4LKAA

Crystal structure of moz double phd finger histone h3k9ac complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 28
structure length 126
sequence length 126
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4lkaA00
1WIMA 3KNVA 2YHOA 2OXQC 2QICA 2LDRA 2ZETC 4GB0A 2ECWA 3T6RA 2VPBA 5G04B 3GV4A 4B86C 2UZGA 1Z6UA 3O70A 5DKAA 3O34A 3N9NA 2L75A 2F6NA 2L5UA 2JMJA 4ZUXU 2F42A 2HYED 5B76A 2VNFA 3EB6A 4AYCB 5G0FA 2VP7A 2H0DA 1MM3A 2JRJA 3N9PA 2MA6A 2G45A 4V3LC 2CSYA 3I2DA 5FERA 5H9MA 3C5KA 2KIZA 2Y1MA 5LKTA 4R8PK 3MHSA 4CCGX 3LRQA 4PPEA 5LKUA 3ZVYA 4NN2A 1VYXA 1HYJA 2M1RA 2EGPA 2AN6A 4AVXA 4B7YC 5FEYA 4FK5A 5B79A 3U5OA 2KU3A 1F62A 3L1ZB 3KV5A 4LK9A 2E6RA 2ECVA 4V3KC 1WEOA 3PUQA 4ZQLA 2CKLB 2M6MA 1X4IA 5TABA 1WEEA 2CKLA 2VPEA 4I7CA 5TDRA 5B75A 1Z60A 1VFYA 3HCUA 1X4UA 4A49A 3HCSA 1JM7B 3LQIA 2L80A 4WZ2A 2VJFA 1WEUA 1V87A 2D8SA 3PHDA 4GNDA 2KWKA 2VJEB 3U5NA 5C13A 3NG2A 5B8DA 2MD8C 1CHCA 4WZ0A 3ZTGA 1FBVA 1LDKC 2YSJA 1XWHA 3O37A 3RTRB 2MNYA 4XI1A 3FL2A 5G05B 4YBMA 4O64A 4BHWA 4GNGA 2CT2A 2EODA 3N9OA 2KGGA 3ZPVE 4BBQA 4I7DA 1G25A 5FB0A 3IHPA 5KH9A 3O33A 2KWJA 3LQJA 2LXPC 4AYCA 2JMDA 2LGVA 1IYMA 3RPGC 4N4FA 2M3HA 4W4UA 4TKPB 2NAAA 2G43A 4GNEA 4C9ZA 2K4DA 2KFTA 4FIPA 2BAYA 5D1LB 4YABA 2KE1A 2PNXA 3QZVA 4YAXA 4QF3A 1RMDA 5I3LA 2ECJA 4FJCA 2F6JA 2XB1A 2LRIC 2KGIA 3EB5A 3VK6A 4IC2A 4LADB 2KYUA 2QJ0A 2XEUA 2C2VS 5C11A 1MM2A 2E6SA 1ZBDB 4LLBA 2KWNA 1WILA 4R2YA 4WA6A 1WEMA 1T1HA 2YQLA 3N9LA 2YSMA 2YYRA 5LKZA 3M99A 1JM7A 4UP0A 2ECTA 3KQIA 2ECGA 3DPLR 5AITA 4F52B 3U5PA 4UI9B 2YW8A 3ASLA 5EYAF 1N87A 1JOCA 2LN0A 2FSAA 1WEVA 2CSZA 2LQ6A 2YT5A 1X4JA 5LCWB 4MVTA 4LKAA 5TRBA 2VJEA 2EA6A 2K16A 3M62A 3GL6A 5B78A 2YHNA 2VPGA 4IC3A 5TDWA 3SOUA 5J3XA 3SOWA 1BORA 2KR4A 2MIQA 2KREA 5KH7A 1WE9A 5H1UA 2PUYA 3HTKC 4LJNA 1WEQA 2ECNA 5JG6A 2YQMA 3O7AA 1WESA 2QIZA 3KV6A 4ZDTA 1U6GB 4A0CD 3DQVR 2YREA 2MA5A 4L7XA 4YATA 2C2LA 3C6WA 2YUCA 3HCTA 2RI7A 4UP5A 4Q6FA 1WEWA 3N9MA 5AIUA 4A4BA 4A4CA 2Y1NA 2L0BA 4N3WA 4AUQB 2FUUA 4YBTA 3L11A 2H0DB 2MUMA 1Z2QA 1E4UA 5KH3A 1WEPA 1LDJB 4L58A 3M63A 3MHHA 2FUIA 4X3GA 5TBNA 2MNZA 2L43A 2MT5A 1WFKA 3O36A 2KWOA 1K2FA 1WENA 2MD7B 3ZPV1 3V43A 4YBSA 5D1KB 2LGLA 5H1VA 3U5MA 4PTBA 4S3OC 4GNFA 2IDAA 5H1TA 5B77A 2YURA 3N9QA 4P5OB 2YU4A 2M85A 3SOXA 2I50A 1HYIA 4AP4A 3RPGB 3ZVZB 2DX8A 5LKXA 4YC9A 5DINA 4R7EA 5FB1A 4CA1A 2HDPA 2JMIA 2LV9A 1FP0A 4FO9A 3ZYQA 2LGGA 2LGKA 4WZ3B 4QF2A 2LXHC 2G6QA 2VJFB 3L1XA 3O35A 2VPDA 1WGMA 3T7LA 1DVPA 3PURA 3ZNIA 2Y43A 2ECIA 4MSXA 5D1MB 2K17A 4YADA 3LQHA 1VD4A 2K1JA 4I7BA 4S3OB 3SHBA 2RSDA
