4V3LC

Rnf38-ub-ubch5b-ub complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
EQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
publication title Activation of a Primed Ring E3-E2-Ubiquitin Complex by Non-Covalent Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4v3lC00
1LDJB 3N9LA 1X4IA 3VK6A 2KU3A 3L1XA 4FJCA 4GB0A 4YBMA 4ZQLA 2H0DB 2KE1A 1WEEA 3HCUA 4I7CA 2ECNA 2L75A 4AUQB 1CHCA 4S3OB 5G0FA 4L7XA 2MD8C 3N9OA 3O36A 2YT5A 2LGGA 2VJEA 4GNDA 2MA6A 5B8DA 4YABA 4R2YA 3T7LA 2VJFB 2G45A 1MM3A 3M62A 4P5OB 1F62A 3L11A 2HYED 1X4JA 2K16A 2Y1MA 2LV9A 2JMJA 2VPDA 3O33A 4C9ZA 2QIZA 4UP5A 1T1HA 2K4DA 2FUUA 3GL6A 5KH7A 1HYJA 5AITA 3QZVA 2JRJA 2JMIA 2KGGA 2KIZA 2YSJA 4Q6FA 1WEWA 2EA6A 2MUMA 2YHOA 5FERA 5KH3A 2DX8A 2OXQC 1JOCA 2XEUA 1U6GB 4A0CD 1WILA 2CKLA 4LADB 2LXHC 2IDAA 2RI7A 5DKAA 4GNGA 4CCGX 2CT2A 3O7AA 3ZTGA 2M6MA 3FL2A 2CSYA 2L43A 1LDKC 1WFKA 4B7YC 2PNXA 3KQIA 2G43A 2LN0A 2ECIA 2LXPC 4A4CA 2HDPA 5LKXA 2XB1A 4B86C 2ECJA 1Z6UA 3EB6A 3ZVYA 1ZBDB 4N4FA 2L5UA 3HCSA 1VFYA 5FB0A 1X4UA 3LQIA 2KYUA 2BAYA 3RTRB 1G25A 4AYCB 2ZETC 3U5OA 3IHPA 2M3HA 4LK9A 4BBQA 4ZUXU 5D1MB 4X3GA 4YAXA 2YUCA 4LKAA 2LQ6A 2VNFA 2MIQA 4R8PK 4L58A 2Y1NA 5TBNA 2ECVA 1WEQA 2VPEA 2NAAA 3LQHA 3ZPV1 2F6NA 5G05B 4TKPB 3KV6A 2E6SA 2QICA 2FUIA 3GV4A 5AIUA 2MA5A 4FIPA 3N9QA 3NG2A 2H0DA 3PHDA 5EYAF 3DQVR 2KWJA 5TDRA 3C5KA 3SHBA 2YYRA 4A4BA 2E6RA 4LLBA 4AP4A 4I7BA 1VYXA 2KGIA 4V3KC 4WZ0A 1WE9A 5C11A 5LCWB 4GNEA 2FSAA 5H1VA 1BORA 2M1RA 2VJFA 2MD7B 4ZDTA 2K17A 3N9NA 2UZGA 5I3LA 1JM7B 5TDWA 4UI9B 3ZNIA 3ZVZB 4YADA 1V87A 2C2LA 2K1JA 4WZ2A 2Y43A 2VPBA 5B75A 4A49A 3ZPVE 2QJ0A 3HTKC 3U5NA 2MT5A 3O37A 3C6WA 4MVTA 5H1TA 2LGVA 2RSDA 4N3WA 4YBSA 4GNFA 4IC3A 1E4UA 2G6QA 2VJEB 1WEVA 4XI1A 5LKTA 3U5MA 5LKZA 3DPLR 5FB1A 3M63A 4MSXA 3RPGC 1WEPA 3MHHA 5TRBA 2KWKA 5FEYA 2YURA 5D1LB 5B78A 3KV5A 1WENA 2LRIC 1MM2A 3T6RA 5B77A 3LRQA 2LGLA 5DINA 2ECWA 5D1KB 4IC2A 2KFTA 4V3LC 2YHNA 1WEMA 3O35A 5TABA 1Z2QA 2I50A 2JMDA 4WA6A 2LGKA 4UP0A 1FP0A 3I2DA 2KR4A 2VP7A 1WEOA 5JG6A 5LKUA 1WGMA 2ECTA 1RMDA 3L1ZB 2CKLB 4I7DA 4NN2A 4PTBA 3O34A 2YW8A 4AYCA 4W4UA 3PURA 3O70A 3V43A 2YREA 5C13A 4YATA 5B79A 4S3OC 4O64A 5KH9A 2ECGA 2LDRA 