4LKAA

Crystal structure of moz double phd finger histone h3k9ac complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
total genus 28
structure length 126
sequence length 126
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4lkaA00
4LJNA 3LQJA 2AN6A 4LADB 5H9MA 2VJFA 1BORA 2XEUA 3N9NA 2FUIA 1WEEA 2VPDA 2M3HA 2IDAA 2ZETC 3DQVR 4WZ2A 4IC2A 4F52B 2KWKA 2G6QA 4UI9B 1HYIA 3N9LA 2CT2A 4V3KC 5G05B 3O34A 3PURA 4S3OB 3SOWA 2KWNA 1XWHA 3V43A 1Z2QA 3EB5A 2ECJA 2ECWA 2LV9A 2KYUA 3ZPV1 2G43A 5FERA 2YQLA 4R8PK 5LKXA 4I7CA 4TKPB 4GNGA 2YQMA 2YSJA 3VK6A 2LQ6A 2EGPA 1WESA 3QZVA 5LKUA 4GNFA 2YYRA 4FJCA 2C2LA 4AP4A 1WEVA 4ZQLA 1WIMA 4YBSA 2M85A 1MM2A 1FP0A 3N9PA 5C13A 3M63A 2EA6A 1JM7A 5LKZA 1WE9A 3L11A 4V3LC 2YHNA 5B78A 3U5NA 2VPBA 1ZBDB 2LGLA 2M1RA 2PUYA 2LGVA 3L1ZB 1X4UA 5G0FA 5J3XA 5TDRA 2G45A 1WEMA 1WEWA 2OXQC 2XB1A 4YBTA 4A4CA 2LRIC 2MIQA 4CCGX 4PPEA 2C2VS 4YAXA 2MA5A 2E6SA 4B86C 4FK5A 3U5PA 2K17A 2KREA 5FB0A 4L7XA 3ASLA 5B76A 2VNFA 3HCTA 3SOUA 3T6RA 2YUCA 2CKLB 2JRJA 4FIPA 2E6RA 4ZDTA 4YADA 2ECTA 2L0BA 2L43A 2Y1MA 5TABA 5TDWA 4B7YC 4UP0A 2Y43A 1V87A 5H1VA 5I3LA 2MNYA 4AUQB 2RI7A 2D8SA 2FUUA 5JG6A 2KGIA 4R7EA 3ZNIA 4YATA 5D1LB 4O64A 3O35A 2ECGA 2DX8A 3SHBA 1FBVA 2YW8A 2HYED 2F6NA 1WGMA 2Y1NA 2MD7B 2KU3A 5AIUA 4QF2A 2MT5A 2JMDA 1LDKC 5AITA 3RTRB 2KWJA 2LN0A 3PHDA 5DKAA 4GNEA 1WEUA 2ECIA 3HCUA 3RPGB 1Z60A 2RSDA 2LXHC 5D1MB 1WILA 3ZTGA 2EODA 2FSAA 4ZUXU 2MUMA 4MSXA 3O7AA 5DINA 3LQHA 4N3WA 4A0CD 3C6WA 4AYCB 5B8DA 1WENA 3GV4A 5TRBA 3DPLR 4PTBA 1CHCA 4I7DA 5KH9A 3SOXA 2JMJA 2CSZA 3ZVYA 1X4JA 3GL6A 3ZVZB 5D1KB 5TBNA 1G25A 1WEPA 2YURA 1F62A 3HCSA 2QIZA 3M99A 4FO9A 4S3OC 2LDRA 2UZGA 5H1UA 1HYJA 3U5MA 2NAAA 4N4FA 1WEOA 2PNXA 4W4UA 2JMIA 4GNDA 2VJEA 1WEQA 3N9MA 2KIZA 2VPGA 3HTKC 3IHPA 4WA6A 5H1TA 1E4UA 2YSMA 2KWOA 2LGGA 4QF3A 5LKTA 3KV5A 4AYCA 2CKLA 2VPEA 1VYXA 1DVPA 2VP7A 4AVXA 3ZYQA 2KR4A 5B75A 4X3GA 1Z6UA 2K16A 5EYAF 3PUQA 3O37A 4R2YA 4MVTA 4YBMA 2YREA 3L1XA 4UP5A 1MM3A 4LK9A 1U6GB 2LGKA 2YHOA 2BAYA 3C5KA 1WFKA 2K4DA 1K2FA 3M62A 4IC3A 1RMDA 2LXPC 3KQIA 3O36A 2F6JA 2K1JA 5B77A 5KH3A 4LLBA 2QJ0A 2F42A 4XI1A 3N9OA 3LQIA 2ECVA 2HDPA 2L5UA 4YABA 2VJEB 2MNZA 4BHWA 5B79A 1JOCA 2M6MA 3N9QA 2I50A 1LDJB 5C11A 2CSYA 3MHHA 4P5OB 2KE1A 1VD4A 4A49A 1VFYA 4I7BA 1IYMA 4NN2A 1T1HA 3ZPVE 2L75A 4WZ0A 3NG2A 1X4IA 2YT5A 2VJFB 1JM7B 3EB6A 4Q6FA 3O70A 4CA1A 4C9ZA 5FB1A 3O33A 3LRQA 5LCWB 2H0DA 3T7LA 2QICA 3RPGC 2KGGA 2MA6A 4A4BA 3U5OA 3KV6A 5KH7A 4GB0A 4YC9A 3MHSA 4L58A 3FL2A 4WZ3B 2MD8C 5G04B 2L80A 3KNVA 4LKAA 2KFTA 5FEYA 2YU4A 2ECNA 4BBQA 2H0DB 1N87A 3I2DA