chains in the Genus database with same CATH superfamily
1WIMA 3KNVA 4O62A 2YHOA 2OXQC 2QICA 2LDRA 2ZETC 4GB0A 2ECWA 3T6RA 2VPBA 5G04B 3GV4A 4B86C 3FAOA 2UZGA 2XOYA 1Z6UA 3O70A 5DKAA 3O34A 3LVQE 3N9NA 2L75A 2F6NA 2P57A 2L5UA 2JMJA 4ZUXU 5K3QA 2F42A 2HYED 5B76A 2VNFA 3EB6A 4AYCB 5G0FA 2VP7A 2H0DA 1MM3A 2JRJA 3N9PA 2MA6A 2G45A 4V3LC 2CSYA 3I2DA 5FERA 5H9MA 3C5KA 2KIZA 2Y1MA 5LKTA 4R8PK 3MHSA 4CCGX 3LRQA 4PPEA 5LKUA 3ZVYA 4NN2A 4QQ4A 1VYXA 3T9KA 1HYJA 2M1RA 2EGPA 2AN6A 4AVXA 2DJAA 4B7YC 5FEYA 4FK5A 5B79A 3U5OA 2KU3A 3Q1DA 1F62A 4Z0RA 3L1ZB 3KV5A 4LK9A 2E6RA 2ECVA 4V3KC 1WEOA 3PUQA 4ZQLA 2CKLB 2M6MA 3FEHA 1X4IA 5TABA 1WEEA 2CKLA 2YVRA 2VPEA 4I7CA 5TDRA 5B75A 1Z60A 2B0OE 1VFYA 3HCUA 1X4UA 3DDTA 4A49A 1DCQA 3HCSA 1JM7B 3LQIA 2L80A 4WZ2A 2VJFA 1WEUA 1V87A 2D8SA 3PHDA 4GNDA 2RR4A 2KWKA 2VJEB 3U5NA 5C13A 3NG2A 5B8DA 2M13A 2MD8C 1CHCA 4WZ0A 3ZTGA 1FBVA 1LDKC 2YSJA 1XWHA 2D8UA 3O37A 3RTRB 2MNYA 4XI1A 3FL2A 5G05B 4YBMA 4O64A 4BHWA 4GNGA 2CT2A 2EODA 3FANA 3N9OA 2KGGA 3ZPVE 4BBQA 4I7DA 1G25A 5FB0A 3IHPA 5KH9A 3O33A 2KWJA 3LQJA 3DWDA 2LXPC 4AYCA 2JMDA 2MKEA 2LGVA 1IYMA 3RPGC 4N4FA 2M3HA 4W4UA 3H7HA 3KDEC 4TKPB 2NAAA 2G43A 4GNEA 4C9ZA 2K4DA 2OWAA 2KFTA 4FIPA 2BAYA 5D1LB 2KKXA 4YABA 2KE1A 2PNXA 3QZVA 4YAXA 4QF3A 1RMDA 2KKYA 5SVXA 5I3LA 2ECJA 2FD4A 4FJCA 2F6JA 2XB1A 4OGCA 2LRIC 2KGIA 3LDYA 2DSMA 3EB5A 3VK6A 4IC2A 4LADB 2KYUA 2JUNA 2QJ0A 2XEUA 2C2VS 3E2DA 5C11A 1MM2A 2E6SA 2EGMA 1ZBDB 4LLBA 2KWNA 1WILA 4R2YA 4WA6A 1WEMA 3MDBC 1T1HA 2YQLA 3N9LA 2YSMA 2YYRA 5LKZA 3M99A 1JM7A 4UP0A 2ECTA 3KQIA 2ECGA 3DPLR 5AITA 4F52B 3U5PA 4UI9B 2YW8A 3ASLA 5EYAF 1N87A 1JOCA 2LN0A 2FSAA 1WEVA 2CSZA 2LQ6A 2YT5A 1X4JA 5LCWB 2JM3A 4MVTA 4LKAA 5TRBA 2CRWA 2VJEA 2EA6A 2K16A 3M62A 3FJUB 2LAUA 2CONA 5SVIB 3GL6A 5B78A 2YHNA 3M7KA 2VPGA 4IC3A 5TDWA 3JUEA 3SOUA 5J3XA 3SOWA 1BORA 3PLWA 2KR4A 4Z0OA 2MIQA 2KREA 3LJUX 5KH7A 1WE9A 5H1UA 2PUYA 2IQJA 3HTKC 4LJNA 1WEQA 3LVRE 2ECNA 5JG6A 2YQMA 4OGEA 3O7AA 1WESA 2QIZA 3KV6A 4ZDTA 3SUBA 1U6GB 4A0CD 3DQVR 2YREA 2MA5A 4L7XA 4YATA 2C2LA 3C6WA 2YUCA 3HCTA 2RI7A 4UP5A 4Q6FA 1WEWA 3N9MA 5AIUA 4A4BA 4A4CA 2Y1NA 2L0BA 4N3WA 4AUQB 2XP0A 2FUUA 4YBTA 3L11A 2H0DB 2MUMA 1Z2QA 1E4UA 5KH3A 1WEPA 