4LKAA

Crystal structure of moz double phd finger histone h3k9ac complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 28
structure length 126
sequence length 126
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4lkaA00
3L1XA 4PPEA 1HYJA 2JMDA 2K16A 4MSXA 5DINA 2YHNA 3O70A 4AUQB 2YUCA 2ECWA 4NN2A 2YU4A 4AYCA 4WA6A 2CKLB 2JMJA 3RPGB 1WEWA 4ZUXU 4A49A 1U6GB 1Z2QA 2MD7B 4O64A 4L58A 2LRIC 4ZQLA 5AIUA 3U5OA 1WEUA 2VPGA 5H9MA 2YSMA 1V87A 1VYXA 2PNXA 4C9ZA 2G43A 5D1LB 1IYMA 3I2DA 5FB0A 3PUQA 4YBSA 1WEVA 2OXQC 1K2FA 1WGMA 2Y1NA 3U5MA 2KU3A 2F6JA 5FEYA 4I7CA 4L7XA 5EYAF 4R8PK 2QICA 2CSZA 1N87A 2MA6A 3SOUA 2VNFA 4QF2A 2JRJA 2UZGA 5D1KB 2LGLA 5H1VA 2KR4A 2VPDA 2EODA 5FERA 1Z60A 1WEOA 3M62A 2YW8A 2VPEA 4LKAA 4GNGA 1E4UA 2MNYA 1LDJB 4IC2A 3PURA 4B86C 5TDRA 5TDWA 5LKZA 2MD8C 5B79A 1BORA 2YREA 4LADB 2L5UA 3NG2A 5B76A 3O35A 4B7YC 1WE9A 3RTRB 2Y43A 3O7AA 4LLBA 4WZ3B 2KWJA 1X4IA 2XB1A 2NAAA 3O33A 4FK5A 3L11A 1XWHA 5H1TA 2K4DA 2KWNA 1FP0A 2Y1MA 3LQHA 5LKTA 4FIPA 2VJFA 2K17A 4X3GA 3MHHA 2KE1A 2QJ0A 3LQJA 5C11A 4N3WA 1G25A 3GL6A 2YT5A 3SHBA 3FL2A 4W4UA 4BBQA 3N9NA 4CCGX 2FSAA 4GNFA 3EB6A 4WZ2A 2M3HA 3O36A 4GNEA 2DX8A 2I50A 2LN0A 3L1ZB 2E6RA 1RMDA 2FUUA 1WESA 3V43A 5AITA 4AVXA 1MM2A 1X4UA 5G04B 4LJNA 2HYED 3O34A 1WEEA 2L0BA 2LV9A 2VJFB 2YQMA 5LCWB 2ECVA 2KFTA 1JM7A 2KWOA 3N9MA 4YBTA 3SOWA 5G0FA 1MM3A 2M85A 3PHDA 3MHSA 4R2YA 5LKXA 2E6SA 2YSJA 3N9OA 2L80A 1WILA 5TBNA 5B8DA 2RI7A 5I3LA 2M6MA 1VD4A 3SOXA 5FB1A 2RSDA 1WEPA 4AP4A 2VPBA 1JOCA 2KWKA 4UI9B 2CT2A 5TRBA 4MVTA 1LDKC 3U5PA 4S3OC 2KIZA 3ZVYA 4BHWA 3N9LA 5J3XA 4V3LC 2VP7A 4YABA 1JM7B 1WFKA 1WEQA 2AN6A 1WENA 5LKUA 2ZETC 5G05B 3ZPVE 2ECIA 2L75A 4YBMA 3DPLR 1Z6UA 3KV5A 4R7EA 1X4JA 2KREA 2L43A 1ZBDB 3C6WA 5KH9A 5TABA 5KH3A 1WIMA 2D8SA 4I7DA 5D1MB 3O37A 2ECTA 4S3OB 4UP5A 4IC3A 2ECNA 2KYUA 3ZTGA 3ASLA 3ZNIA 3U5NA 2VJEA 1FBVA 2LGVA 2H0DB 2PUYA 4QF3A 3LRQA 2KGGA 4PTBA 2EA6A 5B75A 3QZVA 2LXPC 2YURA 2IDAA 2CSYA 1F62A 2LGKA 4P5OB 4LK9A 2JMIA 2MNZA 2QIZA 4YC9A 4V3KC 4A0CD 2C2LA 4GB0A 4WZ0A 3ZVZB 2KGIA 1HYIA 3HTKC 4YAXA 1DVPA 3LQIA 3EB5A 3KV6A 4A4BA 2HDPA 2VJEB 4CA1A 3KQIA 4XI1A 3T6RA 3C5KA 4FO9A 3KNVA 2MUMA 4I7BA 4AYCB 2FUIA 2YYRA 2LDRA 2YQLA 3DQVR 5C13A 4YATA 2G45A 3N9QA 4FJCA 3HCSA 4UP0A 4Q6FA 2MA5A 1VFYA 2BAYA 2YHOA 3VK6A 1WEMA 3HCTA 2K1JA 2M1RA 4A4CA 2C2VS 4F52B 4ZDTA 2F42A 2H0DA 3M63A 4TKPB 2LQ6A 3HCUA 2CKLA 3N9PA 3T7LA 2MT5A 3M99A 2ECGA 2G6QA 5DKAA 3ZPV1 3ZYQA 2ECJA 1T1HA 2MIQA 3GV4A 1CHCA 3IHPA 2XEUA 4GNDA 2LGGA 4N4FA 5B77A 5KH7A 2EGPA 2LXHC 3RPGC 2F6NA 5H1UA 4YADA 5B78A 5JG6A
