4LKAA

Crystal structure of moz double phd finger histone h3k9ac complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
total genus 28
structure length 126
sequence length 126
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4lkaA00
2FUIA 2CKLA 3EB5A 3U5OA 2ECNA 4FIPA 2MD8C 2LN0A 5B78A 1X4JA 3L1ZB 2YHNA 1VYXA 4LADB 4YBTA 3LRQA 4IC2A 2Y43A 4I7BA 3RTRB 1WEQA 2DX8A 3N9LA 2QJ0A 1T1HA 2L75A 4N3WA 4L58A 2JMIA 4A0CD 3VK6A 4ZUXU 2VPGA 2JRJA 1DVPA 5C13A 3SOWA 2CSZA 3L1XA 1LDJB 3V43A 2YHOA 2KWKA 3L11A 4B86C 4R2YA 2KIZA 5TDRA 3N9PA 2KWJA 5LCWB 1Z60A 4S3OC 3C5KA 2MD7B 2M6MA 4FK5A 3KV5A 3MHHA 1LDKC 4UP5A 2LV9A 5AITA 4UP0A 2FUUA 4QF2A 3ZYQA 2VJEA 3LQHA 5C11A 4PPEA 3U5MA 4B7YC 5B8DA 1E4UA 1MM3A 5B76A 4AVXA 3ZTGA 5KH3A 4W4UA 3ZPVE 2QIZA 3QZVA 1RMDA 4C9ZA 3KNVA 2H0DA 2F6NA 4LK9A 5J3XA 4WA6A 4GNFA 4V3LC 5FB1A 4NN2A 3RPGC 2YURA 1WILA 4FJCA 5H9MA 2MNYA 2CKLB 2ZETC 2I50A 2FSAA 2KYUA 3ZVZB 2MA6A 1WEVA 2MA5A 2K17A 5I3LA 3ZVYA 2C2VS 5G04B 4LKAA 3HCSA 5LKZA 3SOUA 2HYED 2H0DB 3EB6A 4BBQA 4ZQLA 2CSYA 2VPDA 5JG6A 1FBVA 2ECGA 5B79A 5H1VA 1Z6UA 2MIQA 2JMDA 4X3GA 1HYIA 1V87A 2LQ6A 3DPLR 4O64A 4I7DA 5LKXA 1JM7A 5AIUA 4YC9A 2EODA 4YADA 3O70A 2L0BA 4YATA 3M63A 5H1UA 2HDPA 3M99A 2D8SA 1WENA 2Y1NA 4S3OB 4R8PK 2PUYA 2LGKA 1WEMA 3GV4A 5FEYA 4IC3A 2MT5A 2UZGA 4CA1A 2MNZA 3ZPV1 2CT2A 3MHSA 2JMJA 4V3KC 3T7LA 3DQVR 3O33A 5TDWA 2VP7A 2NAAA 2E6RA 3HCUA 5LKTA 2K1JA 2YQLA 2VJFA 3N9OA 3PUQA 1WEUA 1JM7B 5D1KB 4LJNA 1WEEA 4A4BA 3ASLA 3PHDA 4A4CA 3SOXA 2LRIC 1WEOA 4AYCA 4A49A 2YREA 3O7AA 1ZBDB 1X4IA 3KQIA 2YU4A 2KGGA 2RSDA 1HYJA 1IYMA 2E6SA 2F6JA 3RPGB 5B77A 2YUCA 1WE9A 1WFKA 2PNXA 2ECJA 2VJFB 2VJEB 2LGGA 1F62A 2VPBA 2L5UA 3O35A 2YSJA 3M62A 2L43A 2K16A 1WIMA 3N9MA 4LLBA 3T6RA 2LXPC 2KWNA 4GNGA 2M3HA 4WZ2A 3U5NA 5G05B 4QF3A 2YSMA 2G45A 5G0FA 2KE1A 4L7XA 1MM2A 5FERA 2KREA 5B75A 1WESA 5TBNA 3SHBA 3N9NA 2XEUA 3PURA 2C2LA 2RI7A 2ECVA 4MSXA 5LKUA 1WEWA 1XWHA 2XB1A 5D1MB 2KR4A 5D1LB 2YW8A 2VPEA 4F52B 3U5PA 5TRBA 3O34A 1CHCA 2LDRA 2LGVA 4YAXA 1BORA 3LQIA 4GNEA 2KGIA 5H1TA 5EYAF 2L80A 1FP0A 4CCGX 1WGMA 2KFTA 2MUMA 5TABA 1G25A 3LQJA 2ECWA 5KH7A 4WZ3B 2VNFA 3ZNIA 3O37A 3HTKC 3FL2A 4TKPB 4YBMA 1VFYA 2F42A 4FO9A 2M1RA 2YT5A 4GB0A 3N9QA 4P5OB 2KWOA 3NG2A 3HCTA 4YBSA 4Q6FA 1VD4A 4XI1A 2ECTA 2G6QA 1JOCA 4WZ0A 2YYRA 5FB0A 1Z2QA 1X4UA 5DINA 2KU3A 3O36A 4I7CA 2IDAA 2LGLA 1WEPA 3KV6A 2EA6A 4ZDTA 2M85A 1N87A 2G43A 5KH9A 4AUQB 4N4FA 4R7EA 2QICA 2OXQC 1U6GB 4BHWA 2Y1MA 4UI9B 2K4DA 3I2DA 3C6WA 4MVTA 5DKAA 4YABA 2YQMA 3IHPA 2AN6A 2EGPA 2LXHC 4PTBA 4AYCB 2ECIA 1K2FA 2BAYA 4AP4A 3GL6A 4GNDA