1LDJB 4L58A 3M63A 3MHHA 3O47A 2FUIA 4X3GA 5TBNA 2MNZA 2L43A 2MT5A 1WFKA 2XOZA 3O36A 2KWOA 1K2FA 1WENA 2MD7B 2L7PA 3ZPV1 3V43A 4YBSA 5D1KB 2LGLA 5H1VA 3U5MA 4PTBA 4S3OC 4GNFA 2IDAA 5H1TA 5B77A 2YURA 3N9QA 4P5OB 5SVYA 2E61A 2YU4A 2M85A 3SOXA 2I50A 1HYIA 4AP4A 3RPGB 3ZVZB 3FM8C 2DX8A 5LKXA 4YC9A 5DINA 2CSVA 4R7EA 5FB1A 1MBMA 2CRRA 2EXUA 4CA1A 2HDPA 2JMIA 2LV9A 1FP0A 4FO9A 3ZYQA 2LGGA 2LGKA 4WZ3B 4QF2A 2LXHC 2G6QA 2VJFB 4H9DA 3L1XA 3O35A 2VPDA 1WGMA 3T7LA 1DVPA 3PURA 3ZNIA 5SVIA 2Y43A 2ECIA 4F1PA 4MSXA 5D1MB 2K17A 4YADA 3LQHA 1VD4A 4I7BA 2K1JA 2XOCA 4S3OB 3SHBA 2FFWA 2RSDA
chains in the Genus database with same CATH topology
1WIMA 3KNVA 2YHOA 2OXQC 2QICA 2LDRA 2ZETC 4GB0A 2ECWA 3T6RA 2VPBA 5G04B 3GV4A 4B86C 2UZGA 1Z6UA 3O70A 5DKAA 3O34A 3N9NA 2L75A 2F6NA 2L5UA 2JMJA 4ZUXU 2F42A 2HYED 5B76A 2VNFA 3EB6A 4AYCB 5G0FA 2VP7A 2H0DA 1MM3A 2JRJA 3N9PA 2MA6A 2G45A 4V3LC 2CSYA 3I2DA 5FERA 5H9MA 3C5KA 2KIZA 2Y1MA 5LKTA 4R8PK 3MHSA 4CCGX 3LRQA 4PPEA 5LKUA 3ZVYA 4NN2A 1VYXA 1HYJA 2M1RA 2EGPA 2AN6A 4AVXA 4B7YC 5FEYA 4FK5A 5B79A 3U5OA 2KU3A 1F62A 3L1ZB 3KV5A 4LK9A 2E6RA 2ECVA 4V3KC 1WEOA 3PUQA 4ZQLA 2CKLB 2M6MA 1X4IA 5TABA 1WEEA 2CKLA 2VPEA 4I7CA 5TDRA 5B75A 1Z60A 1VFYA 3HCUA 1X4UA 4A49A 3HCSA 1JM7B 3LQIA 2L80A 4WZ2A 2VJFA 1WEUA 1V87A 2D8SA 3PHDA 4GNDA 2KWKA 2VJEB 3U5NA 5C13A 3NG2A 5B8DA 2MD8C 1CHCA 4WZ0A 3ZTGA 1FBVA 1LDKC 2YSJA 1XWHA 3O37A 3RTRB 2MNYA 4XI1A 3FL2A 5G05B 4YBMA 4O64A 4BHWA 4GNGA 2CT2A 2EODA 3N9OA 2KGGA 3ZPVE 4BBQA 4I7DA 1G25A 5FB0A 3IHPA 5KH9A 3O33A 2KWJA 3LQJA 2LXPC 4AYCA 2JMDA 2LGVA 1IYMA 3RPGC 4N4FA 2M3HA 4W4UA 4TKPB 2NAAA 2G43A 4GNEA 4C9ZA 2K4DA 2KFTA 4FIPA 2BAYA 5D1LB 4YABA 2KE1A 2PNXA 3QZVA 4YAXA 4QF3A 1RMDA 5I3LA 2ECJA 4FJCA 2F6JA 2XB1A 2LRIC 2KGIA 3EB5A 3VK6A 4IC2A 4LADB 2KYUA 2QJ0A 2XEUA 2C2VS 5C11A 1MM2A 2E6SA 1ZBDB 4LLBA 2KWNA 1WILA 4R2YA 4WA6A 1WEMA 1T1HA 2YQLA 3N9LA 2YSMA 2YYRA 5LKZA 3M99A 1JM7A 4UP0A 2ECTA 3KQIA 2ECGA 3DPLR 5AITA 4F52B 3U5PA 4UI9B 2YW8A 3ASLA 5EYAF 1N87A 1JOCA 2LN0A 2FSAA 1WEVA 2CSZA 2LQ6A 2YT5A 1X4JA 5LCWB 4MVTA 4LKAA 5TRBA 2VJEA 2EA6A 2K16A 3M62A 3GL6A 5B78A 2YHNA 2VPGA 4IC3A 5TDWA 3SOUA 5J3XA 3SOWA 1BORA 2KR4A 2MIQA 2KREA 5KH7A 1WE9A 5H1UA 2PUYA 3HTKC 4LJNA 1WEQA 2ECNA 5JG6A 2YQMA 3O7AA 1WESA 2QIZA 3KV6A 4ZDTA 1U6GB 4A0CD 3DQVR 2YREA 2MA5A 4L7XA 4YATA 2C2LA 3C6WA 2YUCA 3HCTA 2RI7A 4UP5A 4Q6FA 1WEWA 3N9MA 5AIUA 