4LKAA

Crystal structure of moz double phd finger histone h3k9ac complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 126
sequence length 126
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4lkaA00
4LLBA 2VPDA 2PNXA 4AP4A 5KH9A 4A49A 2PUYA 3LQHA 3L11A 2K4DA 4YBMA 5C13A 1JM7A 5FEYA 2KWOA 3O7AA 2M1RA 2VJEB 1Z2QA 1ZBDB 4PTBA 1MM2A 2UZGA 2MA5A 4YABA 3C6WA 2YQMA 2H0DA 2Y1MA 3KNVA 3ZPVE 5B79A 4L58A 3SOWA 5AIUA 2CKLA 1HYJA 3U5MA 2F6JA 2ECIA 4FO9A 3GL6A 1N87A 4ZUXU 2K1JA 2NAAA 4AVXA 4YBSA 2L0BA 2XEUA 4A4CA 4YAXA 3ASLA 2ECWA 1WGMA 3DQVR 5B77A 4W4UA 3ZYQA 5H1VA 2KR4A 1WFKA 3N9QA 4UP0A 1WEUA 3HCTA 1WE9A 1X4IA 2KGGA 2ECVA 4ZQLA 3PHDA 5TABA 1RMDA 3N9LA 2YSJA 2ECJA 2Y1NA 2KIZA 5D1LB 5TDWA 2JMJA 3L1ZB 4N3WA 2VJFA 4FJCA 2G45A 5LKTA 2LXHC 4LJNA 2MIQA 3ZVZB 2KFTA 4R8PK 2BAYA 2LXPC 4S3OB 4N4FA 4BHWA 2JMIA 5TRBA 2MUMA 2MD7B 2E6SA 3EB6A 3O37A 2MD8C 2YW8A 3KV6A 3RTRB 3VK6A 2E6RA 1VD4A 3PURA 4WZ0A 2VP7A 2VJEA 3U5OA 1BORA 1E4UA 2LN0A 2LGGA 2QIZA 2MNZA 2JRJA 3FL2A 3SHBA 2VPGA 3KV5A 2K17A 2M3HA 2YHOA 4YATA 2Y43A 3O36A 2KYUA 5B75A 4GNFA 2C2VS 2HYED 5G04B 2EODA 2YT5A 3PUQA 2FUUA 1VYXA 4S3OC 5J3XA 2VPBA 2L75A 2LGLA 1WEEA 5KH7A 2FUIA 3NG2A 1XWHA 4PPEA 5LKZA 3M99A 1WEWA 2K16A 2CSZA 4YADA 5FB1A 2MT5A 4GNGA 2VPEA 1MM3A 5I3LA 2QJ0A 2YQLA 2DX8A 4O64A 3L1XA 4CCGX 1IYMA 2MNYA 1FBVA 4F52B 1FP0A 3DPLR 3N9MA 4B86C 2MA6A 4V3KC 2RI7A 3LQIA 3O70A 5H1TA 1LDJB 3MHHA 4IC3A 4AYCA 2L43A 3O33A 2G6QA 2LGVA 3RPGB 3LRQA 1G25A 5LKUA 2YU4A 4WZ3B 5DINA 3HTKC 3N9NA 2ECTA 4TKPB 3QZVA 3C5KA 4YBTA 5TBNA 2QICA 2KREA 1LDKC 4WZ2A 4B7YC 2CT2A 2KU3A 4NN2A 2YURA 3M63A 3EB5A 4CA1A 2KWJA 2VNFA 3HCSA 4P5OB 4UI9B 3KQIA 4QF3A 3MHSA 5C11A 4ZDTA 1WEOA 3IHPA 5D1MB 5EYAF 1F62A 2M6MA 5TDRA 2KWKA 4I7BA 2VJFB 4YC9A 3O35A 5LCWB 2FSAA 3N9OA 5G0FA 1WEVA 5B78A 2LV9A 1WEMA 4C9ZA 1T1HA 3I2DA 4MSXA 4Q6FA 2D8SA 2KGIA 4FK5A 3LQJA 4WA6A 2G43A 4LK9A 2ZETC 2XB1A 4UP5A 3U5NA 5AITA 4IC2A 1WESA 4FIPA 4I7DA 2L5UA 2L80A 3SOXA 3T7LA 2F6NA 4GNDA 2F42A 5FB0A 1Z6UA 4A4BA 2AN6A 2JMDA 2YREA 4R7EA 5LKXA 5B8DA 1CHCA 5G05B 2LGKA 3N9PA 3ZVYA 1X4UA 1JM7B 3ZTGA 2YYRA 5D1KB 2KWNA 4X3GA 3U5PA 1Z60A 4BBQA 5FERA 4V3LC 1WIMA 4A0CD 2LDRA 2H0DB 1VFYA 4I7CA 2EA6A 1U6GB 1WILA 2ECNA 2OXQC 3ZNIA 2CKLB 2RSDA 3GV4A 5KH3A 1WENA 5B76A 3M62A 4MVTA 2YHNA 3SOUA 2KE1A 3T6RA 1X4JA 1WEPA 4XI1A 5H1UA 1JOCA 4AUQB 4GNEA 4AYCB 2EGPA 1DVPA 2CSYA 2YUCA 4R2YA 3O34A 2IDAA 2M85A 4GB0A 4LKAA 4L7XA 3RPGC 2YSMA 2LQ6A 1HYIA 5H9MA 2LRIC 3HCUA 4LADB 1K2FA 2I50A 3ZPV1 1V87A 2C2LA 5DKAA 5JG6A 2ECGA 3V43A 4QF2A 1WEQA 2HDPA