chains in the Genus database with same CATH superfamily
3SUBA 2FUIA 2CKLA 3EB5A 3U5OA 4OGEA 2ECNA 4FIPA 2MD8C 2LN0A 2LAUA 5B78A 4Z0OA 1X4JA 3L1ZB 2YHNA 1VYXA 4LADB 4YBTA 3LRQA 3E2DA 4IC2A 2Y43A 4I7BA 3RTRB 1WEQA 2DX8A 3N9LA 2QJ0A 1T1HA 2L75A 4N3WA 4L58A 2JMIA 4A0CD 3VK6A 4ZUXU 2VPGA 2JRJA 1DVPA 5C13A 3SOWA 3LVQE 2CSZA 3L1XA 1LDJB 3V43A 2YHOA 2KWKA 3L11A 4B86C 4R2YA 2KIZA 3Q1DA 5TDRA 3N9PA 2KWJA 5LCWB 1Z60A 4S3OC 3C5KA 2MD7B 2M6MA 3LDYA 4FK5A 3KV5A 2E61A 3MHHA 3T9KA 1LDKC 4UP5A 2LV9A 5AITA 4UP0A 2FUUA 4QF2A 3ZYQA 2VJEA 4H9DA 3LQHA 5C11A 4PPEA 3U5MA 4B7YC 3H7HA 5B8DA 3FAOA 1E4UA 2DSMA 3M7KA 1MM3A 5B76A 3PLWA 4AVXA 3ZTGA 5KH3A 4W4UA 3ZPVE 2FD4A 2CONA 2QIZA 3QZVA 1RMDA 4C9ZA 3DDTA 3KNVA 2DJAA 2H0DA 2F6NA 4LK9A 5J3XA 4WA6A 4GNFA 4V3LC 5FB1A 4NN2A 3RPGC 2YURA 1WILA 2XP0A 2L7PA 4FJCA 5H9MA 2MNYA 2CKLB 2ZETC 2I50A 2FSAA 2KYUA 3FEHA 3ZVZB 2MA6A 1WEVA 2MA5A 2RR4A 2K17A 1DCQA 5I3LA 3ZVYA 2C2VS 5G04B 4LKAA 3HCSA 5LKZA 3SOUA 2HYED 2H0DB 3EB6A 4BBQA 4ZQLA 2CSYA 2VPDA 5JG6A 1FBVA 2ECGA 5B79A 2P57A 5H1VA 1Z6UA 2MIQA 2JMDA 2D8UA 4X3GA 1HYIA 1V87A 2LQ6A 3DPLR 4O64A 4I7DA 5LKXA 1JM7A 4OGCA 5AIUA 2XOCA 2XOZA 3DWDA 4YC9A 2EODA 2YVRA 4YADA 3O70A 2L0BA 4YATA 3M63A 2IQJA 5H1UA 2HDPA 2JM3A 3M99A 2D8SA 1MBMA 1WENA 2XOYA 2Y1NA 4QQ4A 2MKEA 4S3OB 4R8PK 2M13A 2PUYA 2LGKA 1WEMA 3GV4A 5FEYA 4IC3A 2MT5A 2UZGA 4CA1A 2MNZA 3ZPV1 2CT2A 5SVXA 3MHSA 2JMJA 4V3KC 3T7LA 3DQVR 3O33A 5TDWA 2VP7A 2NAAA 2E6RA 2KKXA 3HCUA 5LKTA 2K1JA 2YQLA 2VJFA 3N9OA 3PUQA 1WEUA 1JM7B 5D1KB 4LJNA 1WEEA 4A4BA 3ASLA 3PHDA 4A4CA 5K3QA 3SOXA 2LRIC 1WEOA 4AYCA 4A49A 2YREA 3O7AA 1ZBDB 3KDEC 1X4IA 3KQIA 2YU4A 2KGGA 2RSDA 1HYJA 1IYMA 2E6SA 2F6JA 3RPGB 5B77A 3FANA 2YUCA 1WE9A 5SVIA 1WFKA 2PNXA 2ECJA 2VJFB 2VJEB 2LGGA 1F62A 2VPBA 2L5UA 3LVRE 3O35A 2YSJA 3M62A 2L43A 2K16A 1WIMA 3N9MA 4LLBA 3T6RA 2LXPC 5SVIB 2B0OE 2CSVA 2KWNA 4GNGA 2M3HA 4WZ2A 3U5NA 5G05B 4QF3A 2YSMA 2G45A 5G0FA 4O62A 2KE1A 3O47A 4L7XA 4F1PA 1MM2A 2CRRA 5FERA 2KREA 5B75A 1WESA 5TBNA 3SHBA 3N9NA 2XEUA 3PURA 2C2LA 2RI7A 2ECVA 4MSXA 5LKUA 1WEWA 1XWHA 2XB1A 5D1MB 2KR4A 5D1LB 2YW8A 3JUEA 2VPEA 4F52B 3U5PA 5TRBA 3O34A 1CHCA 2LDRA 2LGVA 4YAXA 1BORA 3LQIA 4GNEA 2KGIA 5H1TA 