chains in the Genus database with same CATH superfamily
2XP0A 3L1XA 4PPEA 1HYJA 2JMDA 2K16A 4MSXA 2FFWA 5DINA 2YHNA 3O70A 4OGEA 2DSMA 4AUQB 2YUCA 2ECWA 4NN2A 2YU4A 4AYCA 2KKYA 4WA6A 2CKLB 2JMJA 3RPGB 1WEWA 4ZUXU 4A49A 1U6GB 1Z2QA 2MD7B 4O64A 2KKXA 4L58A 4Z0RA 2LRIC 4ZQLA 2JM3A 5AIUA 3U5OA 1WEUA 2VPGA 5H9MA 2YSMA 1V87A 1VYXA 2PNXA 3KDEC 4C9ZA 2G43A 5D1LB 2CRWA 1IYMA 2XOCA 3I2DA 5FB0A 3PUQA 2FD4A 2P57A 4YBSA 1WEVA 2OXQC 1K2FA 1WGMA 2Y1NA 3U5MA 2KU3A 2F6JA 5FEYA 4I7CA 4L7XA 5EYAF 3FEHA 4R8PK 4F1PA 2QICA 2CSZA 1N87A 2MA6A 3SOUA 3M7KA 2VNFA 4Z0OA 4QF2A 2JRJA 2UZGA 5D1KB 2LGLA 4O62A 5H1VA 2KR4A 2VPDA 2EODA 5FERA 1Z60A 2CRRA 1WEOA 3M62A 2YW8A 2VPEA 4LKAA 4GNGA 1E4UA 2MNYA 2CONA 5SVIA 1LDJB 4IC2A 3PURA 4B86C 5TDRA 5TDWA 5LKZA 2MD8C 5B79A 1BORA 2LAUA 2YREA 4LADB 2L5UA 3NG2A 5B76A 3O35A 4B7YC 1WE9A 3RTRB 2Y43A 3O7AA 4LLBA 4WZ3B 2KWJA 1X4IA 2XB1A 2NAAA 3O33A 4FK5A 3L11A 1XWHA 3Q1DA 5H1TA 2K4DA 2KWNA 1FP0A 3FJUB 2Y1MA 3LQHA 5LKTA 4FIPA 2VJFA 2K17A 4X3GA 3MHHA 2KE1A 2QJ0A 3LQJA 5C11A 1DCQA 4N3WA 1G25A 3GL6A 5SVIB 2YT5A 3SHBA 3FL2A 4W4UA 4BBQA 3N9NA 3E2DA 4CCGX 2FSAA 4GNFA 3EB6A 3PLWA 3LJUX 4WZ2A 2M3HA 3O36A 4GNEA 2DX8A 2I50A 2LN0A 2E61A 3L1ZB 2E6RA 1RMDA 2FUUA 1WESA 4QQ4A 3V43A 5AITA 4AVXA 4OGCA 2CSVA 1MM2A 1X4UA 5G04B 4LJNA 2HYED 3O34A 1WEEA 2L0BA 2LV9A 3LVRE 2VJFB 2YQMA 5LCWB 2ECVA 2KFTA 1JM7A 2KWOA 3N9MA 4YBTA 3SOWA 5G0FA 2RR4A 1MM3A 2M85A 2YVRA 3PHDA 2M13A 3MHSA 4R2YA 5LKXA 3DDTA 2E6SA 2XOYA 2YSJA 3N9OA 2L80A 2L7PA 1WILA 5TBNA 5B8DA 2RI7A 5I3LA 2MKEA 2M6MA 1VD4A 3SOXA 5FB1A 2RSDA 1WEPA 4AP4A 3FANA 2VPBA 1JOCA 5K3QA 2KWKA 4UI9B 2CT2A 2EXUA 5TRBA 4MVTA 1LDKC 3U5PA 4S3OC 2KIZA 3ZVYA 4BHWA 3N9LA 5J3XA 4V3LC 2EGMA 2VP7A 4YABA 3MDBC 1JM7B 1WFKA 1WEQA 2AN6A 3SUBA 1WENA 3O47A 5LKUA 2ZETC 5G05B 3ZPVE 2ECIA 2L75A 4YBMA 3DPLR 1Z6UA 3KV5A 4R7EA 1X4JA 2KREA 2L43A 1ZBDB 3C6WA 5KH9A 5TABA 5KH3A 1WIMA 2D8SA 4I7DA 5D1MB 3O37A 2ECTA 4H9DA 2B0OE 4S3OB 4UP5A 4IC3A 2ECNA 2KYUA 3ZTGA 3ASLA 3ZNIA 3U5NA 2VJEA 2XOZA 1FBVA 2JUNA 2LGVA 2H0DB 2PUYA 4QF3A 3LRQA 2KGGA 4PTBA 2EA6A 5B75A 3QZVA 2LXPC 2YURA 2IDAA 2CSYA 1F62A 2LGKA 4P5OB 4LK9A 2IQJA 2JMIA 2MNZA 2QIZA 4YC9A 4V3KC 4A0CD 1MBMA 2C2LA 4GB0A 4WZ0A 3ZVZB 