4A4BA 4A4CA 2Y1NA 2L0BA 4N3WA 4AUQB 2FUUA 4YBTA 3L11A 2H0DB 2MUMA 1Z2QA 1E4UA 5KH3A 1WEPA 1LDJB 4L58A 3M63A 3MHHA 2FUIA 4X3GA 5TBNA 2MNZA 2L43A 2MT5A 1WFKA 3O36A 2KWOA 1K2FA 1WENA 2MD7B 3ZPV1 3V43A 4YBSA 5D1KB 2LGLA 5H1VA 3U5MA 4PTBA 4S3OC 4GNFA 2IDAA 5H1TA 5B77A 2YURA 3N9QA 4P5OB 2YU4A 2M85A 3SOXA 2I50A 1HYIA 4AP4A 3RPGB 3ZVZB 2DX8A 5LKXA 4YC9A 5DINA 4R7EA 5FB1A 4CA1A 2HDPA 2JMIA 2LV9A 1FP0A 4FO9A 3ZYQA 2LGGA 2LGKA 4WZ3B 4QF2A 2LXHC 2G6QA 2VJFB 3L1XA 3O35A 2VPDA 1WGMA 3T7LA 1DVPA 3PURA 3ZNIA 2Y43A 2ECIA 4MSXA 5D1MB 2K17A 4YADA 3LQHA 1VD4A 2K1JA 4I7BA 4S3OB 3SHBA 2RSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIM A;  3KNV A;  2YHO A;  2OXQ C;  2QIC A;  2LDR A;  2ZET C;  4GB0 A;  2ECW A;  3T6R A;  2VPB A;  5G04 B;  3GV4 A;  4B86 C;  2UZG A;  1Z6U A;  3O70 A;  5DKA A;  3O34 A;  3N9N A;  2L75 A;  2F6N A;  2L5U A;  2JMJ A;  4ZUX U;  2F42 A;  2HYE D;  5B76 A;  2VNF A;  3EB6 A;  4AYC B;  5G0F A;  2VP7 A;  2H0D A;  1MM3 A;  2JRJ A;  3N9P A;  2MA6 A;  2G45 A;  4V3L C;  2CSY A;  3I2D A;  5FER A;  5H9M A;  3C5K A;  2KIZ A;  2Y1M A;  5LKT A;  4R8P K;  3MHS A;  4CCG X;  3LRQ A;  4PPE A;  5LKU A;  3ZVY A;  4NN2 A;  1VYX A;  1HYJ A;  2M1R A;  2EGP A;  2AN6 A;  4AVX A;  4B7Y C;  5FEY A;  4FK5 A;  5B79 A;  3U5O A;  2KU3 A;  1F62 A;  3L1Z B;  3KV5 A;  4LK9 A;  2E6R A;  2ECV A;  4V3K C;  1WEO A;  3PUQ A;  4ZQL A;  2CKL B;  2M6M A;  1X4I A;  5TAB A;  1WEE A;  2CKL A;  2VPE A;  4I7C A;  5TDR A;  5B75 A;  1Z60 A;  1VFY A;  3HCU A;  1X4U A;  4A49 A;  3HCS A;  1JM7 B;  3LQI A;  2L80 A;  4WZ2 A;  2VJF A;  1WEU A;  1V87 A;  2D8S A;  3PHD A;  4GND A;  2KWK A;  2VJE B;  3U5N A;  5C13 A;  3NG2 A;  5B8D A;  2MD8 C;  1CHC A;  4WZ0 A;  3ZTG A;  1FBV A;  1LDK C;  2YSJ A;  1XWH A;  3O37 A;  3RTR B;  2MNY A;  4XI1 A;  3FL2 A;  5G05 B;  4YBM A;  4O64 A;  4BHW A;  4GNG A;  2CT2 A;  2EOD A;  3N9O A;  2KGG A;  3ZPV E;  4BBQ A;  4I7D A;  1G25 A;  5FB0 A;  3IHP A;  5KH9 A;  3O33 A;  2KWJ A;  3LQJ A;  2LXP C;  4AYC A;  2JMD A;  2LGV A;  1IYM A;  3RPG C;  4N4F A;  2M3H A;  4W4U A;  4TKP B;  2NAA A;  2G43 A;  4GNE A;  4C9Z A;  2K4D A;  2KFT A;  4FIP A;  2BAY A;  5D1L B;  4YAB A;  2KE1 A;  2PNX A;  3QZV A;  4YAX A;  4QF3 A;  1RMD A;  5I3L A;  2ECJ A;  4FJC A;  2F6J A;  2XB1 A;  2LRI C;  2KGI A;  3EB5 A;  3VK6 A;  4IC2 A;  4LAD B;  2KYU A;  2QJ0 A;  2XEU A;  2C2V S;  5C11 A;  