chains in the Genus database with same CATH superfamily
4LJNA 3LQJA 2AN6A 4LADB 5H9MA 2VJFA 3LVRE 2EGMA 1BORA 2XEUA 3N9NA 2FUIA 1WEEA 2VPDA 2M3HA 2IDAA 2CRWA 2ZETC 3DQVR 4WZ2A 4OGCA 4IC2A 4F52B 2KWKA 2G6QA 4UI9B 1HYIA 3N9LA 2EXUA 2CT2A 4V3KC 5G05B 3O34A 3PURA 4S3OB 3SOWA 2KWNA 1XWHA 3V43A 1Z2QA 3EB5A 2ECJA 2ECWA 2LV9A 5SVIA 2KYUA 3ZPV1 2G43A 5FERA 2YQLA 4R8PK 5LKXA 4I7CA 4TKPB 4GNGA 2YQMA 2YSJA 3VK6A 1DCQA 2LQ6A 2EGPA 1WESA 3QZVA 5LKUA 4GNFA 2YYRA 2P57A 4FJCA 2C2LA 4AP4A 1WEVA 3DDTA 1WIMA 4ZQLA 3SUBA 4YBSA 3O47A 2M85A 1MM2A 1FP0A 3FEHA 3N9PA 5C13A 3M63A 2EA6A 1JM7A 5LKZA 1WE9A 3L11A 4V3LC 2YHNA 2CONA 5B78A 3U5NA 2VPBA 1ZBDB 2LGLA 2M1RA 2PUYA 2LGVA 3L1ZB 1X4UA 5G0FA 5J3XA 5TDRA 2G45A 1WEMA 1WEWA 2OXQC 2XB1A 3FJUB 4YBTA 4A4CA 2LRIC 2MIQA 4CCGX 4PPEA 2C2VS 4YAXA 5SVXA 2MA5A 2E6SA 4B86C 4FK5A 3U5PA 2K17A 2KREA 5FB0A 4L7XA 3E2DA 1MBMA 3KDEC 3ASLA 5B76A 2VNFA 3HCTA 3SOUA 3T6RA 2YUCA 2CKLB 2JRJA 4FIPA 2E6RA 4ZDTA 4YADA 2ECTA 2L0BA 2L43A 2Y1MA 5TABA 5TDWA 4B7YC 4UP0A 2Y43A 1V87A 2XOZA 5H1VA 5I3LA 2MNYA 2JM3A 4AUQB 2RI7A 2D8SA 2FUUA 5JG6A 2KGIA 3LDYA 3JUEA 4O62A 4R7EA 3ZNIA 2B0OE 4YATA 5D1LB 4O64A 2CSVA 4H9DA 3O35A 2ECGA 2FD4A 2XOYA 2DX8A 3SHBA 1FBVA 2YW8A 4Z0OA 2HYED 2F6NA 3M7KA 1WGMA 2Y1NA 2MD7B 2KU3A 5AIUA 4QF2A 2MT5A 2JMDA 1LDKC 5AITA 3RTRB 2KWJA 2LN0A 3PHDA 5DKAA 3FM8C 4GNEA 1WEUA 2D8UA 2ECIA 3HCUA 3RPGB 1Z60A 2RSDA 2LXHC 5D1MB 1WILA 3ZTGA 5SVIB 2EODA 2FSAA 4ZUXU 2MUMA 4MSXA 3O7AA 5DINA 3T9KA 2KKYA 3LQHA 4N3WA 2XOCA 3PLWA 4A0CD 3C6WA 4AYCB 5B8DA 1WENA 3GV4A 5TRBA 3DPLR 4PTBA 1CHCA 4I7DA 5KH9A 3SOXA 2JMJA 2CSZA 3ZVYA 1X4JA 3GL6A 3ZVZB 5D1KB 5TBNA 2DSMA 1G25A 3DWDA 1WEPA 2YURA 1F62A 3HCSA 2QIZA 3M99A 4FO9A 4S3OC 2LDRA 2UZGA 2M13A 5H1UA 1HYJA 3U5MA 2NAAA 4N4FA 1WEOA 2PNXA 4W4UA 3FAOA 2JMIA 4GNDA 2VJEA 1WEQA 3N9MA 2KIZA 2VPGA 3HTKC 3IHPA 3LVQE 4WA6A 5H1TA 1E4UA 2YSMA 3H7HA 2KWOA 2LGGA 4QF3A 5LKTA 2IQJA 3KV5A 2DJAA 4AYCA 2CKLA 2VPEA 1VYXA 1DVPA 2VP7A 4AVXA 3ZYQA 4Z0RA 2KR4A 5B75A 4X3GA 1Z6UA 2K16A 2FFWA 5EYAF 3PUQA 3O37A 4R2YA 4MVTA 4YBMA 2YREA 3L1XA 4UP5A 1MM3A 4LK9A 1U6GB 2LGKA 2YHOA 2BAYA 3C5KA 2OWAA 1WFKA 2K4DA 1K2FA 3M62A 4IC3A 1RMDA 2LXPC 3KQIA 3O36A 2F6JA 2K1JA 