2KGIA 3LDYA 1HYIA 3HTKC 3FM8C 3FAOA 4YAXA 1DVPA 3LQIA 3EB5A 3KV6A 4A4BA 2HDPA 2VJEB 4CA1A 3KQIA 4XI1A 3T6RA 3C5KA 4FO9A 3KNVA 2MUMA 5SVYA 4I7BA 2D8UA 4AYCB 2FUIA 2YYRA 3H7HA 2LDRA 2YQLA 3DQVR 5C13A 4YATA 2G45A 2DJAA 3N9QA 5SVXA 4FJCA 3HCSA 4UP0A 4Q6FA 2MA5A 1VFYA 2BAYA 2YHOA 3T9KA 3VK6A 1WEMA 3HCTA 2K1JA 2M1RA 4A4CA 2C2VS 4F52B 4ZDTA 2F42A 2H0DA 3M63A 4TKPB 3DWDA 2LQ6A 3JUEA 3HCUA 2CKLA 3N9PA 3T7LA 2MT5A 3M99A 2ECGA 2G6QA 5DKAA 3ZPV1 3ZYQA 2ECJA 1T1HA 2MIQA 3GV4A 1CHCA 3LVQE 3IHPA 2OWAA 2XEUA 4GNDA 2LGGA 4N4FA 5B77A 5KH7A 2EGPA 2LXHC 3RPGC 2F6NA 5H1UA 4YADA 5B78A 5JG6A
chains in the Genus database with same CATH topology
3L1XA 4PPEA 1HYJA 2JMDA 2K16A 4MSXA 5DINA 2YHNA 3O70A 4AUQB 2YUCA 2ECWA 4NN2A 2YU4A 4AYCA 4WA6A 2CKLB 2JMJA 3RPGB 1WEWA 4ZUXU 4A49A 1U6GB 1Z2QA 2MD7B 4O64A 4L58A 2LRIC 4ZQLA 5AIUA 3U5OA 1WEUA 2VPGA 5H9MA 2YSMA 1V87A 1VYXA 2PNXA 4C9ZA 2G43A 5D1LB 1IYMA 3I2DA 5FB0A 3PUQA 4YBSA 1WEVA 2OXQC 1K2FA 1WGMA 2Y1NA 3U5MA 2KU3A 2F6JA 5FEYA 4I7CA 4L7XA 5EYAF 4R8PK 2QICA 2CSZA 1N87A 2MA6A 3SOUA 2VNFA 4QF2A 2JRJA 2UZGA 5D1KB 2LGLA 5H1VA 2KR4A 2VPDA 2EODA 5FERA 1Z60A 1WEOA 3M62A 2YW8A 2VPEA 4LKAA 4GNGA 1E4UA 2MNYA 1LDJB 4IC2A 3PURA 4B86C 5TDRA 5TDWA 5LKZA 2MD8C 5B79A 1BORA 2YREA 4LADB 2L5UA 3NG2A 5B76A 3O35A 4B7YC 1WE9A 3RTRB 2Y43A 3O7AA 4LLBA 4WZ3B 2KWJA 1X4IA 2XB1A 2NAAA 3O33A 4FK5A 3L11A 1XWHA 5H1TA 2K4DA 2KWNA 1FP0A 2Y1MA 3LQHA 5LKTA 4FIPA 2VJFA 2K17A 4X3GA 3MHHA 2KE1A 2QJ0A 3LQJA 5C11A 4N3WA 1G25A 3GL6A 2YT5A 3SHBA 3FL2A 4W4UA 4BBQA 3N9NA 4CCGX 2FSAA 4GNFA 3EB6A 4WZ2A 2M3HA 3O36A 4GNEA 2DX8A 2I50A 2LN0A 3L1ZB 2E6RA 1RMDA 2FUUA 1WESA 3V43A 5AITA 4AVXA 1MM2A 1X4UA 5G04B 4LJNA 2HYED 3O34A 1WEEA 2L0BA 2LV9A 2VJFB 2YQMA 5LCWB 2ECVA 2KFTA 1JM7A 2KWOA 3N9MA 4YBTA 3SOWA 5G0FA 1MM3A 2M85A 3PHDA 3MHSA 4R2YA 5LKXA 2E6SA 2YSJA 3N9OA 2L80A 1WILA 5TBNA 5B8DA 2RI7A 5I3LA 2M6MA 1VD4A 3SOXA 5FB1A 2RSDA 1WEPA 4AP4A 2VPBA 1JOCA 2KWKA 4UI9B 2CT2A 5TRBA 4MVTA 1LDKC 3U5PA 4S3OC 2KIZA 3ZVYA 4BHWA 3N9LA 5J3XA 4V3LC 2VP7A 4YABA 1JM7B 1WFKA 1WEQA 2AN6A 1WENA 5LKUA 2ZETC 5G05B 3ZPVE 2ECIA 2L75A 4YBMA 3DPLR 1Z6UA 3KV5A 4R7EA 1X4JA 2KREA 2L43A 1ZBDB 3C6WA 5KH9A 5TABA 5KH3A 1WIMA 2D8SA 4I7DA 5D1MB 3O37A 2ECTA 4S3OB 4UP5A 4IC3A 2ECNA 2KYUA 3ZTGA 3ASLA 3ZNIA 3U5NA 2VJEA 1FBVA 2LGVA 2H0DB 2PUYA 4QF3A 3LRQA 2KGGA 4PTBA 2EA6A 5B75A 3QZVA 2LXPC 2YURA 2IDAA 2CSYA 1F62A 