3FJUB 5EYAF 2KKYA 2L80A 1FP0A 4CCGX 1WGMA 2KFTA 2MUMA 5TABA 1G25A 3LQJA 2ECWA 5KH7A 4WZ3B 2VNFA 3ZNIA 2FFWA 3O37A 2OWAA 3HTKC 3FL2A 4TKPB 4YBMA 1VFYA 2F42A 4FO9A 2M1RA 2YT5A 4GB0A 3N9QA 4P5OB 2KWOA 3NG2A 3HCTA 3FM8C 4YBSA 3MDBC 4Q6FA 1VD4A 2EXUA 4XI1A 2ECTA 2G6QA 1JOCA 4WZ0A 2YYRA 5FB0A 1Z2QA 1X4UA 5DINA 2KU3A 5SVYA 3O36A 4I7CA 2IDAA 3LJUX 2LGLA 1WEPA 3KV6A 2EA6A 4ZDTA 2M85A 1N87A 2G43A 2EGMA 2JUNA 5KH9A 4AUQB 4N4FA 4R7EA 2QICA 2OXQC 1U6GB 4BHWA 2Y1MA 4UI9B 2K4DA 3I2DA 3C6WA 4MVTA 5DKAA 4YABA 2YQMA 3IHPA 2AN6A 2EGPA 2LXHC 4PTBA 4AYCB 2ECIA 1K2FA 2BAYA 4AP4A 4Z0RA 2CRWA 3GL6A 4GNDA
chains in the Genus database with same CATH topology
2FUIA 2CKLA 3EB5A 3U5OA 2ECNA 4FIPA 2MD8C 2LN0A 5B78A 1X4JA 3L1ZB 2YHNA 1VYXA 4LADB 4YBTA 3LRQA 4IC2A 2Y43A 4I7BA 3RTRB 1WEQA 2DX8A 3N9LA 2QJ0A 1T1HA 2L75A 4N3WA 4L58A 2JMIA 4A0CD 3VK6A 4ZUXU 2VPGA 2JRJA 1DVPA 5C13A 3SOWA 2CSZA 3L1XA 1LDJB 3V43A 2YHOA 2KWKA 3L11A 4B86C 4R2YA 2KIZA 5TDRA 3N9PA 2KWJA 5LCWB 1Z60A 4S3OC 3C5KA 2MD7B 2M6MA 4FK5A 3KV5A 3MHHA 1LDKC 4UP5A 2LV9A 5AITA 4UP0A 2FUUA 4QF2A 3ZYQA 2VJEA 3LQHA 5C11A 4PPEA 3U5MA 4B7YC 5B8DA 1E4UA 1MM3A 5B76A 4AVXA 3ZTGA 5KH3A 4W4UA 3ZPVE 2QIZA 3QZVA 1RMDA 4C9ZA 3KNVA 2H0DA 2F6NA 4LK9A 5J3XA 4WA6A 4GNFA 4V3LC 5FB1A 4NN2A 3RPGC 2YURA 1WILA 4FJCA 5H9MA 2MNYA 2CKLB 2ZETC 2I50A 2FSAA 2KYUA 3ZVZB 2MA6A 1WEVA 2MA5A 2K17A 5I3LA 3ZVYA 2C2VS 5G04B 4LKAA 3HCSA 5LKZA 3SOUA 2HYED 2H0DB 3EB6A 4BBQA 4ZQLA 2CSYA 2VPDA 5JG6A 1FBVA 2ECGA 5B79A 5H1VA 1Z6UA 2MIQA 2JMDA 4X3GA 1HYIA 1V87A 2LQ6A 3DPLR 4O64A 4I7DA 5LKXA 1JM7A 5AIUA 4YC9A 2EODA 4YADA 3O70A 2L0BA 4YATA 3M63A 5H1UA 2HDPA 3M99A 2D8SA 1WENA 2Y1NA 4S3OB 4R8PK 2PUYA 2LGKA 1WEMA 3GV4A 5FEYA 4IC3A 2MT5A 2UZGA 4CA1A 2MNZA 3ZPV1 2CT2A 3MHSA 2JMJA 4V3KC 3T7LA 3DQVR 3O33A 5TDWA 2VP7A 2NAAA 2E6RA 3HCUA 5LKTA 2K1JA 2YQLA 2VJFA 3N9OA 3PUQA 1WEUA 1JM7B 5D1KB 4LJNA 1WEEA 4A4BA 3ASLA 3PHDA 4A4CA 3SOXA 2LRIC 1WEOA 4AYCA 4A49A 2YREA 3O7AA 1ZBDB 1X4IA 3KQIA 2YU4A 2KGGA 2RSDA 1HYJA 1IYMA 2E6SA 2F6JA 3RPGB 5B77A 2YUCA 1WE9A 1WFKA 2PNXA 2ECJA 2VJFB 2VJEB 2LGGA 1F62A 2VPBA 2L5UA 3O35A 2YSJA 3M62A 2L43A 2K16A 1WIMA 3N9MA 4LLBA 3T6RA 2LXPC 2KWNA 4GNGA 2M3HA 4WZ2A 3U5NA 5G05B 4QF3A 2YSMA 2G45A 5G0FA 2KE1A 4L7XA 1MM2A 5FERA 2KREA 5B75A 1WESA 5TBNA 3SHBA 3N9NA 2XEUA 3PURA 2C2LA 2RI7A 2ECVA 4MSXA 5LKUA 1WEWA 1XWHA 2XB1A 5D1MB 2KR4A 5D1LB 2YW8A 2VPEA 4F52B 