1WEUA 3LQJA 2KWNA 4R7EA 3ZYQA 4LJNA 5J3XA 2L80A 3M99A 4PPEA 2CSZA 3SOXA 5B76A 4QF3A 1DVPA 3SOUA 4WZ3B 2EODA 2M85A 5H1UA 3SOWA 2F6JA 4YBTA 2YQLA 2VPGA 1HYIA 4F52B 2D8SA 3MHSA 2MNZA 3RPGB 4CA1A 4AVXA 1WIMA 4FO9A 3HCTA 4YC9A 1IYMA 2YSMA 5G04B 2KWOA 1WESA 2L0BA 2YQMA 3N9PA 1XWHA 1Z60A 3PUQA 2MNYA 4FK5A 2KREA 1N87A 3N9MA 2PUYA 4QF2A 3EB5A 2AN6A 3KNVA 1VD4A 5H9MA 2YU4A 3ASLA 2C2VS 2F42A 1JM7A 1K2FA 3U5PA 4BHWA 1FBVA 2EGPA
chains in the Genus database with same CATH superfamily
1LDJB 3N9LA 1X4IA 3PLWA 3VK6A 2KU3A 3L1XA 4FJCA 4GB0A 4YBMA 4ZQLA 2H0DB 2KE1A 1WEEA 3HCUA 4I7CA 3LDYA 2ECNA 2L75A 4AUQB 1CHCA 4S3OB 5G0FA 4L7XA 3LVQE 2MD8C 3N9OA 3O36A 2YT5A 2LGGA 2VJEA 4GNDA 2MA6A 5B8DA 4YABA 4R2YA 3T7LA 2VJFB 2G45A 2D8UA 3DWDA 1MM3A 2XOZA 3M62A 4P5OB 1F62A 3L11A 2HYED 2XOYA 1X4JA 2K16A 2Y1MA 2XOCA 2LV9A 2JMJA 5SVXA 2VPDA 3O33A 2FD4A 4C9ZA 2QIZA 4UP5A 3JUEA 1T1HA 2K4DA 2FUUA 3GL6A 5KH7A 1HYJA 5AITA 3QZVA 2JRJA 2JMIA 2KGGA 2KIZA 3FJUB 2YSJA 4Q6FA 1WEWA 2EA6A 3FEHA 2MUMA 2YHOA 5FERA 5KH3A 2DX8A 1DCQA 2OXQC 1JOCA 2XEUA 1U6GB 3H7HA 4A0CD 1WILA 2CKLA 4LADB 2LXHC 2IDAA 2RI7A 5DKAA 3FM8C 4GNGA 4CCGX 2CT2A 2M13A 3O7AA 3ZTGA 2M6MA 3FL2A 2CSYA 2L43A 1LDKC 1WFKA 4B7YC 2PNXA 3KQIA 3M7KA 2G43A 2LN0A 2E61A 2ECIA 2LXPC 4A4CA 2HDPA 5LKXA 2XB1A 3SUBA 4B86C 2OWAA 2ECJA 1Z6UA 3EB6A 3ZVYA 1ZBDB 4N4FA 2L5UA 3HCSA 1VFYA 2FFWA 5FB0A 1X4UA 3LQIA 2KYUA 2BAYA 3RTRB 1G25A 4AYCB 2ZETC 3U5OA 3IHPA 2M3HA 4LK9A 4BBQA 2KKXA 4ZUXU 5D1MB 4X3GA 4YAXA 4Z0RA 2YUCA 4LKAA 3KDEC 3O47A 2LQ6A 2VNFA 2MIQA 4R8PK 4L58A 5K3QA 2Y1NA 5TBNA 2ECVA 1WEQA 2VPEA 2NAAA 3LQHA 3ZPV1 2F6NA 4H9DA 5G05B 3DDTA 4TKPB 2DJAA 3KV6A 2E6SA 2QICA 3T9KA 2FUIA 3GV4A 5AIUA 2MA5A 4FIPA 3N9QA 3NG2A 2H0DA 3PHDA 5EYAF 3DQVR 2KWJA 5TDRA 4O62A 3C5KA 3SHBA 2EGMA 2YYRA 2P57A 4A4BA 2E6RA 2L7PA 5SVIB 4LLBA 4AP4A 4I7BA 1VYXA 2KGIA 4V3KC 4OGEA 4WZ0A 1WE9A 5C11A 5LCWB 2YVRA 2FSAA 4GNEA 5H1VA 1BORA 2M1RA 2VJFA 2MD7B 4ZDTA 2K17A 3N9NA 2UZGA 2B0OE 5I3LA 1JM7B 5TDWA 4UI9B 2CRRA 3ZNIA 4F1PA 3ZVZB 4YADA 1V87A 2C2LA 2K1JA 4WZ2A 2Y43A 2VPBA 3LJUX 3MDBC 5B75A 4A49A 3ZPVE 2QJ0A 3HTKC 3U5NA 2MT5A 3O37A 3C6WA 4MVTA 5H1TA 2EXUA 2XP0A 2LGVA 2RSDA 4N3WA 4YBSA 4GNFA 