2LGKA 4P5OB 4LK9A 2JMIA 2MNZA 2QIZA 4YC9A 4V3KC 4A0CD 2C2LA 4GB0A 4WZ0A 3ZVZB 2KGIA 1HYIA 3HTKC 4YAXA 1DVPA 3LQIA 3EB5A 3KV6A 4A4BA 2HDPA 2VJEB 4CA1A 3KQIA 4XI1A 3T6RA 3C5KA 4FO9A 3KNVA 2MUMA 4I7BA 4AYCB 2FUIA 2YYRA 2LDRA 2YQLA 3DQVR 5C13A 4YATA 2G45A 3N9QA 4FJCA 3HCSA 4UP0A 4Q6FA 2MA5A 1VFYA 2BAYA 2YHOA 3VK6A 1WEMA 3HCTA 2K1JA 2M1RA 4A4CA 2C2VS 4F52B 4ZDTA 2F42A 2H0DA 3M63A 4TKPB 2LQ6A 3HCUA 2CKLA 3N9PA 3T7LA 2MT5A 3M99A 2ECGA 2G6QA 5DKAA 3ZPV1 3ZYQA 2ECJA 1T1HA 2MIQA 3GV4A 1CHCA 3IHPA 2XEUA 4GNDA 2LGGA 4N4FA 5B77A 5KH7A 2EGPA 2LXHC 3RPGC 2F6NA 5H1UA 4YADA 5B78A 5JG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1X A;  4PPE A;  1HYJ A;  2JMD A;  2K16 A;  4MSX A;  5DIN A;  2YHN A;  3O70 A;  4AUQ B;  2YUC A;  2ECW A;  4NN2 A;  2YU4 A;  4AYC A;  4WA6 A;  2CKL B;  2JMJ A;  3RPG B;  1WEW A;  4ZUX U;  4A49 A;  1U6G B;  1Z2Q A;  2MD7 B;  4O64 A;  4L58 A;  2LRI C;  4ZQL A;  5AIU A;  3U5O A;  1WEU A;  2VPG A;  5H9M A;  2YSM A;  1V87 A;  1VYX A;  2PNX A;  4C9Z A;  2G43 A;  5D1L B;  1IYM A;  3I2D A;  5FB0 A;  3PUQ A;  4YBS A;  1WEV A;  2OXQ C;  1K2F A;  1WGM A;  2Y1N A;  3U5M A;  2KU3 A;  2F6J A;  5FEY A;  4I7C A;  4L7X A;  5EYA F;  4R8P K;  2QIC A;  2CSZ A;  1N87 A;  2MA6 A;  3SOU A;  2VNF A;  4QF2 A;  2JRJ A;  2UZG A;  5D1K B;  2LGL A;  5H1V A;  2KR4 A;  2VPD A;  2EOD A;  5FER A;  1Z60 A;  1WEO A;  3M62 A;  2YW8 A;  2VPE A;  4LKA A;  4GNG A;  1E4U A;  2MNY A;  1LDJ B;  4IC2 A;  3PUR A;  4B86 C;  5TDR A;  5TDW A;  5LKZ A;  2MD8 C;  5B79 A;  1BOR A;  2YRE A;  4LAD B;  2L5U A;  3NG2 A;  5B76 A;  3O35 A;  4B7Y C;  1WE9 A;  3RTR B;  2Y43 A;  3O7A A;  4LLB A;  4WZ3 B;  2KWJ A;  1X4I A;  2XB1 A;  2NAA A;  3O33 A;  4FK5 A;  3L11 A;  1XWH A;  5H1T A;  2K4D A;  2KWN A;  1FP0 A;  2Y1M A;  3LQH A;  5LKT A;  4FIP A;  2VJF A;  2K17 A;  4X3G A;  3MHH A;  2KE1 A;  2QJ0 A;  3LQJ A;  5C11 A;  4N3W A;  1G25 A;  3GL6 A;  2YT5 A;  3SHB A;  3FL2 A;  4W4U A;  4BBQ A;  3N9N A;  4CCG X;  2FSA A;  4GNF A;  3EB6 A;  4WZ2 A;  2M3H A;  3O36 A;  4GNE A;  2DX8 A;  2I50 A;  2LN0 A;  3L1Z B;  2E6R A;  1RMD A;  2FUU A;  1WES A;  3V43 A;  5AIT A;  4AVX A;  1MM2 A;  1X4U A;  5G04 B;  4LJN A;  2HYE D;  3O34 A;  1WEE A;  2L0B A;  2LV9 A;  2VJF B;  2YQM A;  5LCW B;  2ECV A;  2KFT A;  1JM7 A;  2KWO A;  3N9M A;  4YBT A;  3SOW A;  5G0F A;  1MM3 A;  2M85 A;  3PHD A;  3MHS A;  4R2Y A;  