3U5PA 5TRBA 3O34A 1CHCA 2LDRA 2LGVA 4YAXA 1BORA 3LQIA 4GNEA 2KGIA 5H1TA 5EYAF 2L80A 1FP0A 4CCGX 1WGMA 2KFTA 2MUMA 5TABA 1G25A 3LQJA 2ECWA 5KH7A 4WZ3B 2VNFA 3ZNIA 3O37A 3HTKC 3FL2A 4TKPB 4YBMA 1VFYA 2F42A 4FO9A 2M1RA 2YT5A 4GB0A 3N9QA 4P5OB 2KWOA 3NG2A 3HCTA 4YBSA 4Q6FA 1VD4A 4XI1A 2ECTA 2G6QA 1JOCA 4WZ0A 2YYRA 5FB0A 1Z2QA 1X4UA 5DINA 2KU3A 3O36A 4I7CA 2IDAA 2LGLA 1WEPA 3KV6A 2EA6A 4ZDTA 2M85A 1N87A 2G43A 5KH9A 4AUQB 4N4FA 4R7EA 2QICA 2OXQC 1U6GB 4BHWA 2Y1MA 4UI9B 2K4DA 3I2DA 3C6WA 4MVTA 5DKAA 4YABA 2YQMA 3IHPA 2AN6A 2EGPA 2LXHC 4PTBA 4AYCB 2ECIA 1K2FA 2BAYA 4AP4A 3GL6A 4GNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUI A;  2CKL A;  3EB5 A;  3U5O A;  2ECN A;  4FIP A;  2MD8 C;  2LN0 A;  5B78 A;  1X4J A;  3L1Z B;  2YHN A;  1VYX A;  4LAD B;  4YBT A;  3LRQ A;  4IC2 A;  2Y43 A;  4I7B A;  3RTR B;  1WEQ A;  2DX8 A;  3N9L A;  2QJ0 A;  1T1H A;  2L75 A;  4N3W A;  4L58 A;  2JMI A;  4A0C D;  3VK6 A;  4ZUX U;  2VPG A;  2JRJ A;  1DVP A;  5C13 A;  3SOW A;  2CSZ A;  3L1X A;  1LDJ B;  3V43 A;  2YHO A;  2KWK A;  3L11 A;  4B86 C;  4R2Y A;  2KIZ A;  5TDR A;  3N9P A;  2KWJ A;  5LCW B;  1Z60 A;  4S3O C;  3C5K A;  2MD7 B;  2M6M A;  4FK5 A;  3KV5 A;  3MHH A;  1LDK C;  4UP5 A;  2LV9 A;  5AIT A;  4UP0 A;  2FUU A;  4QF2 A;  3ZYQ A;  2VJE A;  3LQH A;  5C11 A;  4PPE A;  3U5M A;  4B7Y C;  5B8D A;  1E4U A;  1MM3 A;  5B76 A;  4AVX A;  3ZTG A;  5KH3 A;  4W4U A;  3ZPV E;  2QIZ A;  3QZV A;  1RMD A;  4C9Z A;  3KNV A;  2H0D A;  2F6N A;  4LK9 A;  5J3X A;  4WA6 A;  4GNF A;  4V3L C;  5FB1 A;  4NN2 A;  3RPG C;  2YUR A;  1WIL A;  4FJC A;  5H9M A;  2MNY A;  2CKL B;  2ZET C;  2I50 A;  2FSA A;  2KYU A;  3ZVZ B;  2MA6 A;  1WEV A;  2MA5 A;  2K17 A;  5I3L A;  3ZVY A;  2C2V S;  5G04 B;  4LKA A;  3HCS A;  5LKZ A;  3SOU A;  2HYE D;  2H0D B;  3EB6 A;  4BBQ A;  4ZQL A;  2CSY A;  2VPD A;  5JG6 A;  1FBV A;  2ECG A;  5B79 A;  5H1V A;  1Z6U A;  2MIQ A;  2JMD A;  4X3G A;  1HYI A;  1V87 A;  2LQ6 A;  3DPL R;  4O64 A;  4I7D A;  5LKX A;  1JM7 A;  5AIU A;  4YC9 A;  2EOD A;  4YAD A;  3O70 A;  2L0B A;  4YAT A;  3M63 A;  5H1U A;  2HDP A;  3M99 A;  2D8S A;  1WEN A;  2Y1N A;  4S3O B;  4R8P K;  2PUY A;  2LGK A;  1WEM A;  3GV4 A;  5FEY A;  4IC3 A;  2MT5 A;  2UZG A;  4CA1 A;  2MNZ A;  3ZPV 1;  2CT2 A;  3MHS A;  2JMJ A;  4V3K C;  3T7L A;  3DQV R;  3O33 A;  5TDW A;  2VP7 A;  2NAA A;  2E6R A;  3HCU A;  5LKT