chains in the Genus database with same CATH superfamily
4LLBA 2VPDA 2PNXA 4AP4A 5KH9A 4A49A 2PUYA 3LQHA 2P57A 3L11A 3LDYA 2K4DA 4YBMA 5C13A 1JM7A 5FEYA 3PLWA 2KWOA 3O7AA 2M1RA 2VJEB 1Z2QA 1ZBDB 4PTBA 1MM2A 2UZGA 2MA5A 4YABA 2KKXA 3C6WA 2YQMA 2H0DA 2Y1MA 3KNVA 3ZPVE 5B79A 4L58A 4O62A 3SOWA 5AIUA 2CKLA 1HYJA 3U5MA 2F6JA 2ECIA 4FO9A 3GL6A 2XOYA 1N87A 4ZUXU 2K1JA 2NAAA 4AVXA 4YBSA 2L0BA 2XEUA 4A4CA 3DWDA 4YAXA 3ASLA 2ECWA 1WGMA 3DQVR 5B77A 4W4UA 3ZYQA 5H1VA 3T9KA 2KR4A 1WFKA 2M13A 3N9QA 4UP0A 1WEUA 3HCTA 1WE9A 1X4IA 2KGGA 2ECVA 4ZQLA 4Z0OA 3PHDA 5TABA 1RMDA 3N9LA 3FM8C 2YSJA 2ECJA 2Y1NA 2KIZA 5D1LB 5TDWA 2JMJA 3L1ZB 4N3WA 2VJFA 4FJCA 2G45A 5LKTA 2LXHC 4LJNA 2MIQA 3ZVZB 2KFTA 4R8PK 2BAYA 2OWAA 2LXPC 3KDEC 4S3OB 4N4FA 4H9DA 3SUBA 4BHWA 2JMIA 5TRBA 2MUMA 2MD7B 2XOCA 2E6SA 3EB6A 3O37A 2MD8C 2YW8A 3KV6A 3RTRB 3VK6A 2E6RA 1VD4A 3PURA 4WZ0A 2VP7A 2VJEA 3U5OA 1BORA 1E4UA 2LN0A 2LGGA 2QIZA 2MNZA 2JRJA 3FL2A 3SHBA 2VPGA 3KV5A 2K17A 2M3HA 2YHOA 4YATA 2Y43A 2XOZA 3O36A 2KYUA 5B75A 4GNFA 2C2VS 2HYED 5G04B 2EODA 2YT5A 3PUQA 2FUUA 1VYXA 3H7HA 4S3OC 5J3XA 2VPBA 2L75A 2LGLA 2CRWA 1WEEA 5KH7A 2FUIA 3NG2A 1XWHA 4PPEA 5LKZA 3M99A 1MBMA 1WEWA 2K16A 2CSZA 4YADA 5FB1A 2MT5A 4GNGA 2VPEA 1MM3A 5I3LA 2QJ0A 4F1PA 2YQLA 2DX8A 4O64A 3L1XA 2JUNA 4CCGX 1DCQA 1IYMA 2MNYA 1FBVA 4F52B 1FP0A 3DPLR 3N9MA 4B86C 2MA6A 4V3KC 2RI7A 3LQIA 3O70A 5H1TA 1LDJB 3MHHA 4IC3A 4AYCA 2L43A 3O33A 2EGMA 2G6QA 2D8UA 2LGVA 2CONA 3Q1DA 3RPGB 3LRQA 1G25A 5LKUA 2YU4A 4WZ3B 5DINA 3HTKC 3N9NA 4QQ4A 2FD4A 2ECTA 4TKPB 3QZVA 3C5KA 4YBTA 5TBNA 2QICA 2KREA 1LDKC 3MDBC 4WZ2A 4B7YC 2LAUA 2CT2A 2KU3A 5SVXA 3DDTA 4NN2A 2DJAA 2YURA 3M63A 3EB5A 4CA1A 2KWJA 2VNFA 3HCSA 4P5OB 3E2DA 4UI9B 3KQIA 4QF3A 3MHSA 5C11A 4ZDTA 1WEOA 3IHPA 5D1MB 5EYAF 2DSMA 1F62A 2M6MA 5TDRA 2KWKA 4I7BA 3FEHA 2VJFB 4YC9A 3O35A 5LCWB 2JM3A 2FSAA 3N9OA 5G0FA 1WEVA 5B78A 3FAOA 2B0OE 2LV9A 1WEMA 4C9ZA 1T1HA 3I2DA 4MSXA 4Q6FA 2D8SA 2L7PA 2KGIA 3LJUX 4FK5A 3LQJA 4WA6A 2EXUA 2G43A 4LK9A 2ZETC 2XB1A 4UP5A 2CRRA 3U5NA 5AITA 4IC2A 5SVIB 1WESA 4FIPA 4I7DA 2L5UA 3FANA 2L80A 2RR4A 3SOXA 3T7LA 2F6NA 4GNDA 2E61A 2F42A 1Z6UA 5FB0A 2AN6A 4A4BA 2JMDA 4OGCA 2YREA 4R7EA 5LKXA 5B8DA 1CHCA 4Z0RA 5G05B 2LGKA 