4IC3A 1E4UA 2G6QA 2VJEB 1WEVA 4XI1A 5LKTA 3U5MA 5LKZA 3DPLR 5FB1A 3M63A 4MSXA 3RPGC 1WEPA 3MHHA 2KWKA 5TRBA 5FEYA 2YURA 5D1LB 2CRWA 5B78A 3KV5A 1WENA 2LRIC 3LVRE 1MM2A 3T6RA 5B77A 3LRQA 2KKYA 2LGLA 2DSMA 5DINA 2ECWA 5D1KB 4IC2A 2KFTA 4V3LC 1MBMA 2YHNA 1WEMA 2JM3A 3O35A 3Q1DA 1Z2QA 5TABA 2I50A 2JMDA 4WA6A 2LGKA 2IQJA 4UP0A 1FP0A 3I2DA 2KR4A 2VP7A 1WEOA 2CONA 5JG6A 5LKUA 1WGMA 2ECTA 1RMDA 3L1ZB 2CKLB 4I7DA 4NN2A 4PTBA 3O34A 2YW8A 4AYCA 4W4UA 3PURA 3O70A 3V43A 2YREA 5SVYA 2CSVA 5C13A 4YATA 5B79A 4S3OC 4O64A 5KH9A 2ECGA 2LDRA 3E2DA 2MKEA 1WEUA 3LQJA 2KWNA 2LAUA 4R7EA 3ZYQA 4LJNA 2RR4A 3FAOA 2L80A 5J3XA 3M99A 4PPEA 2CSZA 3SOXA 5B76A 4QF3A 1DVPA 3SOUA 4WZ3B 2EODA 2M85A 5H1UA 3SOWA 2F6JA 4YBTA 2YQLA 2VPGA 1HYIA 4F52B 2D8SA 3FANA 3MHSA 2MNZA 3RPGB 4CA1A 4Z0OA 4AVXA 1WIMA 4FO9A 3HCTA 4YC9A 1IYMA 2YSMA 5G04B 2KWOA 1WESA 2L0BA 2YQMA 3N9PA 1XWHA 1Z60A 3PUQA 2MNYA 4FK5A 5SVIA 2KREA 2JUNA 1N87A 3N9MA 2PUYA 4QF2A 3EB5A 2AN6A 3KNVA 1VD4A 4OGCA 5H9MA 2YU4A 3ASLA 4QQ4A 2C2VS 2F42A 1JM7A 1K2FA 3U5PA 4BHWA 1FBVA 2EGPA
chains in the Genus database with same CATH topology
1LDJB 3N9LA 1X4IA 3VK6A 2KU3A 3L1XA 4FJCA 4GB0A 4YBMA 4ZQLA 2H0DB 2KE1A 1WEEA 3HCUA 4I7CA 2ECNA 2L75A 4AUQB 1CHCA 4S3OB 5G0FA 4L7XA 2MD8C 3N9OA 3O36A 2YT5A 2LGGA 2VJEA 4GNDA 2MA6A 5B8DA 4YABA 4R2YA 3T7LA 2VJFB 2G45A 1MM3A 3M62A 4P5OB 1F62A 3L11A 2HYED 1X4JA 2K16A 2Y1MA 2LV9A 2JMJA 2VPDA 3O33A 4C9ZA 2QIZA 4UP5A 1T1HA 2K4DA 2FUUA 3GL6A 5KH7A 1HYJA 5AITA 3QZVA 2JRJA 2JMIA 2KGGA 2KIZA 2YSJA 4Q6FA 1WEWA 2EA6A 2MUMA 2YHOA 5FERA 5KH3A 2DX8A 2OXQC 1JOCA 2XEUA 1U6GB 4A0CD 1WILA 2CKLA 4LADB 2LXHC 2IDAA 2RI7A 5DKAA 4GNGA 4CCGX 2CT2A 3O7AA 3ZTGA 2M6MA 3FL2A 2CSYA 2L43A 1LDKC 1WFKA 4B7YC 2PNXA 3KQIA 2G43A 2LN0A 2ECIA 2LXPC 4A4CA 2HDPA 5LKXA 2XB1A 4B86C 2ECJA 1Z6UA 3EB6A 3ZVYA 1ZBDB 4N4FA 2L5UA 3HCSA 1VFYA 5FB0A 1X4UA 3LQIA 2KYUA 2BAYA 3RTRB 1G25A 4AYCB 2ZETC 3U5OA 3IHPA 2M3HA 4LK9A 4BBQA 4ZUXU 5D1MB 4X3GA 4YAXA 2YUCA 4LKAA 2LQ6A 2VNFA 2MIQA 4R8PK 4L58A 2Y1NA 5TBNA 2ECVA 1WEQA 2VPEA 2NAAA 3LQHA 3ZPV1 2F6NA 5G05B 4TKPB 3KV6A 2E6SA 2QICA 2FUIA 3GV4A 5AIUA 2MA5A 4FIPA 3N9QA 3NG2A 2H0DA 3PHDA 5EYAF 3DQVR 2KWJA 5TDRA 3C5KA 3SHBA 