5LKX A;  2E6S A;  2YSJ A;  3N9O A;  2L80 A;  1WIL A;  5TBN A;  5B8D A;  2RI7 A;  5I3L A;  2M6M A;  1VD4 A;  3SOX A;  5FB1 A;  2RSD A;  1WEP A;  4AP4 A;  2VPB A;  1JOC A;  2KWK A;  4UI9 B;  2CT2 A;  5TRB A;  4MVT A;  1LDK C;  3U5P A;  4S3O C;  2KIZ A;  3ZVY A;  4BHW A;  3N9L A;  5J3X A;  4V3L C;  2VP7 A;  4YAB A;  1JM7 B;  1WFK A;  1WEQ A;  2AN6 A;  1WEN A;  5LKU A;  2ZET C;  5G05 B;  3ZPV E;  2ECI A;  2L75 A;  4YBM A;  3DPL R;  1Z6U A;  3KV5 A;  4R7E A;  1X4J A;  2KRE A;  2L43 A;  1ZBD B;  3C6W A;  5KH9 A;  5TAB A;  5KH3 A;  1WIM A;  2D8S A;  4I7D A;  5D1M B;  3O37 A;  2ECT A;  4S3O B;  4UP5 A;  4IC3 A;  2ECN A;  2KYU A;  3ZTG A;  3ASL A;  3ZNI A;  3U5N A;  2VJE A;  1FBV A;  2LGV A;  2H0D B;  2PUY A;  4QF3 A;  3LRQ A;  2KGG A;  4PTB A;  2EA6 A;  5B75 A;  3QZV A;  2LXP C;  2YUR A;  2IDA A;  2CSY A;  1F62 A;  2LGK A;  4P5O B;  4LK9 A;  2JMI A;  2MNZ A;  2QIZ A;  4YC9 A;  4V3K C;  4A0C D;  2C2L A;  4GB0 A;  4WZ0 A;  3ZVZ B;  2KGI A;  1HYI A;  3HTK C;  4YAX A;  1DVP A;  3LQI A;  3EB5 A;  3KV6 A;  4A4B A;  2HDP A;  2VJE B;  4CA1 A;  3KQI A;  4XI1 A;  3T6R A;  3C5K A;  4FO9 A;  3KNV A;  2MUM A;  4I7B A;  4AYC B;  2FUI A;  2YYR A;  2LDR A;  2YQL A;  3DQV R;  5C13 A;  4YAT A;  2G45 A;  3N9Q A;  4FJC A;  3HCS A;  4UP0 A;  4Q6F A;  2MA5 A;  1VFY A;  2BAY A;  2YHO A;  3VK6 A;  1WEM A;  3HCT A;  2K1J A;  2M1R A;  4A4C A;  2C2V S;  4F52 B;  4ZDT A;  2F42 A;  2H0D A;  3M63 A;  4TKP B;  2LQ6 A;  3HCU A;  2CKL A;  3N9P A;  3T7L A;  2MT5 A;  3M99 A;  2ECG A;  2G6Q A;  5DKA A;  3ZPV 1;  3ZYQ A;  2ECJ A;  1T1H A;  2MIQ A;  3GV4 A;  1CHC A;  3IHP A;  2XEU A;  4GND A;  2LGG A;  4N4F A;  5B77 A;  5KH7 A;  2EGP A;  2LXH C;  3RPG C;  2F6N A;  5H1U A;  4YAD A;  5B78 A;  5JG6 A; 
#chains in the Genus database with same CATH topology
 2XP0 A;  3L1X A;  4PPE A;  1HYJ A;  2JMD A;  2K16 A;  4MSX A;  2FFW A;  5DIN A;  2YHN A;  3O70 A;  4OGE A;  2DSM A;  4AUQ B;  2YUC A;  2ECW A;  4NN2 A;  2YU4 A;  4AYC A;  2KKY A;  4WA6 A;  2CKL B;  2JMJ A;  3RPG B;  1WEW A;  4ZUX U;  4A49 A;  1U6G B;  1Z2Q A;  2MD7 B;  4O64 A;  2KKX A;  4L58 A;  4Z0R A;  2LRI C;  4ZQL A;  2JM3 A;  5AIU A;  3U5O A;  1WEU A;  2VPG A;  5H9M A;  2YSM A;  1V87 A;  1VYX A;  2PNX A;  3KDE C;  4C9Z A;  2G43 A;  5D1L B;  2CRW A;  1IYM A;  2XOC A;  3I2D A;  5FB0 A;  3PUQ A;  2FD4 A;  2P57 A;  4YBS A;  1WEV A;  2OXQ C;  1K2F A;  1WGM A;  2Y1N A;  3U5M A;  2KU3 A;  2F6J A;  5FEY A;  4I7C A;  4L7X A;  5EYA F;  3FEH A;  4R8P K;  4F1P A;  2QIC A;  2CSZ A;  1N87 A;  2MA6 A;  3SOU A;  3M7K A;  2VNF A;  4Z0O A;  4QF2 A;  2JRJ A;  2UZG A;  5D1K B;  2LGL A;  4O62 A;  5H1V A;  2KR4 A;  2VPD A;  2EOD A;  5FER A;  1Z60 A;  2CRR A;  1WEO A;  3M62 A;  2YW8 A;  2VPE A;  4LKA A;  4GNG A;  1E4U A;  2MNY A;  2CON A;  5SVI A;  1LDJ B;  4IC2 A;  3PUR A;  4B86 C;  5TDR A;  5TDW A;  5LKZ A;  2MD8 C;  5B79 A;  1BOR A;  2LAU A;  2YRE A;  4LAD B;  2L5U A;  3NG2 A;  5B76 A;  3O35 A;  4B7Y C;  1WE9 A;  3RTR B;  2Y43 A;  3O7A A;  4LLB A;  4WZ3 B;  2KWJ A;  1X4I A;  2XB1 A;  2NAA A;  3O33 A;  4FK5 A;  3L11 A;  1XWH A;  3Q1D A;  5H1T A;  2K4D A;  2KWN A;  1FP0 A;  3FJU B;  2Y1M A;  3LQH A;  5LKT A;  4FIP A;  2VJF A;  2K17 A;  4X3G A;  3MHH A;  2KE1 A;  2QJ0 A;  3LQJ A;  5C11 A;  1DCQ A;  4N3W A;  1G25 A;  3GL6 A;  5SVI B;  2YT5 A;  3SHB A;  3FL2 A;  4W4U A;  4BBQ A;  3N9N A;  3E2D A;  4CCG X;  2FSA A;  4GNF A;  3EB6 A;  3PLW A;  3LJU X;  4WZ2 A;  2M3H A;  3O36 A;  4GNE A;  2DX8 A;  2I50 A;  2LN0 A;  2E61 A;  3L1Z B;  2E6R A;  1RMD A;  2FUU A;  1WES A;  4QQ4 A;  3V43 A;  5AIT A;  4AVX A;  4OGC A;  2CSV A;  1MM2 A;  1X4U A;  5G04 B;  4LJN A;  2HYE D;  3O34 A;  1WEE A;  2L0B A;  2LV9 A;  3LVR E;  2VJF B;  2YQM A;  5LCW B;  2ECV A;  2KFT A;  1JM7 A;  2KWO A;  3N9M A;  4YBT A;  3SOW A;  5G0F A;  2RR4 A;  1MM3 A;  2M85 A;  2YVR A;  3PHD A;  2M13 A;  3MHS A;  4R2Y A;  5LKX A;  3DDT A;  2E6S A;  2XOY A;  2YSJ A;  3N9O A;  2L80 A;  2L7P A;  1WIL A;  5TBN A;  5B8D A;  2RI7 A;  5I3L A;  2MKE A;  2M6M A;  1VD4 A;  3SOX A;  5FB1 A;  2RSD A;  1WEP A;  4AP4 A;  3FAN A;  2VPB A;  1JOC A;  5K3Q A;  2KWK A;  4UI9 B;  2CT2 A;  2EXU A;  5TRB A;  4MVT A;  1LDK C;  3U5P A;  4S3O C;  2KIZ A;  3ZVY A;  4BHW A;  3N9L A;  5J3X A;  4V3L C;  2EGM A;  2VP7 A;  4YAB A;  3MDB C;  1JM7 B;  1WFK A;  1WEQ A;  2AN6 A;  3SUB A;  1WEN A;  3O47 A;  5LKU A;  2ZET C;  5G05 B;  3ZPV E;  2ECI A;  2L75 A;  4YBM A;  3DPL R;  1Z6U A;  3KV5 A;  4R7E A;  1X4J A;  2KRE A;  2L43 A;  1ZBD B;  3C6W A;  5KH9 A;  5TAB A;  5KH3 A;  1WIM A;  2D8S A;  4I7D A;  5D1M B;  3O37 A;  2ECT A;  4H9D A;  2B0O E;  4S3O B;  4UP5 A;  4IC3 A;  2ECN A;  2KYU A;  3ZTG A;  3ASL A;  3ZNI A;  3U5N A;  2VJE A;  2XOZ A;  1FBV A;  2JUN A;  2LGV A;  2H0D B;  