3N9PA 3ZVYA 1X4UA 1JM7B 3ZTGA 2YYRA 5D1KB 2KWNA 4X3GA 3O47A 1Z60A 4BBQA 3U5PA 5FERA 4V3LC 1WIMA 4A0CD 2LDRA 2H0DB 3M7KA 1VFYA 4I7CA 2EA6A 1U6GB 1WILA 2ECNA 2OXQC 3ZNIA 3LVRE 2CKLB 2RSDA 3GV4A 5KH3A 1WENA 5B76A 3M62A 4MVTA 2YHNA 3SOUA 3LVQE 2KE1A 3T6RA 1X4JA 5SVYA 1WEPA 4XI1A 5H1UA 1JOCA 4AUQB 4GNEA 2CSVA 4AYCB 2KKYA 2EGPA 1DVPA 2CSYA 2YUCA 4OGEA 4R2YA 3JUEA 2IDAA 2M85A 3O34A 4GB0A 4LKAA 4L7XA 3RPGC 2YSMA 2LQ6A 1HYIA 5H9MA 2YVRA 5K3QA 2LRIC 2FFWA 2XP0A 3HCUA 4LADB 1K2FA 2I50A 2MKEA 5SVIA 3ZPV1 1V87A 2IQJA 2C2LA 5DKAA 5JG6A 2ECGA 3V43A 4QF2A 3FJUB 1WEQA 2HDPA
chains in the Genus database with same CATH topology
4LLBA 2VPDA 2PNXA 4AP4A 5KH9A 4A49A 2PUYA 3LQHA 3L11A 2K4DA 4YBMA 5C13A 1JM7A 5FEYA 2KWOA 3O7AA 2M1RA 2VJEB 1Z2QA 1ZBDB 4PTBA 1MM2A 2UZGA 2MA5A 4YABA 3C6WA 2YQMA 2H0DA 2Y1MA 3KNVA 3ZPVE 5B79A 4L58A 3SOWA 5AIUA 2CKLA 1HYJA 3U5MA 2F6JA 2ECIA 4FO9A 3GL6A 1N87A 4ZUXU 2K1JA 2NAAA 4AVXA 4YBSA 2L0BA 2XEUA 4A4CA 4YAXA 3ASLA 2ECWA 1WGMA 3DQVR 5B77A 4W4UA 3ZYQA 5H1VA 2KR4A 1WFKA 3N9QA 4UP0A 1WEUA 3HCTA 1WE9A 1X4IA 2KGGA 2ECVA 4ZQLA 3PHDA 5TABA 1RMDA 3N9LA 2YSJA 2ECJA 2Y1NA 2KIZA 5D1LB 5TDWA 2JMJA 3L1ZB 4N3WA 2VJFA 4FJCA 2G45A 5LKTA 2LXHC 4LJNA 2MIQA 3ZVZB 2KFTA 4R8PK 2BAYA 2LXPC 4S3OB 4N4FA 4BHWA 2JMIA 5TRBA 2MUMA 2MD7B 2E6SA 3EB6A 3O37A 2MD8C 2YW8A 3KV6A 3RTRB 3VK6A 2E6RA 1VD4A 3PURA 4WZ0A 2VP7A 2VJEA 3U5OA 1BORA 1E4UA 2LN0A 2LGGA 2QIZA 2MNZA 2JRJA 3FL2A 3SHBA 2VPGA 3KV5A 2K17A 2M3HA 2YHOA 4YATA 2Y43A 3O36A 2KYUA 5B75A 4GNFA 2C2VS 2HYED 5G04B 2EODA 2YT5A 3PUQA 2FUUA 1VYXA 4S3OC 5J3XA 2VPBA 2L75A 2LGLA 1WEEA 5KH7A 2FUIA 3NG2A 1XWHA 4PPEA 5LKZA 3M99A 1WEWA 2K16A 2CSZA 4YADA 5FB1A 2MT5A 4GNGA 2VPEA 1MM3A 5I3LA 2QJ0A 2YQLA 2DX8A 4O64A 3L1XA 4CCGX 1IYMA 2MNYA 1FBVA 4F52B 1FP0A 3DPLR 3N9MA 4B86C 2MA6A 4V3KC 2RI7A 3LQIA 3O70A 5H1TA 1LDJB 3MHHA 4IC3A 4AYCA 2L43A 3O33A 2G6QA 2LGVA 3RPGB 3LRQA 1G25A 5LKUA 2YU4A 4WZ3B 5DINA 3HTKC 3N9NA 2ECTA 4TKPB 3QZVA 3C5KA 4YBTA 5TBNA 2QICA 2KREA 1LDKC 4WZ2A 4B7YC 2CT2A 2KU3A 4NN2A 2YURA 3M63A 3EB5A 4CA1A 2KWJA 2VNFA 3HCSA 4P5OB 4UI9B 3KQIA 4QF3A 3MHSA 5C11A 4ZDTA 1WEOA 3IHPA 5D1MB 5EYAF 1F62A 2M6MA 5TDRA 2KWKA 4I7BA 2VJFB 4YC9A 3O35A 5LCWB 2FSAA 3N9OA 5G0FA 1WEVA 5B78A 2LV9A 1WEMA 4C9ZA 1T1HA 3I2DA 4MSXA 4Q6FA 2D8SA 2KGIA 4FK5A 3LQJA 4WA6A 2G43A 4LK9A 2ZETC 2XB1A 4UP5A 3U5NA 5AITA 4IC2A 1WESA 4FIPA 4I7DA 2L5UA 2L80A 