A;  2K1J A;  2YQL A;  2VJF A;  3N9O A;  3PUQ A;  1WEU A;  1JM7 B;  5D1K B;  4LJN A;  1WEE A;  4A4B A;  3ASL A;  3PHD A;  4A4C A;  3SOX A;  2LRI C;  1WEO A;  4AYC A;  4A49 A;  2YRE A;  3O7A A;  1ZBD B;  1X4I A;  3KQI A;  2YU4 A;  2KGG A;  2RSD A;  1HYJ A;  1IYM A;  2E6S A;  2F6J A;  3RPG B;  5B77 A;  2YUC A;  1WE9 A;  1WFK A;  2PNX A;  2ECJ A;  2VJF B;  2VJE B;  2LGG A;  1F62 A;  2VPB A;  2L5U A;  3O35 A;  2YSJ A;  3M62 A;  2L43 A;  2K16 A;  1WIM A;  3N9M A;  4LLB A;  3T6R A;  2LXP C;  2KWN A;  4GNG A;  2M3H A;  4WZ2 A;  3U5N A;  5G05 B;  4QF3 A;  2YSM A;  2G45 A;  5G0F A;  2KE1 A;  4L7X A;  1MM2 A;  5FER A;  2KRE A;  5B75 A;  1WES A;  5TBN A;  3SHB A;  3N9N A;  2XEU A;  3PUR A;  2C2L A;  2RI7 A;  2ECV A;  4MSX A;  5LKU A;  1WEW A;  1XWH A;  2XB1 A;  5D1M B;  2KR4 A;  5D1L B;  2YW8 A;  2VPE A;  4F52 B;  3U5P A;  5TRB A;  3O34 A;  1CHC A;  2LDR A;  2LGV A;  4YAX A;  1BOR A;  3LQI A;  4GNE A;  2KGI A;  5H1T A;  5EYA F;  2L80 A;  1FP0 A;  4CCG X;  1WGM A;  2KFT A;  2MUM A;  5TAB A;  1G25 A;  3LQJ A;  2ECW A;  5KH7 A;  4WZ3 B;  2VNF A;  3ZNI A;  3O37 A;  3HTK C;  3FL2 A;  4TKP B;  4YBM A;  1VFY A;  2F42 A;  4FO9 A;  2M1R A;  2YT5 A;  4GB0 A;  3N9Q A;  4P5O B;  2KWO A;  3NG2 A;  3HCT A;  4YBS A;  4Q6F A;  1VD4 A;  4XI1 A;  2ECT A;  2G6Q A;  1JOC A;  4WZ0 A;  2YYR A;  5FB0 A;  1Z2Q A;  1X4U A;  5DIN A;  2KU3 A;  3O36 A;  4I7C A;  2IDA A;  2LGL A;  1WEP A;  3KV6 A;  2EA6 A;  4ZDT A;  2M85 A;  1N87 A;  2G43 A;  5KH9 A;  4AUQ B;  4N4F A;  4R7E A;  2QIC A;  2OXQ C;  1U6G B;  4BHW A;  2Y1M A;  4UI9 B;  2K4D A;  3I2D A;  3C6W A;  4MVT A;  5DKA A;  4YAB A;  2YQM A;  3IHP A;  2AN6 A;  2EGP A;  2LXH C;  4PTB A;  4AYC B;  2ECI A;  1K2F A;  2BAY A;  4AP4 A;  3GL6 A;  4GND A; 
#chains in the Genus database with same CATH topology
 3SUB A;  2FUI A;  2CKL A;  3EB5 A;  3U5O A;  4OGE A;  2ECN A;  4FIP A;  2MD8 C;  2LN0 A;  2LAU A;  5B78 A;  4Z0O A;  1X4J A;  3L1Z B;  2YHN A;  1VYX A;  4LAD B;  4YBT A;  3LRQ A;  3E2D A;  4IC2 A;  2Y43 A;  4I7B A;  3RTR B;  1WEQ A;  2DX8 A;  3N9L A;  2QJ0 A;  1T1H A;  2L75 A;  4N3W A;  4L58 A;  2JMI A;  4A0C D;  3VK6 A;  4ZUX U;  2VPG A;  2JRJ A;  1DVP A;  5C13 A;  3SOW A;  3LVQ E;  2CSZ A;  3L1X A;  1LDJ B;  3V43 A;  2YHO A;  2KWK A;  3L11 A;  4B86 C;  4R2Y A;  2KIZ A;  3Q1D A;  5TDR A;  3N9P A;  2KWJ A;  5LCW B;  1Z60 A;  4S3O C;  