2YYRA 4A4BA 2E6RA 4LLBA 4AP4A 4I7BA 1VYXA 2KGIA 4V3KC 4WZ0A 1WE9A 5C11A 5LCWB 4GNEA 2FSAA 5H1VA 1BORA 2M1RA 2VJFA 2MD7B 4ZDTA 2K17A 3N9NA 2UZGA 5I3LA 1JM7B 5TDWA 4UI9B 3ZNIA 3ZVZB 4YADA 1V87A 2C2LA 2K1JA 4WZ2A 2Y43A 2VPBA 5B75A 4A49A 3ZPVE 2QJ0A 3HTKC 3U5NA 2MT5A 3O37A 3C6WA 4MVTA 5H1TA 2LGVA 2RSDA 4N3WA 4YBSA 4GNFA 4IC3A 1E4UA 2G6QA 2VJEB 1WEVA 4XI1A 5LKTA 3U5MA 5LKZA 3DPLR 5FB1A 3M63A 4MSXA 3RPGC 1WEPA 3MHHA 5TRBA 2KWKA 5FEYA 2YURA 5D1LB 5B78A 3KV5A 1WENA 2LRIC 1MM2A 3T6RA 5B77A 3LRQA 2LGLA 5DINA 2ECWA 5D1KB 4IC2A 2KFTA 4V3LC 2YHNA 1WEMA 3O35A 5TABA 1Z2QA 2I50A 2JMDA 4WA6A 2LGKA 4UP0A 1FP0A 3I2DA 2KR4A 2VP7A 1WEOA 5JG6A 5LKUA 1WGMA 2ECTA 1RMDA 3L1ZB 2CKLB 4I7DA 4NN2A 4PTBA 3O34A 2YW8A 4AYCA 4W4UA 3PURA 3O70A 3V43A 2YREA 5C13A 4YATA 5B79A 4S3OC 4O64A 5KH9A 2ECGA 2LDRA 1WEUA 3LQJA 2KWNA 4R7EA 3ZYQA 4LJNA 5J3XA 2L80A 3M99A 4PPEA 2CSZA 3SOXA 5B76A 4QF3A 1DVPA 3SOUA 4WZ3B 2EODA 2M85A 5H1UA 3SOWA 2F6JA 4YBTA 2YQLA 2VPGA 1HYIA 4F52B 2D8SA 3MHSA 2MNZA 3RPGB 4CA1A 4AVXA 1WIMA 4FO9A 3HCTA 4YC9A 1IYMA 2YSMA 5G04B 2KWOA 1WESA 2L0BA 2YQMA 3N9PA 1XWHA 1Z60A 3PUQA 2MNYA 4FK5A 2KREA 1N87A 3N9MA 2PUYA 4QF2A 3EB5A 2AN6A 3KNVA 1VD4A 5H9MA 2YU4A 3ASLA 2C2VS 2F42A 1JM7A 1K2FA 3U5PA 4BHWA 1FBVA 2EGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDJ B;  3N9L A;  1X4I A;  3VK6 A;  2KU3 A;  3L1X A;  4FJC A;  4GB0 A;  4YBM A;  4ZQL A;  2H0D B;  2KE1 A;  1WEE A;  3HCU A;  4I7C A;  2ECN A;  2L75 A;  4AUQ B;  1CHC A;  4S3O B;  5G0F A;  4L7X A;  2MD8 C;  3N9O A;  3O36 A;  2YT5 A;  2LGG A;  2VJE A;  4GND A;  2MA6 A;  5B8D A;  4YAB A;  4R2Y A;  3T7L A;  2VJF B;  2G45 A;  1MM3 A;  3M62 A;  4P5O B;  1F62 A;  3L11 A;  2HYE D;  1X4J A;  2K16 A;  2Y1M A;  2LV9 A;  2JMJ A;  2VPD A;  3O33 A;  4C9Z A;  2QIZ A;  4UP5 A;  1T1H A;  2K4D A;  2FUU A;  3GL6 A;  5KH7 A;  1HYJ A;  5AIT A;  3QZV A;  2JRJ A;  2JMI A;  2KGG A;  2KIZ A;  2YSJ A;  4Q6F A;  1WEW A;  2EA6 A;  2MUM A;  2YHO A;  5FER A;  5KH3 A;  2DX8 A;  2OXQ C;  1JOC A;  2XEU A;  1U6G B;  4A0C D;  1WIL A;  2CKL A;  4LAD B;  2LXH C;  2IDA A;  2RI7 A;  5DKA A;  4GNG A;  4CCG X;  2CT2 A;  3O7A A;  3ZTG A;  2M6M A;  3FL2 A;  2CSY A;  2L43 A;  