1MM2 A;  2E6S A;  1ZBD B;  4LLB A;  2KWN A;  1WIL A;  4R2Y A;  4WA6 A;  1WEM A;  1T1H A;  2YQL A;  3N9L A;  2YSM A;  2YYR A;  5LKZ A;  3M99 A;  1JM7 A;  4UP0 A;  2ECT A;  3KQI A;  2ECG A;  3DPL R;  5AIT A;  4F52 B;  3U5P A;  4UI9 B;  2YW8 A;  3ASL A;  5EYA F;  1N87 A;  1JOC A;  2LN0 A;  2FSA A;  1WEV A;  2CSZ A;  2LQ6 A;  2YT5 A;  1X4J A;  5LCW B;  4MVT A;  4LKA A;  5TRB A;  2VJE A;  2EA6 A;  2K16 A;  3M62 A;  3GL6 A;  5B78 A;  2YHN A;  2VPG A;  4IC3 A;  5TDW A;  3SOU A;  5J3X A;  3SOW A;  1BOR A;  2KR4 A;  2MIQ A;  2KRE A;  5KH7 A;  1WE9 A;  5H1U A;  2PUY A;  3HTK C;  4LJN A;  1WEQ A;  2ECN A;  5JG6 A;  2YQM A;  3O7A A;  1WES A;  2QIZ A;  3KV6 A;  4ZDT A;  1U6G B;  4A0C D;  3DQV R;  2YRE A;  2MA5 A;  4L7X A;  4YAT A;  2C2L A;  3C6W A;  2YUC A;  3HCT A;  2RI7 A;  4UP5 A;  4Q6F A;  1WEW A;  3N9M A;  5AIU A;  4A4B A;  4A4C A;  2Y1N A;  2L0B A;  4N3W A;  4AUQ B;  2FUU A;  4YBT A;  3L11 A;  2H0D B;  2MUM A;  1Z2Q A;  1E4U A;  5KH3 A;  1WEP A;  1LDJ B;  4L58 A;  3M63 A;  3MHH A;  2FUI A;  4X3G A;  5TBN A;  2MNZ A;  2L43 A;  2MT5 A;  1WFK A;  3O36 A;  2KWO A;  1K2F A;  1WEN A;  2MD7 B;  3ZPV 1;  3V43 A;  4YBS A;  5D1K B;  2LGL A;  5H1V A;  3U5M A;  4PTB A;  4S3O C;  4GNF A;  2IDA A;  5H1T A;  5B77 A;  2YUR A;  3N9Q A;  4P5O B;  2YU4 A;  2M85 A;  3SOX A;  2I50 A;  1HYI A;  4AP4 A;  3RPG B;  3ZVZ B;  2DX8 A;  5LKX A;  4YC9 A;  5DIN A;  4R7E A;  5FB1 A;  4CA1 A;  2HDP A;  2JMI A;  2LV9 A;  1FP0 A;  4FO9 A;  3ZYQ A;  2LGG A;  2LGK A;  4WZ3 B;  4QF2 A;  2LXH C;  2G6Q A;  2VJF B;  3L1X A;  3O35 A;  2VPD A;  1WGM A;  3T7L A;  1DVP A;  3PUR A;  3ZNI A;  2Y43 A;  2ECI A;  4MSX A;  5D1M B;  2K17 A;  4YAD A;  3LQH A;  1VD4 A;  2K1J A;  4I7B A;  4S3O B;  3SHB A;  2RSD A; 
#chains in the Genus database with same CATH topology
 1WIM A;  3KNV A;  4O62 A;  2YHO A;  2OXQ C;  2QIC A;  2LDR A;  2ZET C;  4GB0 A;  2ECW A;  3T6R A;  2VPB A;  5G04 B;  3GV4 A;  4B86 C;  3FAO A;  2UZG A;  2XOY A;  1Z6U A;  3O70 A;  5DKA A;  3O34 A;  3LVQ E;  3N9N A;  2L75 A;  2F6N A;  2P57 A;  2L5U A;  2JMJ A;  4ZUX U;  5K3Q A;  2F42 A;  2HYE D;  5B76 A;  2VNF A;  3EB6 A;  4AYC B;  5G0F A;  2VP7 A;  2H0D A;  1MM3 A;  2JRJ A;  3N9P A;  2MA6 A;  2G45 A;  4V3L C;  2CSY A;  3I2D A;  5FER A;  5H9M A;  3C5K A;  2KIZ A;  2Y1M A;  5LKT A;  4R8P K;  3MHS A;  4CCG X;  3LRQ A;  4PPE A;  5LKU A;  3ZVY