5B77A 5KH3A 4LLBA 2QJ0A 4F1PA 2F42A 2MKEA 2E61A 4XI1A 3N9OA 3LQIA 2ECVA 2HDPA 2L5UA 2VJEB 4YABA 2MNZA 4QQ4A 4BHWA 5B79A 1JOCA 2M6MA 3N9QA 5SVYA 2I50A 1LDJB 2CRRA 5C11A 2CSYA 3MHHA 2KKXA 4P5OB 2KE1A 1VD4A 4A49A 1VFYA 4I7BA 1IYMA 4NN2A 1T1HA 3ZPVE 2L75A 3FANA 4WZ0A 3NG2A 1X4IA 2YT5A 2VJFB 1JM7B 3EB6A 4Q6FA 3O70A 4CA1A 4C9ZA 5FB1A 3O33A 3LRQA 5LCWB 2H0DA 3T7LA 2RR4A 2QICA 3RPGC 2KGGA 2L7PA 3MDBC 2MA6A 4A4BA 3U5OA 3KV6A 5KH7A 4GB0A 4YC9A 3MHSA 4L58A 3FL2A 4WZ3B 2MD8C 5G04B 2L80A 2LAUA 2YVRA 3KNVA 4LKAA 2KFTA 5FEYA 5K3QA 2YU4A 2ECNA 2JUNA 2XP0A 3LJUX 3Q1DA 4BBQA 2H0DB 1N87A 4OGEA 3I2DA
chains in the Genus database with same CATH topology
4LJNA 3LQJA 2AN6A 4LADB 5H9MA 2VJFA 1BORA 2XEUA 3N9NA 2FUIA 1WEEA 2VPDA 2M3HA 2IDAA 2ZETC 3DQVR 4WZ2A 4IC2A 4F52B 2KWKA 2G6QA 4UI9B 1HYIA 3N9LA 2CT2A 4V3KC 5G05B 3O34A 3PURA 4S3OB 3SOWA 2KWNA 1XWHA 3V43A 1Z2QA 3EB5A 2ECJA 2ECWA 2LV9A 2KYUA 3ZPV1 2G43A 5FERA 2YQLA 4R8PK 5LKXA 4I7CA 4TKPB 4GNGA 2YQMA 2YSJA 3VK6A 2LQ6A 2EGPA 1WESA 3QZVA 5LKUA 4GNFA 2YYRA 4FJCA 2C2LA 4AP4A 1WEVA 4ZQLA 1WIMA 4YBSA 2M85A 1MM2A 1FP0A 3N9PA 5C13A 3M63A 2EA6A 1JM7A 5LKZA 1WE9A 3L11A 4V3LC 2YHNA 5B78A 3U5NA 2VPBA 1ZBDB 2LGLA 2M1RA 2PUYA 2LGVA 3L1ZB 1X4UA 5G0FA 5J3XA 5TDRA 2G45A 1WEMA 1WEWA 2OXQC 2XB1A 4YBTA 4A4CA 2LRIC 2MIQA 4CCGX 4PPEA 2C2VS 4YAXA 2MA5A 2E6SA 4B86C 4FK5A 3U5PA 2K17A 2KREA 5FB0A 4L7XA 3ASLA 5B76A 2VNFA 3HCTA 3SOUA 3T6RA 2YUCA 2CKLB 2JRJA 4FIPA 2E6RA 4ZDTA 4YADA 2ECTA 2L0BA 2L43A 2Y1MA 5TABA 5TDWA 4B7YC 4UP0A 2Y43A 1V87A 5H1VA 5I3LA 2MNYA 4AUQB 2RI7A 2D8SA 2FUUA 5JG6A 2KGIA 4R7EA 3ZNIA 4YATA 5D1LB 4O64A 3O35A 2ECGA 2DX8A 3SHBA 1FBVA 2YW8A 2HYED 2F6NA 1WGMA 2Y1NA 2MD7B 2KU3A 5AIUA 4QF2A 2MT5A 2JMDA 1LDKC 5AITA 3RTRB 2KWJA 2LN0A 3PHDA 5DKAA 4GNEA 1WEUA 2ECIA 3HCUA 3RPGB 1Z60A 2RSDA 2LXHC 5D1MB 1WILA 3ZTGA 2EODA 2FSAA 4ZUXU 2MUMA 4MSXA 3O7AA 5DINA 3LQHA 4N3WA 4A0CD 3C6WA 4AYCB 5B8DA 1WENA 3GV4A 5TRBA 3DPLR 4PTBA 1CHCA 4I7DA 5KH9A 3SOXA 2JMJA 2CSZA 3ZVYA 1X4JA 3GL6A 3ZVZB 5D1KB 5TBNA 1G25A 1WEPA 2YURA 1F62A 3HCSA 2QIZA 3M99A 4FO9A 4S3OC 2LDRA 2UZGA 5H1UA 1HYJA 3U5MA 2NAAA 4N4FA 1WEOA 2PNXA 4W4UA 2JMIA 4GNDA 2VJEA 1WEQA 3N9MA 2KIZA 2VPGA 3HTKC 3IHPA 4WA6A 5H1TA 1E4UA 2YSMA 2KWOA 2LGGA 4QF3A 5LKTA 3KV5A 4AYCA 2CKLA 2VPEA 1VYXA 1DVPA 2VP7A 4AVXA 3ZYQA 2KR4A 5B75A 4X3GA 1Z6UA 2K16A 5EYAF 3PUQA 3O37A 4R2YA 4MVTA 4YBMA 2YREA 3L1XA 4UP5A 1MM3A 4LK9A 1U6GB 2LGKA 2YHOA 2BAYA 3C5KA 1WFKA 2K4DA 1K2FA 3M62A 4IC3A 1RMDA 2LXPC 3KQIA 3O36A 2F6JA 2K1JA 5B77A 5KH3A 4LLBA 2QJ0A 2F42A 4XI1A 3N9OA 3LQIA 2ECVA 2HDPA 2L5UA 4YABA 2VJEB 2MNZA 4BHWA 5B79A 1JOCA 2M6MA 3N9QA 2I50A 1LDJB 5C11A 2CSYA 3MHHA 4P5OB 2KE1A 1VD4A 4A49A 1VFYA 4I7BA 1IYMA 4NN2A 1T1HA 3ZPVE 2L75A 4WZ0A 3NG2A 1X4IA 2YT5A 2VJFB 1JM7B 3EB6A 4Q6FA 3O70A 4CA1A 4C9ZA 5FB1A 3O33A 3LRQA 5LCWB 2H0DA 3T7LA 2QICA 3RPGC 2KGGA 2MA6A 4A4BA 3U5OA 3KV6A 5KH7A 4GB0A 4YC9A 3MHSA 4L58A 3FL2A 4WZ3B 2MD8C 5G04B 2L80A 3KNVA 4LKAA 2KFTA 5FEYA 2YU4A 2ECNA 4BBQA 2H0DB 1N87A 3I2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJN A;  3LQJ A;  2AN6 A;  4LAD B;  5H9M A;  2VJF A;  1BOR A;  2XEU A;  3N9N A;  2FUI A;  1WEE A;  2VPD A;  2M3H A;  2IDA A;  2ZET C;  3DQV R;  4WZ2 A;  4IC2 A;  4F52 B;  2KWK A;  2G6Q A;  4UI9 B;  1HYI A;  3N9L A;  2CT2 A;  4V3K C;  5G05 B;  3O34 A;  3PUR A;  4S3O B;  3SOW A;  2KWN A;  1XWH A;  3V43 A;  1Z2Q A;  3EB5 A;  2ECJ A;  2ECW A;  2LV9 A;  2KYU A;  3ZPV 1;  2G43 A;  5FER A;  2YQL A;  4R8P K;  5LKX A;  4I7C A;  4TKP B;  4GNG A;  2YQM A;  2YSJ A;  3VK6 A;  2LQ6 A;  2EGP A;  1WES A;  3QZV A;  5LKU A;  4GNF A;  2YYR A;  4FJC A;  2C2L A;  4AP4 A;  1WEV A;  4ZQL A;  1WIM A;  4YBS A;  2M85 A;  1MM2 A;  1FP0 A;  3N9P A;  5C13 A;  3M63 A;  2EA6 A;  1JM7 A;  5LKZ A;  1WE9 A;  3L11 A;  4V3L C;  2YHN A;  5B78 A;  3U5N A;  2VPB A;  1ZBD B;  2LGL A;  2M1R A;  2PUY A;  2LGV A;  3L1Z B;  1X4U A;  5G0F A;  5J3X A;  5TDR A;  2G45 A;  1WEM A;  1WEW A;  2OXQ C;  2XB1 A;  4YBT A;  4A4C A;  2LRI C;  2MIQ A;  4CCG X;  4PPE A;  2C2V S;  4YAX A;  2MA5 A;  2E6S A;  4B86 C;  4FK5 A;  3U5P A;  2K17 A;  2KRE A;  5FB0 A;  4L7X A;  3ASL A;  5B76 A;  2VNF A;  3HCT A;  3SOU A;  3T6R A;  2YUC A;  2CKL B;  2JRJ A;  4FIP A;  2E6R A;  4ZDT A;  4YAD A;  2ECT A;  2L0B A;  2L43 A;  2Y1M A;  5TAB A;  5TDW A;  4B7Y C;  4UP0 A;  2Y43 A;  1V87 A;  5H1V A;  5I3L A;  2MNY A;  4AUQ B;  2RI7 A;  2D8S A;  2FUU A;  5JG6 A;  2KGI A;  4R7E A;  3ZNI A;  4YAT A;  5D1L B;  4O64 A;  3O35 A;  2ECG A;  2DX8 A;  3SHB A;  1FBV A;  2YW8 A;  2HYE D;  2F6N A;  1WGM A;  2Y1N A;  2MD7 B;  2KU3 A;  5AIU A;  4QF2 A;  2MT5 A;  2JMD A;  1LDK C;  5AIT A;  3RTR B;  2KWJ A;  2LN0 A;  3PHD A;  5DKA A;  4GNE A;  1WEU A;  2ECI A;  3HCU A;  3RPG B;  1Z60 A;  2RSD A;  2LXH C;  5D1M B;  1WIL