1LDK C;  1WFK A;  4B7Y C;  2PNX A;  3KQI A;  2G43 A;  2LN0 A;  2ECI A;  2LXP C;  4A4C A;  2HDP A;  5LKX A;  2XB1 A;  4B86 C;  2ECJ A;  1Z6U A;  3EB6 A;  3ZVY A;  1ZBD B;  4N4F A;  2L5U A;  3HCS A;  1VFY A;  5FB0 A;  1X4U A;  3LQI A;  2KYU A;  2BAY A;  3RTR B;  1G25 A;  4AYC B;  2ZET C;  3U5O A;  3IHP A;  2M3H A;  4LK9 A;  4BBQ A;  4ZUX U;  5D1M B;  4X3G A;  4YAX A;  2YUC A;  4LKA A;  2LQ6 A;  2VNF A;  2MIQ A;  4R8P K;  4L58 A;  2Y1N A;  5TBN A;  2ECV A;  1WEQ A;  2VPE A;  2NAA A;  3LQH A;  3ZPV 1;  2F6N A;  5G05 B;  4TKP B;  3KV6 A;  2E6S A;  2QIC A;  2FUI A;  3GV4 A;  5AIU A;  2MA5 A;  4FIP A;  3N9Q A;  3NG2 A;  2H0D A;  3PHD A;  5EYA F;  3DQV R;  2KWJ A;  5TDR A;  3C5K A;  3SHB A;  2YYR A;  4A4B A;  2E6R A;  4LLB A;  4AP4 A;  4I7B A;  1VYX A;  2KGI A;  4V3K C;  4WZ0 A;  1WE9 A;  5C11 A;  5LCW B;  4GNE A;  2FSA A;  5H1V A;  1BOR A;  2M1R A;  2VJF A;  2MD7 B;  4ZDT A;  2K17 A;  3N9N A;  2UZG A;  5I3L A;  1JM7 B;  5TDW A;  4UI9 B;  3ZNI A;  3ZVZ B;  4YAD A;  1V87 A;  2C2L A;  2K1J A;  4WZ2 A;  2Y43 A;  2VPB A;  5B75 A;  4A49 A;  3ZPV E;  2QJ0 A;  3HTK C;  3U5N A;  2MT5 A;  3O37 A;  3C6W A;  4MVT A;  5H1T A;  2LGV A;  2RSD A;  4N3W A;  4YBS A;  4GNF A;  4IC3 A;  1E4U A;  2G6Q A;  2VJE B;  1WEV A;  4XI1 A;  5LKT A;  3U5M A;  5LKZ A;  3DPL R;  5FB1 A;  3M63 A;  4MSX A;  3RPG C;  1WEP A;  3MHH A;  5TRB A;  2KWK A;  5FEY A;  2YUR A;  5D1L B;  5B78 A;  3KV5 A;  1WEN A;  2LRI C;  1MM2 A;  3T6R A;  5B77 A;  3LRQ A;  2LGL A;  5DIN A;  2ECW A;  5D1K B;  4IC2 A;  2KFT A;  4V3L C;  2YHN A;  1WEM A;  3O35 A;  5TAB A;  1Z2Q A;  2I50 A;  2JMD A;  4WA6 A;  2LGK A;  4UP0 A;  1FP0 A;  3I2D A;  2KR4 A;  2VP7 A;  1WEO A;  5JG6 A;  5LKU A;  1WGM A;  2ECT A;  1RMD A;  3L1Z B;  2CKL B;  4I7D A;  4NN2 A;  4PTB A;  3O34 A;  2YW8 A;  4AYC A;  4W4U A;  3PUR A;  3O70 A;  3V43 A;  2YRE A;  5C13 A;  4YAT A;  5B79 A;  4S3O C;  4O64 A;  5KH9 A;  2ECG A;  2LDR A;  1WEU A;  3LQJ A;  2KWN A;  4R7E A;  3ZYQ A;  4LJN A;  5J3X A;  2L80 A;  3M99 A;  4PPE A;  2CSZ A;  3SOX A;  5B76 A;  4QF3 A;  1DVP A;  3SOU A;  4WZ3 B;  2EOD A;  2M85 A;  5H1U A;  3SOW A;  2F6J A;  4YBT A;  2YQL A;  2VPG A;  1HYI