A;  4NN2 A;  4QQ4 A;  1VYX A;  3T9K A;  1HYJ A;  2M1R A;  2EGP A;  2AN6 A;  4AVX A;  2DJA A;  4B7Y C;  5FEY A;  4FK5 A;  5B79 A;  3U5O A;  2KU3 A;  3Q1D A;  1F62 A;  4Z0R A;  3L1Z B;  3KV5 A;  4LK9 A;  2E6R A;  2ECV A;  4V3K C;  1WEO A;  3PUQ A;  4ZQL A;  2CKL B;  2M6M A;  3FEH A;  1X4I A;  5TAB A;  1WEE A;  2CKL A;  2YVR A;  2VPE A;  4I7C A;  5TDR A;  5B75 A;  1Z60 A;  2B0O E;  1VFY A;  3HCU A;  1X4U A;  3DDT A;  4A49 A;  1DCQ A;  3HCS A;  1JM7 B;  3LQI A;  2L80 A;  4WZ2 A;  2VJF A;  1WEU A;  1V87 A;  2D8S A;  3PHD A;  4GND A;  2RR4 A;  2KWK A;  2VJE B;  3U5N A;  5C13 A;  3NG2 A;  5B8D A;  2M13 A;  2MD8 C;  1CHC A;  4WZ0 A;  3ZTG A;  1FBV A;  1LDK C;  2YSJ A;  1XWH A;  2D8U A;  3O37 A;  3RTR B;  2MNY A;  4XI1 A;  3FL2 A;  5G05 B;  4YBM A;  4O64 A;  4BHW A;  4GNG A;  2CT2 A;  2EOD A;  3FAN A;  3N9O A;  2KGG A;  3ZPV E;  4BBQ A;  4I7D A;  1G25 A;  5FB0 A;  3IHP A;  5KH9 A;  3O33 A;  2KWJ A;  3LQJ A;  3DWD A;  2LXP C;  4AYC A;  2JMD A;  2MKE A;  2LGV A;  1IYM A;  3RPG C;  4N4F A;  2M3H A;  4W4U A;  3H7H A;  3KDE C;  4TKP B;  2NAA A;  2G43 A;  4GNE A;  4C9Z A;  2K4D A;  2OWA A;  2KFT A;  4FIP A;  2BAY A;  5D1L B;  2KKX A;  4YAB A;  2KE1 A;  2PNX A;  3QZV A;  4YAX A;  4QF3 A;  1RMD A;  2KKY A;  5SVX A;  5I3L A;  2ECJ A;  2FD4 A;  4FJC A;  2F6J A;  2XB1 A;  4OGC A;  2LRI C;  2KGI A;  3LDY A;  2DSM A;  3EB5 A;  3VK6 A;  4IC2 A;  4LAD B;  2KYU A;  2JUN A;  2QJ0 A;  2XEU A;  2C2V S;  3E2D A;  5C11 A;  1MM2 A;  2E6S A;  2EGM A;  1ZBD B;  4LLB A;  2KWN A;  1WIL A;  4R2Y A;  4WA6 A;  1WEM A;  3MDB C;  1T1H A;  2YQL A;  3N9L A;  2YSM A;  2YYR A;  5LKZ A;  3M99 A;  1JM7 A;  4UP0 A;  2ECT A;  3KQI A;  2ECG A;  3DPL R;  5AIT A;  4F52 B;  3U5P A;  4UI9 B;  2YW8 A;  3ASL A;  5EYA F;  1N87 A;  1JOC A;  2LN0 A;  2FSA A;  1WEV A;  2CSZ A;  2LQ6 A;  2YT5 A;  1X4J A;  5LCW B;  2JM3 A;  4MVT A;  4LKA A;  5TRB A;  2CRW A;  2VJE A;  2EA6 A;  2K16 A;  3M62 A;  3FJU B;  2LAU A;  2CON A;  5SVI B;  3GL6 A;  5B78 A;  2YHN A;  3M7K A;  2VPG A;  4IC3 A;  5TDW A;  3JUE A;  3SOU A;  5J3X A;  3SOW A;  1BOR A;  3PLW A;  2KR4 A;  4Z0O A;  2MIQ A;  2KRE A;  3LJU X;  5KH7 A;  1WE9 A;  5H1U A;  2PUY A;  2IQJ A;  3HTK C;  4LJN A;  1WEQ A;  3LVR E;  2ECN A;  5JG6 A;  2YQM A;  4OGE A;  3O7A A;  1WES A;  2QIZ A;  3KV6 A;  4ZDT A;  3SUB A;  1U6G B;  4A0C D;  3DQV R;  2YRE A;  2MA5 A;  