3SOXA 3T7LA 2F6NA 4GNDA 2F42A 5FB0A 1Z6UA 4A4BA 2AN6A 2JMDA 2YREA 4R7EA 5LKXA 5B8DA 1CHCA 5G05B 2LGKA 3N9PA 3ZVYA 1X4UA 1JM7B 3ZTGA 2YYRA 5D1KB 2KWNA 4X3GA 3U5PA 1Z60A 4BBQA 5FERA 4V3LC 1WIMA 4A0CD 2LDRA 2H0DB 1VFYA 4I7CA 2EA6A 1U6GB 1WILA 2ECNA 2OXQC 3ZNIA 2CKLB 2RSDA 3GV4A 5KH3A 1WENA 5B76A 3M62A 4MVTA 2YHNA 3SOUA 2KE1A 3T6RA 1X4JA 1WEPA 4XI1A 5H1UA 1JOCA 4AUQB 4GNEA 4AYCB 2EGPA 1DVPA 2CSYA 2YUCA 4R2YA 3O34A 2IDAA 2M85A 4GB0A 4LKAA 4L7XA 3RPGC 2YSMA 2LQ6A 1HYIA 5H9MA 2LRIC 3HCUA 4LADB 1K2FA 2I50A 3ZPV1 1V87A 2C2LA 5DKAA 5JG6A 2ECGA 3V43A 4QF2A 1WEQA 2HDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLB A;  2VPD A;  2PNX A;  4AP4 A;  5KH9 A;  4A49 A;  2PUY A;  3LQH A;  3L11 A;  2K4D A;  4YBM A;  5C13 A;  1JM7 A;  5FEY A;  2KWO A;  3O7A A;  2M1R A;  2VJE B;  1Z2Q A;  1ZBD B;  4PTB A;  1MM2 A;  2UZG A;  2MA5 A;  4YAB A;  3C6W A;  2YQM A;  2H0D A;  2Y1M A;  3KNV A;  3ZPV E;  5B79 A;  4L58 A;  3SOW A;  5AIU A;  2CKL A;  1HYJ A;  3U5M A;  2F6J A;  2ECI A;  4FO9 A;  3GL6 A;  1N87 A;  4ZUX U;  2K1J A;  2NAA A;  4AVX A;  4YBS A;  2L0B A;  2XEU A;  4A4C A;  4YAX A;  3ASL A;  2ECW A;  1WGM A;  3DQV R;  5B77 A;  4W4U A;  3ZYQ A;  5H1V A;  2KR4 A;  1WFK A;  3N9Q A;  4UP0 A;  1WEU A;  3HCT A;  1WE9 A;  1X4I A;  2KGG A;  2ECV A;  4ZQL A;  3PHD A;  5TAB A;  1RMD A;  3N9L A;  2YSJ A;  2ECJ A;  2Y1N A;  2KIZ A;  5D1L B;  5TDW A;  2JMJ A;  3L1Z B;  4N3W A;  2VJF A;  4FJC A;  2G45 A;  5LKT A;  2LXH C;  4LJN A;  2MIQ A;  3ZVZ B;  2KFT A;  4R8P K;  2BAY A;  2LXP C;  4S3O B;  4N4F A;  4BHW A;  2JMI A;  5TRB A;  2MUM A;  2MD7 B;  2E6S A;  3EB6 A;  3O37 A;  2MD8 C;  2YW8 A;  3KV6 A;  3RTR B;  3VK6 A;  2E6R A;  1VD4 A;  3PUR A;  4WZ0 A;  2VP7 A;  2VJE A;  3U5O A;  1BOR A;  1E4U A;  2LN0 A;  2LGG A;  2QIZ A;  2MNZ A;  2JRJ A;  3FL2 A;  3SHB A;  2VPG A;  3KV5 A;  2K17 A;  2M3H A;  2YHO A;  4YAT A;  2Y43 A;  3O36 A;  2KYU A;  5B75 A;  4GNF A;  2C2V S;  2HYE D;  5G04 B;  2EOD A;  2YT5 A;  3PUQ A;  2FUU A;  1VYX A;  4S3O C;  5J3X A;  2VPB A;  2L75 A;  2LGL A;  1WEE A;  5KH7 A;  2FUI A;  3NG2 A;  1XWH A;  4PPE A;  5LKZ A;  3M99 A;  1WEW A;  2K16 A;  2CSZ A;  4YAD A;  5FB1 A;  2MT5 A;  4GNG A;  2VPE A;  1MM3 A;  5I3L A;  2QJ0 A;  2YQL A;  2DX8 A;  4O64 A;  3L1X A;  4CCG X;  1IYM A;  2MNY A;  1FBV A;  4F52 B;  1FP0 A;  3DPL R;  3N9M A;  4B86 C;  2MA6 A;  4V3K C;  