  1WEV A;  2QIZ A;  2ECG A;  1FBV A;  5H1U A;  1RMD A;  4WZ3 B;  2MA5 A;  5DKA A;  3LQI A;  2CT2 A;  5C11 A;  3FL2 A;  5H1V A;  5TDR A;  5B76 A;  2M3H A;  3LQH A;  4O64 A;  2FUI A;  5D1M B;  1WEN A;  4LAD B;  2MT5 A;  4QF2 A;  3V43 A;  5DIN A;  2YU4 A;  3LRQ A;  2HDP A;  4BHW A;  3SOU A;  2Y1N A;  4WZ2 A;  2M85 A;  2ECW A;  2HYE D;  1Z60 A;  5KH7 A;  2C2V S;  4ZDT A;  3N9M A;  1X4J A;  2DX8 A;  4LJN A;  2KWN A;  4NN2 A;  2LXH C;  2RSD A;  2KGG A;  4R7E A;  2PNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...