A;  4F52 B;  2D8S A;  3MHS A;  2MNZ A;  3RPG B;  4CA1 A;  4AVX A;  1WIM A;  4FO9 A;  3HCT A;  4YC9 A;  1IYM A;  2YSM A;  5G04 B;  2KWO A;  1WES A;  2L0B A;  2YQM A;  3N9P A;  1XWH A;  1Z60 A;  3PUQ A;  2MNY A;  4FK5 A;  2KRE A;  1N87 A;  3N9M A;  2PUY A;  4QF2 A;  3EB5 A;  2AN6 A;  3KNV A;  1VD4 A;  5H9M A;  2YU4 A;  3ASL A;  2C2V S;  2F42 A;  1JM7 A;  1K2F A;  3U5P A;  4BHW A;  1FBV A;  2EGP A; 
#chains in the Genus database with same CATH topology
 1LDJ B;  3N9L A;  1X4I A;  3PLW A;  3VK6 A;  2KU3 A;  3L1X A;  4FJC A;  4GB0 A;  4YBM A;  4ZQL A;  2H0D B;  2KE1 A;  1WEE A;  3HCU A;  4I7C A;  3LDY A;  2ECN A;  2L75 A;  4AUQ B;  1CHC A;  4S3O B;  5G0F A;  4L7X A;  3LVQ E;  2MD8 C;  3N9O A;  3O36 A;  2YT5 A;  2LGG A;  2VJE A;  4GND A;  2MA6 A;  5B8D A;  4YAB A;  4R2Y A;  3T7L A;  2VJF B;  2G45 A;  2D8U A;  3DWD A;  1MM3 A;  2XOZ A;  3M62 A;  4P5O B;  1F62 A;  3L11 A;  2HYE D;  2XOY A;  1X4J A;  2K16 A;  2Y1M A;  2XOC A;  2LV9 A;  2JMJ A;  5SVX A;  2VPD A;  3O33 A;  2FD4 A;  4C9Z A;  2QIZ A;  4UP5 A;  3JUE A;  1T1H A;  2K4D A;  2FUU A;  3GL6 A;  5KH7 A;  1HYJ A;  5AIT A;  3QZV A;  2JRJ A;  2JMI A;  2KGG A;  2KIZ A;  3FJU B;  2YSJ A;  4Q6F A;  1WEW A;  2EA6 A;  3FEH A;  2MUM A;  2YHO A;  5FER A;  5KH3 A;  2DX8 A;  1DCQ A;  2OXQ C;  1JOC A;  2XEU A;  1U6G B;  3H7H A;  4A0C D;  1WIL A;  2CKL A;  4LAD B;  2LXH C;  2IDA A;  2RI7 A;  5DKA A;  3FM8 C;  4GNG A;  4CCG X;  2CT2 A;  2M13 A;  3O7A A;  3ZTG A;  2M6M A;  3FL2 A;  2CSY A;  2L43 A;  1LDK C;  1WFK A;  4B7Y C;  2PNX A;  3KQI A;  3M7K A;  2G43 A;  2LN0 A;  2E61 A;  2ECI A;  2LXP C;  4A4C A;  2HDP A;  5LKX A;  2XB1 A;  3SUB A;  4B86 C;  2OWA A;  2ECJ A;  1Z6U A;  3EB6 A;  3ZVY A;  1ZBD B;  4N4F A;  2L5U A;  3HCS A;  1VFY A;  2FFW A;  5FB0 A;  1X4U A;  3LQI A;  2KYU A;  2BAY A;  3RTR B;  1G25 A;  4AYC B;  2ZET C;  3U5O A;  3IHP A;  2M3H A;  4LK9 A;  4BBQ A;  2KKX A;  4ZUX U;  5D1M B;  4X3G A;  4YAX A;  4Z0R A;  2YUC A;  4LKA A;  3KDE C;  3O47 A;  2LQ6 A;  2VNF A;  2MIQ A;  4R8P K;  4L58 A;  5K3Q A;  2Y1N A;  5TBN A;  2ECV A;  1WEQ A;  2VPE A;  2NAA A;  3LQH A;  3ZPV 1;  2F6N A;  4H9D A;  5G05 B;  3DDT A;  4TKP B;  