2RI7 A;  3LQI A;  3O70 A;  5H1T A;  1LDJ B;  3MHH A;  4IC3 A;  4AYC A;  2L43 A;  3O33 A;  2G6Q A;  2LGV A;  3RPG B;  3LRQ A;  1G25 A;  5LKU A;  2YU4 A;  4WZ3 B;  5DIN A;  3HTK C;  3N9N A;  2ECT A;  4TKP B;  3QZV A;  3C5K A;  4YBT A;  5TBN A;  2QIC A;  2KRE A;  1LDK C;  4WZ2 A;  4B7Y C;  2CT2 A;  2KU3 A;  4NN2 A;  2YUR A;  3M63 A;  3EB5 A;  4CA1 A;  2KWJ A;  2VNF A;  3HCS A;  4P5O B;  4UI9 B;  3KQI A;  4QF3 A;  3MHS A;  5C11 A;  4ZDT A;  1WEO A;  3IHP A;  5D1M B;  5EYA F;  1F62 A;  2M6M A;  5TDR A;  2KWK A;  4I7B A;  2VJF B;  4YC9 A;  3O35 A;  5LCW B;  2FSA A;  3N9O A;  5G0F A;  1WEV A;  5B78 A;  2LV9 A;  1WEM A;  4C9Z A;  1T1H A;  3I2D A;  4MSX A;  4Q6F A;  2D8S A;  2KGI A;  4FK5 A;  3LQJ A;  4WA6 A;  2G43 A;  4LK9 A;  2ZET C;  2XB1 A;  4UP5 A;  3U5N A;  5AIT A;  4IC2 A;  1WES A;  4FIP A;  4I7D A;  2L5U A;  2L80 A;  3SOX A;  3T7L A;  2F6N A;  4GND A;  2F42 A;  5FB0 A;  1Z6U A;  4A4B A;  2AN6 A;  2JMD A;  2YRE A;  4R7E A;  5LKX A;  5B8D A;  1CHC A;  5G05 B;  2LGK A;  3N9P A;  3ZVY A;  1X4U A;  1JM7 B;  3ZTG A;  2YYR A;  5D1K B;  2KWN A;  4X3G A;  3U5P A;  1Z60 A;  4BBQ A;  5FER A;  4V3L C;  1WIM A;  4A0C D;  2LDR A;  2H0D B;  1VFY A;  4I7C A;  2EA6 A;  1U6G B;  1WIL A;  2ECN A;  2OXQ C;  3ZNI A;  2CKL B;  2RSD A;  3GV4 A;  5KH3 A;  1WEN A;  5B76 A;  3M62 A;  4MVT A;  2YHN A;  3SOU A;  2KE1 A;  3T6R A;  1X4J A;  1WEP A;  4XI1 A;  5H1U A;  1JOC A;  4AUQ B;  4GNE A;  4AYC B;  2EGP A;  1DVP A;  2CSY A;  2YUC A;  4R2Y A;  3O34 A;  2IDA A;  2M85 A;  4GB0 A;  4LKA A;  4L7X A;  3RPG C;  2YSM A;  2LQ6 A;  1HYI A;  5H9M A;  2LRI C;  3HCU A;  4LAD B;  1K2F A;  2I50 A;  3ZPV 1;  1V87 A;  2C2L A;  5DKA A;  5JG6 A;  2ECG A;  3V43 A;  4QF2 A;  1WEQ A;  2HDP A; 
#chains in the Genus database with same CATH topology
 4LLB A;  2VPD A;  2PNX A;  4AP4 A;  5KH9 A;  4A49 A;  2PUY A;  3LQH A;  2P57 A;  3L11 A;  3LDY A;  2K4D A;  4YBM A;  5C13 A;  1JM7 A;  5FEY A;  3PLW A;  2KWO A;  3O7A A;  2M1R A;  2VJE B;  1Z2Q A;  1ZBD B;  4PTB A;  1MM2 A;  2UZG A;  2MA5 A;  4YAB A;  2KKX A;  3C6W A;  2YQM A;  2H0D A;  2Y1M A;  3KNV A;  3ZPV E;  5B79 A;  4L58 A;  4O62 A;  3SOW A;  5AIU A;  2CKL A;  1HYJ A;  3U5M A;  2F6J A;  2ECI A;  4FO9 A;  3GL6 A;  2XOY A;  1N87 A;  4ZUX U;  2K1J A;  2NAA A;  4AVX A;  4YBS A;  2L0B A;  2XEU A;  4A4C A;  3DWD A;  4YAX A;  3ASL A;  2ECW A;  