3C5K A;  2MD7 B;  2M6M A;  3LDY A;  4FK5 A;  3KV5 A;  2E61 A;  3MHH A;  3T9K A;  1LDK C;  4UP5 A;  2LV9 A;  5AIT A;  4UP0 A;  2FUU A;  4QF2 A;  3ZYQ A;  2VJE A;  4H9D A;  3LQH A;  5C11 A;  4PPE A;  3U5M A;  4B7Y C;  3H7H A;  5B8D A;  3FAO A;  1E4U A;  2DSM A;  3M7K A;  1MM3 A;  5B76 A;  3PLW A;  4AVX A;  3ZTG A;  5KH3 A;  4W4U A;  3ZPV E;  2FD4 A;  2CON A;  2QIZ A;  3QZV A;  1RMD A;  4C9Z A;  3DDT A;  3KNV A;  2DJA A;  2H0D A;  2F6N A;  4LK9 A;  5J3X A;  4WA6 A;  4GNF A;  4V3L C;  5FB1 A;  4NN2 A;  3RPG C;  2YUR A;  1WIL A;  2XP0 A;  2L7P A;  4FJC A;  5H9M A;  2MNY A;  2CKL B;  2ZET C;  2I50 A;  2FSA A;  2KYU A;  3FEH A;  3ZVZ B;  2MA6 A;  1WEV A;  2MA5 A;  2RR4 A;  2K17 A;  1DCQ A;  5I3L A;  3ZVY A;  2C2V S;  5G04 B;  4LKA A;  3HCS A;  5LKZ A;  3SOU A;  2HYE D;  2H0D B;  3EB6 A;  4BBQ A;  4ZQL A;  2CSY A;  2VPD A;  5JG6 A;  1FBV A;  2ECG A;  5B79 A;  2P57 A;  5H1V A;  1Z6U A;  2MIQ A;  2JMD A;  2D8U A;  4X3G A;  1HYI A;  1V87 A;  2LQ6 A;  3DPL R;  4O64 A;  4I7D A;  5LKX A;  1JM7 A;  4OGC A;  5AIU A;  2XOC A;  2XOZ A;  3DWD A;  4YC9 A;  2EOD A;  2YVR A;  4YAD A;  3O70 A;  2L0B A;  4YAT A;  3M63 A;  2IQJ A;  5H1U A;  2HDP A;  2JM3 A;  3M99 A;  2D8S A;  1MBM A;  1WEN A;  2XOY A;  2Y1N A;  4QQ4 A;  2MKE A;  4S3O B;  4R8P K;  2M13 A;  2PUY A;  2LGK A;  1WEM A;  3GV4 A;  5FEY A;  4IC3 A;  2MT5 A;  2UZG A;  4CA1 A;  2MNZ A;  3ZPV 1;  2CT2 A;  5SVX A;  3MHS A;  2JMJ A;  4V3K C;  3T7L A;  3DQV R;  3O33 A;  5TDW A;  2VP7 A;  2NAA A;  2E6R A;  2KKX A;  3HCU A;  5LKT A;  2K1J A;  2YQL A;  2VJF A;  3N9O A;  3PUQ A;  1WEU A;  1JM7 B;  5D1K B;  4LJN A;  1WEE A;  4A4B A;  3ASL A;  3PHD A;  4A4C A;  5K3Q A;  3SOX A;  2LRI C;  1WEO A;  4AYC A;  4A49 A;  2YRE A;  3O7A A;  1ZBD B;  3KDE C;  1X4I A;  3KQI A;  2YU4 A;  2KGG A;  2RSD A;  1HYJ A;  1IYM A;  2E6S A;  2F6J A;  3RPG B;  5B77 A;  3FAN A;  2YUC A;  1WE9 A;  5SVI A;  1WFK A;  2PNX A;  2ECJ A;  2VJF B;  2VJE B;  2LGG A;  1F62 A;  2VPB A;  2L5U A;  3LVR E;  3O35 A;  2YSJ A;  3M62 A;  2L43 A;  2K16 A;  1WIM A;  3N9M A;  4LLB A;  3T6R A;  2LXP C;  5SVI B;  2B0O E;  2CSV A;  2KWN A;  4GNG A;  2M3H A;  4WZ2 A;  3U5N A;  5G05 B;  4QF3 A;  2YSM A;  2G45 A;  5G0F A;  4O62 A;  2KE1 A;  3O47 A;  4L7X A;  4F1P A;  1MM2 A;  2CRR A;  5FER A;  2KRE A;  5B75 A;  1WES A;  5TBN A;  3SHB A;  3N9N A;  2XEU A;  3PUR A;  2C2L A;  2RI7 A;  2ECV A;  4MSX A;  5LKU A;  1WEW A;  1XWH A;  2XB1 A;  5D1M B;  2KR4 A;  5D1L B;  2YW8 A;  3JUE A;  2VPE A;  4F52 B;  3U5P A;  5TRB A;  3O34 A;  1CHC A;  2LDR A;  2LGV A;  4YAX A;  1BOR A;  3LQI A;  4GNE A;  2KGI A;  5H1T A;  3FJU B;  5EYA F;  2KKY A;  2L80 A;  1FP0 A;  4CCG X;  1WGM A;  2KFT A;  2MUM A;  5TAB A;  1G25 A;  3LQJ A;  2ECW A;  5KH7 A;  4WZ3 B;  2VNF A;  3ZNI A;  2FFW A;  3O37 A;  2OWA A;  3HTK C;  3FL2 A;  4TKP B;  4YBM A;  1VFY A;  2F42 A;  4FO9 A;  2M1R A;  2YT5 A;  4GB0 A;  3N9Q A;  4P5O B;  2KWO A;  3NG2 A;  3HCT A;  3FM8 C;  4YBS A;  3MDB C;  4Q6F A;  1VD4 A;  2EXU A;  4XI1 A;  2ECT A;  2G6Q A;  1JOC A;  4WZ0 A;  2YYR A;  5FB0 A;  1Z2Q A;  1X4U A;  5DIN A;  2KU3 A;  5SVY A;  3O36 A;  4I7C A;  2IDA A;  3LJU X;  2LGL A;  1WEP A;  3KV6 A;  2EA6 A;  4ZDT A;  2M85 A;  1N87 A;  2G43 A;  2EGM A;  2JUN A;  5KH9 A;  4AUQ B;  4N4F A;  4R7E A;  2QIC A;  2OXQ C;  1U6G B;  4BHW A;  2Y1M A;  4UI9 B;  2K4D A;  3I2D A;  3C6W A;  4MVT A;  5DKA A;  4YAB A;  2YQM A;  3IHP A;  2AN6 A;  2EGP A;  2LXH C;  4PTB A;  4AYC B;  2ECI A;  1K2F A;  2BAY A;  4AP4 A;  4Z0R A;  2CRW A;  3GL6 A;  4GND A; 
#chains in the Genus database with same CATH homology
 2FUI A;  2CKL A;  3EB5 A;  3U5O A;  2ECN A;  4FIP A;  2MD8 C;  2LN0 A;  5B78 A;  1X4J A;  3L1Z B;  2YHN A;  1VYX A;  4LAD B;  4YBT A;  3LRQ A;  4IC2 A;  2Y43 A;  4I7B A;  3RTR B;  1WEQ A;  2DX8 A;  3N9L A;  2QJ0 A;  1T1H A;  2L75 A;  4N3W A;  4L58 A;  2JMI A;  4A0C D;  3VK6 A;  4ZUX U;  2VPG A;  2JRJ A;  1DVP A;  5C13 A;  3SOW A;  2CSZ A;  3L1X A;  1LDJ B;  3V43 A;  2YHO A;  2KWK A;  3L11 A;  4B86 C;  4R2Y A;  2KIZ A;  5TDR A;  3N9P A;  2KWJ A;  5LCW B;  1Z60 A;  4S3O C;  3C5K A;  2MD7 B;  2M6M A;  4FK5 A;  3KV5 A;  3MHH A;  1LDK C;  4UP5 A;  2LV9 A;  5AIT A;  4UP0 A;  2FUU A;  4QF2 A;  3ZYQ A;  2VJE A;  3LQH A;  5C11 A;  4PPE A;  3U5M A;  4B7Y C;  5B8D A;  1E4U A;  1MM3 A;  5B76 A;  4AVX A;  3ZTG A;  5KH3 A;  4W4U A;  3ZPV E;  2QIZ A;  3QZV A;  1RMD A;  4C9Z A;  3KNV A;  2H0D A;  2F6N A;  4LK9 A;  5J3X A;  4WA6 A;  4GNF A;  4V3L C;  5FB1 A;  4NN2 A;  3RPG C;  2YUR A;  1WIL A;  4FJC A;  5H9M A;  2MNY A;  2CKL B;  2ZET C;  2I50 A;  2FSA A;  2KYU A;  3ZVZ B;  2MA6 A;  1WEV A;  2MA5 A;  2K17 A;  5I3L A;  3ZVY A;  2C2V S;  5G04 B;  4LKA A;  3HCS A;  5LKZ A;  3SOU A;  2HYE D;  2H0D B;  3EB6 A;  