2DJA A;  3KV6 A;  2E6S A;  2QIC A;  3T9K A;  2FUI A;  3GV4 A;  5AIU A;  2MA5 A;  4FIP A;  3N9Q A;  3NG2 A;  2H0D A;  3PHD A;  5EYA F;  3DQV R;  2KWJ A;  5TDR A;  4O62 A;  3C5K A;  3SHB A;  2EGM A;  2YYR A;  2P57 A;  4A4B A;  2E6R A;  2L7P A;  5SVI B;  4LLB A;  4AP4 A;  4I7B A;  1VYX A;  2KGI A;  4V3K C;  4OGE A;  4WZ0 A;  1WE9 A;  5C11 A;  5LCW B;  2YVR A;  2FSA A;  4GNE A;  5H1V A;  1BOR A;  2M1R A;  2VJF A;  2MD7 B;  4ZDT A;  2K17 A;  3N9N A;  2UZG A;  2B0O E;  5I3L A;  1JM7 B;  5TDW A;  4UI9 B;  2CRR A;  3ZNI A;  4F1P A;  3ZVZ B;  4YAD A;  1V87 A;  2C2L A;  2K1J A;  4WZ2 A;  2Y43 A;  2VPB A;  3LJU X;  3MDB C;  5B75 A;  4A49 A;  3ZPV E;  2QJ0 A;  3HTK C;  3U5N A;  2MT5 A;  3O37 A;  3C6W A;  4MVT A;  5H1T A;  2EXU A;  2XP0 A;  2LGV A;  2RSD A;  4N3W A;  4YBS A;  4GNF A;  4IC3 A;  1E4U A;  2G6Q A;  2VJE B;  1WEV A;  4XI1 A;  5LKT A;  3U5M A;  5LKZ A;  3DPL R;  5FB1 A;  3M63 A;  4MSX A;  3RPG C;  1WEP A;  3MHH A;  2KWK A;  5TRB A;  5FEY A;  2YUR A;  5D1L B;  2CRW A;  5B78 A;  3KV5 A;  1WEN A;  2LRI C;  3LVR E;  1MM2 A;  3T6R A;  5B77 A;  3LRQ A;  2KKY A;  2LGL A;  2DSM A;  5DIN A;  2ECW A;  5D1K B;  4IC2 A;  2KFT A;  4V3L C;  1MBM A;  2YHN A;  1WEM A;  2JM3 A;  3O35 A;  3Q1D A;  1Z2Q A;  5TAB A;  2I50 A;  2JMD A;  4WA6 A;  2LGK A;  2IQJ A;  4UP0 A;  1FP0 A;  3I2D A;  2KR4 A;  2VP7 A;  1WEO A;  2CON A;  5JG6 A;  5LKU A;  1WGM A;  2ECT A;  1RMD A;  3L1Z B;  2CKL B;  4I7D A;  4NN2 A;  4PTB A;  3O34 A;  2YW8 A;  4AYC A;  4W4U A;  3PUR A;  3O70 A;  3V43 A;  2YRE A;  5SVY A;  2CSV A;  5C13 A;  4YAT A;  5B79 A;  4S3O C;  4O64 A;  5KH9 A;  2ECG A;  2LDR A;  3E2D A;  2MKE A;  1WEU A;  3LQJ A;  2KWN A;  2LAU A;  4R7E A;  3ZYQ A;  4LJN A;  2RR4 A;  3FAO A;  2L80 A;  5J3X A;  3M99 A;  4PPE A;  2CSZ A;  3SOX A;  5B76 A;  4QF3 A;  1DVP A;  3SOU A;  4WZ3 B;  2EOD A;  2M85 A;  5H1U A;  3SOW A;  2F6J A;  4YBT A;  2YQL A;  2VPG A;  1HYI A;  4F52 B;  2D8S A;  3FAN A;  3MHS A;  2MNZ A;  3RPG B;  4CA1 A;  4Z0O A;  4AVX A;  1WIM A;  4FO9 A;  3HCT A;  4YC9 A;  1IYM A;  2YSM A;  5G04 B;  2KWO A;  1WES A;  2L0B A;  2YQM A;  3N9P A;  1XWH A;  1Z60 A;  3PUQ A;  2MNY A;  4FK5 A;  5SVI A;  2KRE A;  2JUN A;  1N87 A;  3N9M A;  2PUY A;  4QF2 A;  3EB5 A;  2AN6 A;  3KNV A;  1VD4 A;  4OGC A;  5H9M A;  2YU4 A;  3ASL A;  4QQ4 A;  2C2V S;  2F42 A;  1JM7 A;  1K2F A;  3U5P A;  4BHW A;  1FBV A;  2EGP A; 