1WGM A;  3DQV R;  5B77 A;  4W4U A;  3ZYQ A;  5H1V A;  3T9K A;  2KR4 A;  1WFK A;  2M13 A;  3N9Q A;  4UP0 A;  1WEU A;  3HCT A;  1WE9 A;  1X4I A;  2KGG A;  2ECV A;  4ZQL A;  4Z0O A;  3PHD A;  5TAB A;  1RMD A;  3N9L A;  3FM8 C;  2YSJ A;  2ECJ A;  2Y1N A;  2KIZ A;  5D1L B;  5TDW A;  2JMJ A;  3L1Z B;  4N3W A;  2VJF A;  4FJC A;  2G45 A;  5LKT A;  2LXH C;  4LJN A;  2MIQ A;  3ZVZ B;  2KFT A;  4R8P K;  2BAY A;  2OWA A;  2LXP C;  3KDE C;  4S3O B;  4N4F A;  4H9D A;  3SUB A;  4BHW A;  2JMI A;  5TRB A;  2MUM A;  2MD7 B;  2XOC A;  2E6S A;  3EB6 A;  3O37 A;  2MD8 C;  2YW8 A;  3KV6 A;  3RTR B;  3VK6 A;  2E6R A;  1VD4 A;  3PUR A;  4WZ0 A;  2VP7 A;  2VJE A;  3U5O A;  1BOR A;  1E4U A;  2LN0 A;  2LGG A;  2QIZ A;  2MNZ A;  2JRJ A;  3FL2 A;  3SHB A;  2VPG A;  3KV5 A;  2K17 A;  2M3H A;  2YHO A;  4YAT A;  2Y43 A;  2XOZ A;  3O36 A;  2KYU A;  5B75 A;  4GNF A;  2C2V S;  2HYE D;  5G04 B;  2EOD A;  2YT5 A;  3PUQ A;  2FUU A;  1VYX A;  3H7H A;  4S3O C;  5J3X A;  2VPB A;  2L75 A;  2LGL A;  2CRW A;  1WEE A;  5KH7 A;  2FUI A;  3NG2 A;  1XWH A;  4PPE A;  5LKZ A;  3M99 A;  1MBM A;  1WEW A;  2K16 A;  2CSZ A;  4YAD A;  5FB1 A;  2MT5 A;  4GNG A;  2VPE A;  1MM3 A;  5I3L A;  2QJ0 A;  4F1P A;  2YQL A;  2DX8 A;  4O64 A;  3L1X A;  2JUN A;  4CCG X;  1DCQ A;  1IYM A;  2MNY A;  1FBV A;  4F52 B;  1FP0 A;  3DPL R;  3N9M A;  4B86 C;  2MA6 A;  4V3K C;  2RI7 A;  3LQI A;  3O70 A;  5H1T A;  1LDJ B;  3MHH A;  4IC3 A;  4AYC A;  2L43 A;  3O33 A;  2EGM A;  2G6Q A;  2D8U A;  2LGV A;  2CON A;  3Q1D A;  3RPG B;  3LRQ A;  1G25 A;  5LKU A;  2YU4 A;  4WZ3 B;  5DIN A;  3HTK C;  3N9N A;  4QQ4 A;  2FD4 A;  2ECT A;  4TKP B;  3QZV A;  3C5K A;  4YBT A;  5TBN A;  2QIC A;  2KRE A;  1LDK C;  3MDB C;  4WZ2 A;  4B7Y C;  2LAU A;  2CT2 A;  2KU3 A;  5SVX A;  3DDT A;  4NN2 A;  2DJA A;  2YUR A;  3M63 A;  3EB5 A;  4CA1 A;  2KWJ A;  2VNF A;  3HCS A;  4P5O B;  3E2D A;  4UI9 B;  3KQI A;  4QF3 A;  3MHS A;  5C11 A;  4ZDT A;  1WEO A;  3IHP A;  5D1M B;  5EYA F;  2DSM A;  1F62 A;  2M6M A;  5TDR A;  2KWK A;  4I7B A;  3FEH A;  2VJF B;  4YC9 A;  3O35 A;  5LCW B;  2JM3 A;  2FSA A;  3N9O A;  5G0F A;  1WEV A;  5B78 A;  3FAO A;  2B0O E;  2LV9 A;  1WEM A;  4C9Z A;  1T1H A;  3I2D A;  4MSX A;  4Q6F A;  2D8S A;  2L7P A;  2KGI A;  3LJU X;  4FK5 A;  3LQJ A;  4WA6 A;  2EXU A;  2G43 A;  4LK9 A;  2ZET C;  2XB1 A;  4UP5 A;  2CRR A;  3U5N A;  5AIT