4L7X A;  4YAT A;  2C2L A;  3C6W A;  2YUC A;  3HCT A;  2RI7 A;  4UP5 A;  4Q6F A;  1WEW A;  3N9M A;  5AIU A;  4A4B A;  4A4C A;  2Y1N A;  2L0B A;  4N3W A;  4AUQ B;  2XP0 A;  2FUU A;  4YBT A;  3L11 A;  2H0D B;  2MUM A;  1Z2Q A;  1E4U A;  5KH3 A;  1WEP A;  1LDJ B;  4L58 A;  3M63 A;  3MHH A;  3O47 A;  2FUI A;  4X3G A;  5TBN A;  2MNZ A;  2L43 A;  2MT5 A;  1WFK A;  2XOZ A;  3O36 A;  2KWO A;  1K2F A;  1WEN A;  2MD7 B;  2L7P A;  3ZPV 1;  3V43 A;  4YBS A;  5D1K B;  2LGL A;  5H1V A;  3U5M A;  4PTB A;  4S3O C;  4GNF A;  2IDA A;  5H1T A;  5B77 A;  2YUR A;  3N9Q A;  4P5O B;  5SVY A;  2E61 A;  2YU4 A;  2M85 A;  3SOX A;  2I50 A;  1HYI A;  4AP4 A;  3RPG B;  3ZVZ B;  3FM8 C;  2DX8 A;  5LKX A;  4YC9 A;  5DIN A;  2CSV A;  4R7E A;  5FB1 A;  1MBM A;  2CRR A;  2EXU A;  4CA1 A;  2HDP A;  2JMI A;  2LV9 A;  1FP0 A;  4FO9 A;  3ZYQ A;  2LGG A;  2LGK A;  4WZ3 B;  4QF2 A;  2LXH C;  2G6Q A;  2VJF B;  4H9D A;  3L1X A;  3O35 A;  2VPD A;  1WGM A;  3T7L A;  1DVP A;  3PUR A;  3ZNI A;  5SVI A;  2Y43 A;  2ECI A;  4F1P A;  4MSX A;  5D1M B;  2K17 A;  4YAD A;  3LQH A;  1VD4 A;  4I7B A;  2K1J A;  2XOC A;  4S3O B;  3SHB A;  2FFW A;  2RSD A; 
#chains in the Genus database with same CATH homology
 1WIM A;  3KNV A;  2YHO A;  2OXQ C;  2QIC A;  2LDR A;  2ZET C;  4GB0 A;  2ECW A;  3T6R A;  2VPB A;  5G04 B;  3GV4 A;  4B86 C;  2UZG A;  1Z6U A;  3O70 A;  5DKA A;  3O34 A;  3N9N A;  2L75 A;  2F6N A;  2L5U A;  2JMJ A;  4ZUX U;  2F42 A;  2HYE D;  5B76 A;  2VNF A;  3EB6 A;  4AYC B;  5G0F A;  2VP7 A;  2H0D A;  1MM3 A;  2JRJ A;  3N9P A;  2MA6 A;  2G45 A;  4V3L C;  2CSY A;  3I2D A;  5FER A;  5H9M A;  3C5K A;  2KIZ A;  2Y1M A;  5LKT A;  4R8P K;  3MHS A;  4CCG X;  3LRQ A;  4PPE A;  5LKU A;  3ZVY A;  4NN2 A;  1VYX A;  1HYJ A;  2M1R A;  2EGP A;  2AN6 A;  4AVX A;  4B7Y C;  5FEY A;  4FK5 A;  5B79 A;  3U5O A;  2KU3 A;  1F62 A;  3L1Z B;  3KV5 A;  4LK9 A;  2E6R A;  2ECV A;  4V3K C;  1WEO A;  3PUQ A;  4ZQL A;  2CKL B;  2M6M A;  1X4I A;  5TAB A;  1WEE A;  2CKL A;  2VPE A;  4I7C A;  5TDR A;  5B75 A;  1Z60 A;  1VFY A;  3HCU A;  1X4U A;  4A49 A;  3HCS A;  1JM7 B;  3LQI A;  2L80 A;  4WZ2 A;  2VJF A;  1WEU A;  1V87 A;  2D8S A;  3PHD A;  4GND A;  2KWK A;  2VJE B;  3U5N A;  5C13 A;  3NG2 A;  5B8D A;  2MD8 C;  1CHC A;  4WZ0 A;  3ZTG A;  1FBV A;  1LDK C;  2YSJ A;  1XWH A;  3O37 A;  3RTR B;  2MNY A;  4XI1 A;  3FL2 A;  