A;  3ZTG A;  2EOD A;  2FSA A;  4ZUX U;  2MUM A;  4MSX A;  3O7A A;  5DIN A;  3LQH A;  4N3W A;  4A0C D;  3C6W A;  4AYC B;  5B8D A;  1WEN A;  3GV4 A;  5TRB A;  3DPL R;  4PTB A;  1CHC A;  4I7D A;  5KH9 A;  3SOX A;  2JMJ A;  2CSZ A;  3ZVY A;  1X4J A;  3GL6 A;  3ZVZ B;  5D1K B;  5TBN A;  1G25 A;  1WEP A;  2YUR A;  1F62 A;  3HCS A;  2QIZ A;  3M99 A;  4FO9 A;  4S3O C;  2LDR A;  2UZG A;  5H1U A;  1HYJ A;  3U5M A;  2NAA A;  4N4F A;  1WEO A;  2PNX A;  4W4U A;  2JMI A;  4GND A;  2VJE A;  1WEQ A;  3N9M A;  2KIZ A;  2VPG A;  3HTK C;  3IHP A;  4WA6 A;  5H1T A;  1E4U A;  2YSM A;  2KWO A;  2LGG A;  4QF3 A;  5LKT A;  3KV5 A;  4AYC A;  2CKL A;  2VPE A;  1VYX A;  1DVP A;  2VP7 A;  4AVX A;  3ZYQ A;  2KR4 A;  5B75 A;  4X3G A;  1Z6U A;  2K16 A;  5EYA F;  3PUQ A;  3O37 A;  4R2Y A;  4MVT A;  4YBM A;  2YRE A;  3L1X A;  4UP5 A;  1MM3 A;  4LK9 A;  1U6G B;  2LGK A;  2YHO A;  2BAY A;  3C5K A;  1WFK A;  2K4D A;  1K2F A;  3M62 A;  4IC3 A;  1RMD A;  2LXP C;  3KQI A;  3O36 A;  2F6J A;  2K1J A;  5B77 A;  5KH3 A;  4LLB A;  2QJ0 A;  2F42 A;  4XI1 A;  3N9O A;  3LQI A;  2ECV A;  2HDP A;  2L5U A;  4YAB A;  2VJE B;  2MNZ A;  4BHW A;  5B79 A;  1JOC A;  2M6M A;  3N9Q A;  2I50 A;  1LDJ B;  5C11 A;  2CSY A;  3MHH A;  4P5O B;  2KE1 A;  1VD4 A;  4A49 A;  1VFY A;  4I7B A;  1IYM A;  4NN2 A;  1T1H A;  3ZPV E;  2L75 A;  4WZ0 A;  3NG2 A;  1X4I A;  2YT5 A;  2VJF B;  1JM7 B;  3EB6 A;  4Q6F A;  3O70 A;  4CA1 A;  4C9Z A;  5FB1 A;  3O33 A;  3LRQ A;  5LCW B;  2H0D A;  3T7L A;  2QIC A;  3RPG C;  2KGG A;  2MA6 A;  4A4B A;  3U5O A;  3KV6 A;  5KH7 A;  4GB0 A;  4YC9 A;  3MHS A;  4L58 A;  3FL2 A;  4WZ3 B;  2MD8 C;  5G04 B;  2L80 A;  3KNV A;  4LKA A;  2KFT A;  5FEY A;  2YU4 A;  2ECN A;  4BBQ A;  2H0D B;  1N87 A;  3I2D A; 
#chains in the Genus database with same CATH topology
 4LJN A;  3LQJ A;  2AN6 A;  4LAD B;  5H9M A;  2VJF A;  3LVR E;  2EGM A;  1BOR A;  2XEU A;  3N9N A;  2FUI A;  1WEE A;  2VPD A;  2M3H A;  2IDA A;  2CRW A;  2ZET C;  3DQV R;  4WZ2 A;  4OGC A;  4IC2 A;  4F52 B;  2KWK A;  2G6Q A;  4UI9 B;  1HYI A;  3N9L A;  2EXU A;  2CT2 A;  4V3K C;  5G05 B;  3O34 A;  3PUR A;  4S3O B;  3SOW A;  2KWN A;  1XWH A;  3V43 A;  1Z2Q A;  3EB5 A;  2ECJ A;  2ECW A;  2LV9 A;  5SVI A;  2KYU A;  3ZPV 1;  2G43 A;  5FER A;  2YQL A;  4R8P K;  5LKX A;  4I7C A;  4TKP B;  4GNG A;  2YQM A;  2YSJ A;  3VK6 A;  1DCQ A;  2LQ6 A;  