A;  4IC2 A;  5SVI B;  1WES A;  4FIP A;  4I7D A;  2L5U A;  3FAN A;  2L80 A;  2RR4 A;  3SOX A;  3T7L A;  2F6N A;  4GND A;  2E61 A;  2F42 A;  1Z6U A;  5FB0 A;  2AN6 A;  4A4B A;  2JMD A;  4OGC A;  2YRE A;  4R7E A;  5LKX A;  5B8D A;  1CHC A;  4Z0R A;  5G05 B;  2LGK A;  3N9P A;  3ZVY A;  1X4U A;  1JM7 B;  3ZTG A;  2YYR A;  5D1K B;  2KWN A;  4X3G A;  3O47 A;  1Z60 A;  4BBQ A;  3U5P A;  5FER A;  4V3L C;  1WIM A;  4A0C D;  2LDR A;  2H0D B;  3M7K A;  1VFY A;  4I7C A;  2EA6 A;  1U6G B;  1WIL A;  2ECN A;  2OXQ C;  3ZNI A;  3LVR E;  2CKL B;  2RSD A;  3GV4 A;  5KH3 A;  1WEN A;  5B76 A;  3M62 A;  4MVT A;  2YHN A;  3SOU A;  3LVQ E;  2KE1 A;  3T6R A;  1X4J A;  5SVY A;  1WEP A;  4XI1 A;  5H1U A;  1JOC A;  4AUQ B;  4GNE A;  2CSV A;  4AYC B;  2KKY A;  2EGP A;  1DVP A;  2CSY A;  2YUC A;  4OGE A;  4R2Y A;  3JUE A;  2IDA A;  2M85 A;  3O34 A;  4GB0 A;  4LKA A;  4L7X A;  3RPG C;  2YSM A;  2LQ6 A;  1HYI A;  5H9M A;  2YVR A;  5K3Q A;  2LRI C;  2FFW A;  2XP0 A;  3HCU A;  4LAD B;  1K2F A;  2I50 A;  2MKE A;  5SVI A;  3ZPV 1;  1V87 A;  2IQJ A;  2C2L A;  5DKA A;  5JG6 A;  2ECG A;  3V43 A;  4QF2 A;  3FJU B;  1WEQ A;  2HDP A; 
#chains in the Genus database with same CATH homology
 4LLB A;  2VPD A;  2PNX A;  4AP4 A;  5KH9 A;  4A49 A;  2PUY A;  3LQH A;  3L11 A;  2K4D A;  4YBM A;  5C13 A;  1JM7 A;  5FEY A;  2KWO A;  3O7A A;  2M1R A;  2VJE B;  1Z2Q A;  1ZBD B;  4PTB A;  1MM2 A;  2UZG A;  2MA5 A;  4YAB A;  3C6W A;  2YQM A;  2H0D A;  2Y1M A;  3KNV A;  3ZPV E;  5B79 A;  4L58 A;  3SOW A;  5AIU A;  2CKL A;  1HYJ A;  3U5M A;  2F6J A;  2ECI A;  4FO9 A;  3GL6 A;  1N87 A;  4ZUX U;  2K1J A;  2NAA A;  4AVX A;  4YBS A;  2L0B A;  2XEU A;  4A4C A;  4YAX A;  3ASL A;  2ECW A;  1WGM A;  3DQV R;  5B77 A;  4W4U A;  3ZYQ A;  5H1V A;  2KR4 A;  1WFK A;  3N9Q A;  4UP0 A;  1WEU A;  3HCT A;  1WE9 A;  1X4I A;  2KGG A;  2ECV A;  4ZQL A;  3PHD A;  5TAB A;  1RMD A;  3N9L A;  2YSJ A;  2ECJ A;  2Y1N A;  2KIZ A;  5D1L B;  5TDW A;  2JMJ A;  3L1Z B;  4N3W A;  2VJF A;  4FJC A;  2G45 A;  5LKT A;  2LXH C;  4LJN A;  2MIQ A;  3ZVZ B;  2KFT A;  4R8P K;  2BAY A;  2LXP C;  4S3O B;  4N4F A;  4BHW A;  2JMI A;  5TRB A;  2MUM A;  2MD7 B;  2E6S A;  3EB6 A;  3O37 A;  2MD8 C;  2YW8 A;  3KV6 A;  3RTR B;  3VK6 A;  2E6R A;  1VD4 A;  3PUR A;  4WZ0 A;  2VP7 A;  2VJE A;  3U5O A;  1BOR A;  1E4U A;  2LN0 A;  2LGG A;  2QIZ A;  2MNZ A;  2JRJ A;  3FL2 A;  3SHB A;  2VPG A;  3KV5 A;  2K17 A;  2M3H A;  2YHO A;  4YAT A;  2Y43 A;  3O36 A;  2KYU A;  5B75 A;  4GNF A;  2C2V S;  2HYE D;  5G04 B;  2EOD A;  2YT5 A;  3PUQ A;  2FUU A;  1VYX A;  4S3O C;  5J3X A;  2VPB A;  2L75 A;  2LGL A;  1WEE A;  5KH7 A;  2FUI A;  3NG2 A;  1XWH A;  4PPE A;  5LKZ A;  3M99 A;  1WEW A;  2K16 A;  2CSZ A;  4YAD A;  5FB1 A;  2MT5 A;  4GNG A;  2VPE A;  1MM3 A;  5I3L A;  2QJ0 A;  2YQL A;  2DX8 A;  4O64 A;  3L1X A;  4CCG X;  1IYM A;  2MNY A;  1FBV A;  4F52 B;  1FP0 A;  3DPL R;  3N9M A;  4B86 C;  2MA6 A;  4V3K C;  2RI7 A;  3LQI A;  3O70 A;  5H1T A;  1LDJ B;  3MHH A;  4IC3 A;  4AYC A;  2L43 A;  3O33 A;  2G6Q A;  2LGV A;  3RPG B;  3LRQ A;  1G25 A;  5LKU A;  2YU4 A;  4WZ3 B;  5DIN A;  3HTK C;  3N9N A;  2ECT A;  4TKP B;  3QZV A;  3C5K A;  4YBT A;  5TBN A;  2QIC A;  2KRE A;  1LDK C;  4WZ2 A;  4B7Y C;  2CT2 A;  2KU3 A;  4NN2 A;  2YUR A;  3M63 A;  3EB5 A;  4CA1 A;  2KWJ A;  2VNF A;  3HCS A;  4P5O B;  4UI9 B;  3KQI A;  4QF3 A;  3MHS A;  5C11 A;  4ZDT A;  1WEO A;  3IHP A;  5D1M B;  5EYA F;  1F62 A;  2M6M A;  5TDR A;  2KWK A;  4I7B A;  2VJF B;  4YC9 A;  3O35 A;  5LCW B;  2FSA A;  3N9O A;  5G0F A;  1WEV A;  5B78 A;  2LV9 A;  1WEM A;  4C9Z A;  1T1H A;  3I2D A;  4MSX A;  4Q6F A;  2D8S A;  2KGI A;  4FK5 A;  3LQJ A;  4WA6 A;  2G43 A;  4LK9 A;  2ZET C;  2XB1 A;  4UP5 A;  3U5N A;  5AIT A;  4IC2 A;  1WES A;  4FIP A;  4I7D A;  2L5U A;  2L80 A;  3SOX A;  3T7L A;  2F6N A;  4GND A;  2F42 A;  5FB0 A;  1Z6U A;  4A4B A;  2AN6 A;  2JMD A;  2YRE A;  4R7E A;  5LKX A;  5B8D A;  1CHC A;  5G05 B;  2LGK A;  3N9P A;  3ZVY A;  1X4U A;  1JM7 B;  3ZTG A;  2YYR A;  5D1K B;  2KWN A;  4X3G A;  3U5P A;  1Z60 A;  4BBQ A;  5FER A;  4V3L C;  1WIM A;  4A0C D;  2LDR A;  2H0D B;  1VFY A;  4I7C A;  2EA6 A;  1U6G B;  1WIL A;  2ECN A;  2OXQ C;  3ZNI A;  2CKL B;  2RSD A;  3GV4 A;  5KH3 A;  1WEN A;  5B76 A;  3M62 A;  4MVT A;  2YHN A;  3SOU A;  2KE1 A;  3T6R A;  1X4J A;  1WEP A;  4XI1 A;  5H1U A;  1JOC A;  4AUQ B;  4GNE A;  4AYC B;  2EGP A;  1DVP A;  2CSY A;  2YUC A;  4R2Y A;  3O34 A;  2IDA A;  2M85 A;  4GB0 A;  4LKA A;  4L7X A;  3RPG C;  2YSM A;  2LQ6 A;  1HYI A;  5H9M A;  2LRI C;  3HCU A;  4LAD B;  1K2F A;  2I50 A;  3ZPV 1;  1V87 A;  2C2L A;  5DKA A;  5JG6 A;  2ECG A;  3V43 A;  4QF2 A;  1WEQ A;  2HDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...