4BBQ A;  4ZQL A;  2CSY A;  2VPD A;  5JG6 A;  1FBV A;  2ECG A;  5B79 A;  5H1V A;  1Z6U A;  2MIQ A;  2JMD A;  4X3G A;  1HYI A;  1V87 A;  2LQ6 A;  3DPL R;  4O64 A;  4I7D A;  5LKX A;  1JM7 A;  5AIU A;  4YC9 A;  2EOD A;  4YAD A;  3O70 A;  2L0B A;  4YAT A;  3M63 A;  5H1U A;  2HDP A;  3M99 A;  2D8S A;  1WEN A;  2Y1N A;  4S3O B;  4R8P K;  2PUY A;  2LGK A;  1WEM A;  3GV4 A;  5FEY A;  4IC3 A;  2MT5 A;  2UZG A;  4CA1 A;  2MNZ A;  3ZPV 1;  2CT2 A;  3MHS A;  2JMJ A;  4V3K C;  3T7L A;  3DQV R;  3O33 A;  5TDW A;  2VP7 A;  2NAA A;  2E6R A;  3HCU A;  5LKT A;  2K1J A;  2YQL A;  2VJF A;  3N9O A;  3PUQ A;  1WEU A;  1JM7 B;  5D1K B;  4LJN A;  1WEE A;  4A4B A;  3ASL A;  3PHD A;  4A4C A;  3SOX A;  2LRI C;  1WEO A;  4AYC A;  4A49 A;  2YRE A;  3O7A A;  1ZBD B;  1X4I A;  3KQI A;  2YU4 A;  2KGG A;  2RSD A;  1HYJ A;  1IYM A;  2E6S A;  2F6J A;  3RPG B;  5B77 A;  2YUC A;  1WE9 A;  1WFK A;  2PNX A;  2ECJ A;  2VJF B;  2VJE B;  2LGG A;  1F62 A;  2VPB A;  2L5U A;  3O35 A;  2YSJ A;  3M62 A;  2L43 A;  2K16 A;  1WIM A;  3N9M A;  4LLB A;  3T6R A;  2LXP C;  2KWN A;  4GNG A;  2M3H A;  4WZ2 A;  3U5N A;  5G05 B;  4QF3 A;  2YSM A;  2G45 A;  5G0F A;  2KE1 A;  4L7X A;  1MM2 A;  5FER A;  2KRE A;  5B75 A;  1WES A;  5TBN A;  3SHB A;  3N9N A;  2XEU A;  3PUR A;  2C2L A;  2RI7 A;  2ECV A;  4MSX A;  5LKU A;  1WEW A;  1XWH A;  2XB1 A;  5D1M B;  2KR4 A;  5D1L B;  2YW8 A;  2VPE A;  4F52 B;  3U5P A;  5TRB A;  3O34 A;  1CHC A;  2LDR A;  2LGV A;  4YAX A;  1BOR A;  3LQI A;  4GNE A;  2KGI A;  5H1T A;  5EYA F;  2L80 A;  1FP0 A;  4CCG X;  1WGM A;  2KFT A;  2MUM A;  5TAB A;  1G25 A;  3LQJ A;  2ECW A;  5KH7 A;  4WZ3 B;  2VNF A;  3ZNI A;  3O37 A;  3HTK C;  3FL2 A;  4TKP B;  4YBM A;  1VFY A;  2F42 A;  4FO9 A;  2M1R A;  2YT5 A;  4GB0 A;  3N9Q A;  4P5O B;  2KWO A;  3NG2 A;  3HCT A;  4YBS A;  4Q6F A;  1VD4 A;  4XI1 A;  2ECT A;  2G6Q A;  1JOC A;  4WZ0 A;  2YYR A;  5FB0 A;  1Z2Q A;  1X4U A;  5DIN A;  2KU3 A;  3O36 A;  4I7C A;  2IDA A;  2LGL A;  1WEP A;  3KV6 A;  2EA6 A;  4ZDT A;  2M85 A;  1N87 A;  2G43 A;  5KH9 A;  4AUQ B;  4N4F A;  4R7E A;  2QIC A;  2OXQ C;  1U6G B;  4BHW A;  2Y1M A;  4UI9 B;  2K4D A;  3I2D A;  3C6W A;  4MVT A;  5DKA A;  4YAB A;  2YQM A;  3IHP A;  2AN6 A;  2EGP A;  2LXH C;  4PTB A;  4AYC B;  2ECI A;  1K2F A;  2BAY A;  4AP4 A;  3GL6 A;  4GND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...