2EGP A;  1WES A;  3QZV A;  5LKU A;  4GNF A;  2YYR A;  2P57 A;  4FJC A;  2C2L A;  4AP4 A;  1WEV A;  3DDT A;  1WIM A;  4ZQL A;  3SUB A;  4YBS A;  3O47 A;  2M85 A;  1MM2 A;  1FP0 A;  3FEH A;  3N9P A;  5C13 A;  3M63 A;  2EA6 A;  1JM7 A;  5LKZ A;  1WE9 A;  3L11 A;  4V3L C;  2YHN A;  2CON A;  5B78 A;  3U5N A;  2VPB A;  1ZBD B;  2LGL A;  2M1R A;  2PUY A;  2LGV A;  3L1Z B;  1X4U A;  5G0F A;  5J3X A;  5TDR A;  2G45 A;  1WEM A;  1WEW A;  2OXQ C;  2XB1 A;  3FJU B;  4YBT A;  4A4C A;  2LRI C;  2MIQ A;  4CCG X;  4PPE A;  2C2V S;  4YAX A;  5SVX A;  2MA5 A;  2E6S A;  4B86 C;  4FK5 A;  3U5P A;  2K17 A;  2KRE A;  5FB0 A;  4L7X A;  3E2D A;  1MBM A;  3KDE C;  3ASL A;  5B76 A;  2VNF A;  3HCT A;  3SOU A;  3T6R A;  2YUC A;  2CKL B;  2JRJ A;  4FIP A;  2E6R A;  4ZDT A;  4YAD A;  2ECT A;  2L0B A;  2L43 A;  2Y1M A;  5TAB A;  5TDW A;  4B7Y C;  4UP0 A;  2Y43 A;  1V87 A;  2XOZ A;  5H1V A;  5I3L A;  2MNY A;  2JM3 A;  4AUQ B;  2RI7 A;  2D8S A;  2FUU A;  5JG6 A;  2KGI A;  3LDY A;  3JUE A;  4O62 A;  4R7E A;  3ZNI A;  2B0O E;  4YAT A;  5D1L B;  4O64 A;  2CSV A;  4H9D A;  3O35 A;  2ECG A;  2FD4 A;  2XOY A;  2DX8 A;  3SHB A;  1FBV A;  2YW8 A;  4Z0O A;  2HYE D;  2F6N A;  3M7K A;  1WGM A;  2Y1N A;  2MD7 B;  2KU3 A;  5AIU A;  4QF2 A;  2MT5 A;  2JMD A;  1LDK C;  5AIT A;  3RTR B;  2KWJ A;  2LN0 A;  3PHD A;  5DKA A;  3FM8 C;  4GNE A;  1WEU A;  2D8U A;  2ECI A;  3HCU A;  3RPG B;  1Z60 A;  2RSD A;  2LXH C;  5D1M B;  1WIL A;  3ZTG A;  5SVI B;  2EOD A;  2FSA A;  4ZUX U;  2MUM A;  4MSX A;  3O7A A;  5DIN A;  3T9K A;  2KKY A;  3LQH A;  4N3W A;  2XOC A;  3PLW A;  4A0C D;  3C6W A;  4AYC B;  5B8D A;  1WEN A;  3GV4 A;  5TRB A;  3DPL R;  4PTB A;  1CHC A;  4I7D A;  5KH9 A;  3SOX A;  2JMJ A;  2CSZ A;  3ZVY A;  1X4J A;  3GL6 A;  3ZVZ B;  5D1K B;  5TBN A;  2DSM A;  1G25 A;  3DWD A;  1WEP A;  2YUR A;  1F62 A;  3HCS A;  2QIZ A;  3M99 A;  4FO9 A;  4S3O C;  2LDR A;  2UZG A;  2M13 A;  5H1U A;  1HYJ A;  3U5M A;  2NAA A;  4N4F A;  1WEO A;  2PNX A;  4W4U A;  3FAO A;  2JMI A;  4GND A;  2VJE A;  1WEQ A;  3N9M A;  2KIZ A;  2VPG A;  3HTK C;  3IHP A;  3LVQ E;  4WA6 A;  5H1T A;  1E4U A;  2YSM A;  3H7H A;  2KWO A;  2LGG A;  4QF3 A;  5LKT A;  2IQJ A;  3KV5 A;  2DJA A;  4AYC A;  2CKL A;  2VPE A;  1VYX A;  1DVP A;  2VP7 A;  4AVX A;  3ZYQ A;  4Z0R A;  2KR4 A;  5B75 A;  4X3G A;  1Z6U A;  2K16 A;  2FFW A;  5EYA F;  3PUQ A;  3O37 A;  4R2Y A;  4MVT A;  4YBM A;  2YRE A;  3L1X A;  4UP5 A;  1MM3 A;  4LK9 A;  1U6G B;  2LGK A;  2YHO A;  2BAY A;  3C5K A;  2OWA A;  1WFK A;  2K4D A;  1K2F A;  3M62 A;  4IC3 A;  1RMD A;  2LXP C;  3KQI A;  3O36 A;  2F6J A;  2K1J A;  5B77 A;  5KH3 A;  4LLB A;  2QJ0 A;  4F1P A;  2F42 A;  2MKE A;  2E61 A;  4XI1 A;  3N9O A;  3LQI A;  2ECV A;  2HDP A;  2L5U A;  2VJE B;  4YAB A;  2MNZ A;  4QQ4 A;  4BHW A;  5B79 A;  1JOC A;  2M6M A;  3N9Q A;  5SVY A;  2I50 A;  1LDJ B;  2CRR A;  5C11 A;  2CSY A;  3MHH A;  2KKX A;  4P5O B;  2KE1 A;  1VD4 A;  4A49 A;  1VFY A;  4I7B A;  1IYM A;  4NN2 A;  1T1H A;  3ZPV E;  2L75 A;  3FAN A;  4WZ0 A;  3NG2 A;  1X4I A;  2YT5 A;  2VJF B;  1JM7 B;  3EB6 A;  4Q6F A;  3O70 A;  4CA1 A;  4C9Z A;  5FB1 A;  3O33 A;  3LRQ A;  5LCW B;  2H0D A;  3T7L A;  2RR4 A;  2QIC A;  3RPG C;  2KGG A;  2L7P A;  3MDB C;  2MA6 A;  4A4B A;  3U5O A;  3KV6 A;  5KH7 A;  4GB0 A;  4YC9 A;  3MHS A;  4L58 A;  3FL2 A;  4WZ3 B;  2MD8 C;  5G04 B;  2L80 A;  2LAU A;  2YVR A;  3KNV A;  4LKA A;  2KFT A;  5FEY A;  5K3Q A;  2YU4 A;  2ECN A;  2JUN A;  2XP0 A;  3LJU X;  3Q1D A;  4BBQ A;  2H0D B;  1N87 A;  4OGE A;  3I2D A; 
#chains in the Genus database with same CATH homology
 4LJN A;  3LQJ A;  2AN6 A;  4LAD B;  5H9M A;  2VJF A;  1BOR A;  2XEU A;  3N9N A;  2FUI A;  1WEE A;  2VPD A;  2M3H A;  2IDA A;  2ZET C;  3DQV R;  4WZ2 A;  4IC2 A;  4F52 B;  2KWK A;  2G6Q A;  4UI9 B;  1HYI A;  3N9L A;  2CT2 A;  4V3K C;  5G05 B;  3O34 A;  3PUR A;  4S3O B;  3SOW A;  2KWN A;  1XWH A;  3V43 A;  1Z2Q A;  3EB5 A;  2ECJ A;  2ECW A;  2LV9 A;  2KYU A;  3ZPV 1;  2G43 A;  5FER A;  2YQL A;  4R8P K;  5LKX A;  4I7C A;  4TKP B;  4GNG A;  2YQM A;  2YSJ A;  3VK6 A;  2LQ6 A;  2EGP A;  1WES A;  3QZV A;  5LKU A;  4GNF A;  2YYR A;  4FJC A;  2C2L A;  4AP4 A;  1WEV A;  4ZQL A;  1WIM A;  4YBS A;  2M85 A;  1MM2 A;  1FP0 A;  3N9P A;  5C13 A;  3M63 A;  2EA6 A;  1JM7 A;  5LKZ A;  1WE9 A;  3L11 A;  4V3L C;  2YHN A;  5B78 A;  3U5N A;  2VPB A;  1ZBD B;  2LGL A;  2M1R A;  2PUY A;  2LGV A;  3L1Z B;  1X4U A;  5G0F A;  5J3X A;  5TDR A;  2G45 A;  1WEM A;  1WEW A;  2OXQ C;  2XB1 A;  4YBT A;  4A4C A;  2LRI C;  2MIQ A;  4CCG X;  4PPE A;  2C2V S;  4YAX A;  2MA5 A;  2E6S A;  4B86 C;  4FK5 A;  3U5P A;  2K17 A;  2KRE A;  5FB0 A;  4L7X A;  3ASL A;  5B76 A;  2VNF A;  3HCT A;  3SOU A;  3T6R A;  2YUC A;  2CKL B;  2JRJ A;  