2PUY A;  4QF3 A;  3LRQ A;  2KGG A;  4PTB A;  2EA6 A;  5B75 A;  3QZV A;  2LXP C;  2YUR A;  2IDA A;  2CSY A;  1F62 A;  2LGK A;  4P5O B;  4LK9 A;  2IQJ A;  2JMI A;  2MNZ A;  2QIZ A;  4YC9 A;  4V3K C;  4A0C D;  1MBM A;  2C2L A;  4GB0 A;  4WZ0 A;  3ZVZ B;  2KGI A;  3LDY A;  1HYI A;  3HTK C;  3FM8 C;  3FAO A;  4YAX A;  1DVP A;  3LQI A;  3EB5 A;  3KV6 A;  4A4B A;  2HDP A;  2VJE B;  4CA1 A;  3KQI A;  4XI1 A;  3T6R A;  3C5K A;  4FO9 A;  3KNV A;  2MUM A;  5SVY A;  4I7B A;  2D8U A;  4AYC B;  2FUI A;  2YYR A;  3H7H A;  2LDR A;  2YQL A;  3DQV R;  5C13 A;  4YAT A;  2G45 A;  2DJA A;  3N9Q A;  5SVX A;  4FJC A;  3HCS A;  4UP0 A;  4Q6F A;  2MA5 A;  1VFY A;  2BAY A;  2YHO A;  3T9K A;  3VK6 A;  1WEM A;  3HCT A;  2K1J A;  2M1R A;  4A4C A;  2C2V S;  4F52 B;  4ZDT A;  2F42 A;  2H0D A;  3M63 A;  4TKP B;  3DWD A;  2LQ6 A;  3JUE A;  3HCU A;  2CKL A;  3N9P A;  3T7L A;  2MT5 A;  3M99 A;  2ECG A;  2G6Q A;  5DKA A;  3ZPV 1;  3ZYQ A;  2ECJ A;  1T1H A;  2MIQ A;  3GV4 A;  1CHC A;  3LVQ E;  3IHP A;  2OWA A;  2XEU A;  4GND A;  2LGG A;  4N4F A;  5B77 A;  5KH7 A;  2EGP A;  2LXH C;  3RPG C;  2F6N A;  5H1U A;  4YAD A;  5B78 A;  5JG6 A; 
#chains in the Genus database with same CATH homology
 3L1X A;  4PPE A;  1HYJ A;  2JMD A;  2K16 A;  4MSX A;  5DIN A;  2YHN A;  3O70 A;  4AUQ B;  2YUC A;  2ECW A;  4NN2 A;  2YU4 A;  4AYC A;  4WA6 A;  2CKL B;  2JMJ A;  3RPG B;  1WEW A;  4ZUX U;  4A49 A;  1U6G B;  1Z2Q A;  2MD7 B;  4O64 A;  4L58 A;  2LRI C;  4ZQL A;  5AIU A;  3U5O A;  1WEU A;  2VPG A;  5H9M A;  2YSM A;  1V87 A;  1VYX A;  2PNX A;  4C9Z A;  2G43 A;  5D1L B;  1IYM A;  3I2D A;  5FB0 A;  3PUQ A;  4YBS A;  1WEV A;  2OXQ C;  1K2F A;  1WGM A;  2Y1N A;  3U5M A;  2KU3 A;  2F6J A;  5FEY A;  4I7C A;  4L7X A;  5EYA F;  4R8P K;  2QIC A;  2CSZ A;  1N87 A;  2MA6 A;  3SOU A;  2VNF A;  4QF2 A;  2JRJ A;  2UZG A;  5D1K B;  2LGL A;  5H1V A;  2KR4 A;  2VPD A;  2EOD A;  5FER A;  1Z60 A;  1WEO A;  3M62 A;  2YW8 A;  2VPE A;  4LKA A;  4GNG A;  1E4U A;  2MNY A;  1LDJ B;  4IC2 A;  3PUR A;  4B86 C;  5TDR A;  5TDW A;  5LKZ A;  2MD8 C;  5B79 A;  1BOR A;  2YRE A;  4LAD B;  2L5U A;  3NG2 A;  5B76 A;  3O35 A;  4B7Y C;  1WE9 A;  3RTR B;  2Y43 A;  3O7A A;  4LLB A;  4WZ3 B;  2KWJ A;  1X4I A;  2XB1 A;  2NAA A;  3O33 A;  4FK5 A;  3L11 A;  1XWH A;  5H1T A;  2K4D A;  2KWN A;  1FP0 A;  2Y1M A;  3LQH A;  5LKT A;  4FIP A;  