5G05 B;  4YBM A;  4O64 A;  4BHW A;  4GNG A;  2CT2 A;  2EOD A;  3N9O A;  2KGG A;  3ZPV E;  4BBQ A;  4I7D A;  1G25 A;  5FB0 A;  3IHP A;  5KH9 A;  3O33 A;  2KWJ A;  3LQJ A;  2LXP C;  4AYC A;  2JMD A;  2LGV A;  1IYM A;  3RPG C;  4N4F A;  2M3H A;  4W4U A;  4TKP B;  2NAA A;  2G43 A;  4GNE A;  4C9Z A;  2K4D A;  2KFT A;  4FIP A;  2BAY A;  5D1L B;  4YAB A;  2KE1 A;  2PNX A;  3QZV A;  4YAX A;  4QF3 A;  1RMD A;  5I3L A;  2ECJ A;  4FJC A;  2F6J A;  2XB1 A;  2LRI C;  2KGI A;  3EB5 A;  3VK6 A;  4IC2 A;  4LAD B;  2KYU A;  2QJ0 A;  2XEU A;  2C2V S;  5C11 A;  1MM2 A;  2E6S A;  1ZBD B;  4LLB A;  2KWN A;  1WIL A;  4R2Y A;  4WA6 A;  1WEM A;  1T1H A;  2YQL A;  3N9L A;  2YSM A;  2YYR A;  5LKZ A;  3M99 A;  1JM7 A;  4UP0 A;  2ECT A;  3KQI A;  2ECG A;  3DPL R;  5AIT A;  4F52 B;  3U5P A;  4UI9 B;  2YW8 A;  3ASL A;  5EYA F;  1N87 A;  1JOC A;  2LN0 A;  2FSA A;  1WEV A;  2CSZ A;  2LQ6 A;  2YT5 A;  1X4J A;  5LCW B;  4MVT A;  4LKA A;  5TRB A;  2VJE A;  2EA6 A;  2K16 A;  3M62 A;  3GL6 A;  5B78 A;  2YHN A;  2VPG A;  4IC3 A;  5TDW A;  3SOU A;  5J3X A;  3SOW A;  1BOR A;  2KR4 A;  2MIQ A;  2KRE A;  5KH7 A;  1WE9 A;  5H1U A;  2PUY A;  3HTK C;  4LJN A;  1WEQ A;  2ECN A;  5JG6 A;  2YQM A;  3O7A A;  1WES A;  2QIZ A;  3KV6 A;  4ZDT A;  1U6G B;  4A0C D;  3DQV R;  2YRE A;  2MA5 A;  4L7X A;  4YAT A;  2C2L A;  3C6W A;  2YUC A;  3HCT A;  2RI7 A;  4UP5 A;  4Q6F A;  1WEW A;  3N9M A;  5AIU A;  4A4B A;  4A4C A;  2Y1N A;  2L0B A;  4N3W A;  4AUQ B;  2FUU A;  4YBT A;  3L11 A;  2H0D B;  2MUM A;  1Z2Q A;  1E4U A;  5KH3 A;  1WEP A;  1LDJ B;  4L58 A;  3M63 A;  3MHH A;  2FUI A;  4X3G A;  5TBN A;  2MNZ A;  2L43 A;  2MT5 A;  1WFK A;  3O36 A;  2KWO A;  1K2F A;  1WEN A;  2MD7 B;  3ZPV 1;  3V43 A;  4YBS A;  5D1K B;  2LGL A;  5H1V A;  3U5M A;  4PTB A;  4S3O C;  4GNF A;  2IDA A;  5H1T A;  5B77 A;  2YUR A;  3N9Q A;  4P5O B;  2YU4 A;  2M85 A;  3SOX A;  2I50 A;  1HYI A;  4AP4 A;  3RPG B;  3ZVZ B;  2DX8 A;  5LKX A;  4YC9 A;  5DIN A;  4R7E A;  5FB1 A;  4CA1 A;  2HDP A;  2JMI A;  2LV9 A;  1FP0 A;  4FO9 A;  3ZYQ A;  2LGG A;  2LGK A;  4WZ3 B;  4QF2 A;  2LXH C;  2G6Q A;  2VJF B;  3L1X A;  3O35 A;  2VPD A;  1WGM A;  3T7L A;  1DVP A;  3PUR A;  3ZNI A;  2Y43 A;  2ECI A;  4MSX A;  5D1M B;  2K17 A;  4YAD A;  3LQH A;  1VD4 A;  2K1J A;  4I7B A;  4S3O B;  3SHB A;  2RSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...