4FIP A;  2E6R A;  4ZDT A;  4YAD A;  2ECT A;  2L0B A;  2L43 A;  2Y1M A;  5TAB A;  5TDW A;  4B7Y C;  4UP0 A;  2Y43 A;  1V87 A;  5H1V A;  5I3L A;  2MNY A;  4AUQ B;  2RI7 A;  2D8S A;  2FUU A;  5JG6 A;  2KGI A;  4R7E A;  3ZNI A;  4YAT A;  5D1L B;  4O64 A;  3O35 A;  2ECG A;  2DX8 A;  3SHB A;  1FBV A;  2YW8 A;  2HYE D;  2F6N A;  1WGM A;  2Y1N A;  2MD7 B;  2KU3 A;  5AIU A;  4QF2 A;  2MT5 A;  2JMD A;  1LDK C;  5AIT A;  3RTR B;  2KWJ A;  2LN0 A;  3PHD A;  5DKA A;  4GNE A;  1WEU A;  2ECI A;  3HCU A;  3RPG B;  1Z60 A;  2RSD A;  2LXH C;  5D1M B;  1WIL A;  3ZTG A;  2EOD A;  2FSA A;  4ZUX U;  2MUM A;  4MSX A;  3O7A A;  5DIN A;  3LQH A;  4N3W A;  4A0C D;  3C6W A;  4AYC B;  5B8D A;  1WEN A;  3GV4 A;  5TRB A;  3DPL R;  4PTB A;  1CHC A;  4I7D A;  5KH9 A;  3SOX A;  2JMJ A;  2CSZ A;  3ZVY A;  1X4J A;  3GL6 A;  3ZVZ B;  5D1K B;  5TBN A;  1G25 A;  1WEP A;  2YUR A;  1F62 A;  3HCS A;  2QIZ A;  3M99 A;  4FO9 A;  4S3O C;  2LDR A;  2UZG A;  5H1U A;  1HYJ A;  3U5M A;  2NAA A;  4N4F A;  1WEO A;  2PNX A;  4W4U A;  2JMI A;  4GND A;  2VJE A;  1WEQ A;  3N9M A;  2KIZ A;  2VPG A;  3HTK C;  3IHP A;  4WA6 A;  5H1T A;  1E4U A;  2YSM A;  2KWO A;  2LGG A;  4QF3 A;  5LKT A;  3KV5 A;  4AYC A;  2CKL A;  2VPE A;  1VYX A;  1DVP A;  2VP7 A;  4AVX A;  3ZYQ A;  2KR4 A;  5B75 A;  4X3G A;  1Z6U A;  2K16 A;  5EYA F;  3PUQ A;  3O37 A;  4R2Y A;  4MVT A;  4YBM A;  2YRE A;  3L1X A;  4UP5 A;  1MM3 A;  4LK9 A;  1U6G B;  2LGK A;  2YHO A;  2BAY A;  3C5K A;  1WFK A;  2K4D A;  1K2F A;  3M62 A;  4IC3 A;  1RMD A;  2LXP C;  3KQI A;  3O36 A;  2F6J A;  2K1J A;  5B77 A;  5KH3 A;  4LLB A;  2QJ0 A;  2F42 A;  4XI1 A;  3N9O A;  3LQI A;  2ECV A;  2HDP A;  2L5U A;  4YAB A;  2VJE B;  2MNZ A;  4BHW A;  5B79 A;  1JOC A;  2M6M A;  3N9Q A;  2I50 A;  1LDJ B;  5C11 A;  2CSY A;  3MHH A;  4P5O B;  2KE1 A;  1VD4 A;  4A49 A;  1VFY A;  4I7B A;  1IYM A;  4NN2 A;  1T1H A;  3ZPV E;  2L75 A;  4WZ0 A;  3NG2 A;  1X4I A;  2YT5 A;  2VJF B;  1JM7 B;  3EB6 A;  4Q6F A;  3O70 A;  4CA1 A;  4C9Z A;  5FB1 A;  3O33 A;  3LRQ A;  5LCW B;  2H0D A;  3T7L A;  2QIC A;  3RPG C;  2KGG A;  2MA6 A;  4A4B A;  3U5O A;  3KV6 A;  5KH7 A;  4GB0 A;  4YC9 A;  3MHS A;  4L58 A;  3FL2 A;  4WZ3 B;  2MD8 C;  5G04 B;  2L80 A;  3KNV A;  4LKA A;  2KFT A;  5FEY A;  2YU4 A;  2ECN A;  4BBQ A;  2H0D B;  1N87 A;  3I2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...