2VJF A;  2K17 A;  4X3G A;  3MHH A;  2KE1 A;  2QJ0 A;  3LQJ A;  5C11 A;  4N3W A;  1G25 A;  3GL6 A;  2YT5 A;  3SHB A;  3FL2 A;  4W4U A;  4BBQ A;  3N9N A;  4CCG X;  2FSA A;  4GNF A;  3EB6 A;  4WZ2 A;  2M3H A;  3O36 A;  4GNE A;  2DX8 A;  2I50 A;  2LN0 A;  3L1Z B;  2E6R A;  1RMD A;  2FUU A;  1WES A;  3V43 A;  5AIT A;  4AVX A;  1MM2 A;  1X4U A;  5G04 B;  4LJN A;  2HYE D;  3O34 A;  1WEE A;  2L0B A;  2LV9 A;  2VJF B;  2YQM A;  5LCW B;  2ECV A;  2KFT A;  1JM7 A;  2KWO A;  3N9M A;  4YBT A;  3SOW A;  5G0F A;  1MM3 A;  2M85 A;  3PHD A;  3MHS A;  4R2Y A;  5LKX A;  2E6S A;  2YSJ A;  3N9O A;  2L80 A;  1WIL A;  5TBN A;  5B8D A;  2RI7 A;  5I3L A;  2M6M A;  1VD4 A;  3SOX A;  5FB1 A;  2RSD A;  1WEP A;  4AP4 A;  2VPB A;  1JOC A;  2KWK A;  4UI9 B;  2CT2 A;  5TRB A;  4MVT A;  1LDK C;  3U5P A;  4S3O C;  2KIZ A;  3ZVY A;  4BHW A;  3N9L A;  5J3X A;  4V3L C;  2VP7 A;  4YAB A;  1JM7 B;  1WFK A;  1WEQ A;  2AN6 A;  1WEN A;  5LKU A;  2ZET C;  5G05 B;  3ZPV E;  2ECI A;  2L75 A;  4YBM A;  3DPL R;  1Z6U A;  3KV5 A;  4R7E A;  1X4J A;  2KRE A;  2L43 A;  1ZBD B;  3C6W A;  5KH9 A;  5TAB A;  5KH3 A;  1WIM A;  2D8S A;  4I7D A;  5D1M B;  3O37 A;  2ECT A;  4S3O B;  4UP5 A;  4IC3 A;  2ECN A;  2KYU A;  3ZTG A;  3ASL A;  3ZNI A;  3U5N A;  2VJE A;  1FBV A;  2LGV A;  2H0D B;  2PUY A;  4QF3 A;  3LRQ A;  2KGG A;  4PTB A;  2EA6 A;  5B75 A;  3QZV A;  2LXP C;  2YUR A;  2IDA A;  2CSY A;  1F62 A;  2LGK A;  4P5O B;  4LK9 A;  2JMI A;  2MNZ A;  2QIZ A;  4YC9 A;  4V3K C;  4A0C D;  2C2L A;  4GB0 A;  4WZ0 A;  3ZVZ B;  2KGI A;  1HYI A;  3HTK C;  4YAX A;  1DVP A;  3LQI A;  3EB5 A;  3KV6 A;  4A4B A;  2HDP A;  2VJE B;  4CA1 A;  3KQI A;  4XI1 A;  3T6R A;  3C5K A;  4FO9 A;  3KNV A;  2MUM A;  4I7B A;  4AYC B;  2FUI A;  2YYR A;  2LDR A;  2YQL A;  3DQV R;  5C13 A;  4YAT A;  2G45 A;  3N9Q A;  4FJC A;  3HCS A;  4UP0 A;  4Q6F A;  2MA5 A;  1VFY A;  2BAY A;  2YHO A;  3VK6 A;  1WEM A;  3HCT A;  2K1J A;  2M1R A;  4A4C A;  2C2V S;  4F52 B;  4ZDT A;  2F42 A;  2H0D A;  3M63 A;  4TKP B;  2LQ6 A;  3HCU A;  2CKL A;  3N9P A;  3T7L A;  2MT5 A;  3M99 A;  2ECG A;  2G6Q A;  5DKA A;  3ZPV 1;  3ZYQ A;  2ECJ A;  1T1H A;  2MIQ A;  3GV4 A;  1CHC A;  3IHP A;  2XEU A;  4GND A;  2LGG A;  4N4F A;  5B77 A;  5KH7 A;  2EGP A;  2LXH C;  3RPG C;  2F6N A;  5H1U A;  4YAD A;  5B78 A;  5JG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...