#chains in the Genus database with same CATH homology
 1LDJ B;  3N9L A;  1X4I A;  3VK6 A;  2KU3 A;  3L1X A;  4FJC A;  4GB0 A;  4YBM A;  4ZQL A;  2H0D B;  2KE1 A;  1WEE A;  3HCU A;  4I7C A;  2ECN A;  2L75 A;  4AUQ B;  1CHC A;  4S3O B;  5G0F A;  4L7X A;  2MD8 C;  3N9O A;  3O36 A;  2YT5 A;  2LGG A;  2VJE A;  4GND A;  2MA6 A;  5B8D A;  4YAB A;  4R2Y A;  3T7L A;  2VJF B;  2G45 A;  1MM3 A;  3M62 A;  4P5O B;  1F62 A;  3L11 A;  2HYE D;  1X4J A;  2K16 A;  2Y1M A;  2LV9 A;  2JMJ A;  2VPD A;  3O33 A;  4C9Z A;  2QIZ A;  4UP5 A;  1T1H A;  2K4D A;  2FUU A;  3GL6 A;  5KH7 A;  1HYJ A;  5AIT A;  3QZV A;  2JRJ A;  2JMI A;  2KGG A;  2KIZ A;  2YSJ A;  4Q6F A;  1WEW A;  2EA6 A;  2MUM A;  2YHO A;  5FER A;  5KH3 A;  2DX8 A;  2OXQ C;  1JOC A;  2XEU A;  1U6G B;  4A0C D;  1WIL A;  2CKL A;  4LAD B;  2LXH C;  2IDA A;  2RI7 A;  5DKA A;  4GNG A;  4CCG X;  2CT2 A;  3O7A A;  3ZTG A;  2M6M A;  3FL2 A;  2CSY A;  2L43 A;  1LDK C;  1WFK A;  4B7Y C;  2PNX A;  3KQI A;  2G43 A;  2LN0 A;  2ECI A;  2LXP C;  4A4C A;  2HDP A;  5LKX A;  2XB1 A;  4B86 C;  2ECJ A;  1Z6U A;  3EB6 A;  3ZVY A;  1ZBD B;  4N4F A;  2L5U A;  3HCS A;  1VFY A;  5FB0 A;  1X4U A;  3LQI A;  2KYU A;  2BAY A;  3RTR B;  1G25 A;  4AYC B;  2ZET C;  3U5O A;  3IHP A;  2M3H A;  4LK9 A;  4BBQ A;  4ZUX U;  5D1M B;  4X3G A;  4YAX A;  2YUC A;  4LKA A;  2LQ6 A;  2VNF A;  2MIQ A;  4R8P K;  4L58 A;  2Y1N A;  5TBN A;  2ECV A;  1WEQ A;  2VPE A;  2NAA A;  3LQH A;  3ZPV 1;  2F6N A;  5G05 B;  4TKP B;  3KV6 A;  2E6S A;  2QIC A;  2FUI A;  3GV4 A;  5AIU A;  2MA5 A;  4FIP A;  3N9Q A;  3NG2 A;  2H0D A;  3PHD A;  5EYA F;  3DQV R;  2KWJ A;  5TDR A;  3C5K A;  3SHB A;  2YYR A;  4A4B A;  2E6R A;  4LLB A;  4AP4 A;  4I7B A;  1VYX A;  2KGI A;  4V3K C;  4WZ0 A;  1WE9 A;  5C11 A;  5LCW B;  4GNE A;  2FSA A;  5H1V A;  1BOR A;  2M1R A;  2VJF A;  2MD7 B;  4ZDT A;  2K17 A;  3N9N A;  2UZG A;  5I3L A;  1JM7 B;  5TDW A;  4UI9 B;  3ZNI A;  3ZVZ B;  4YAD A;  1V87 A;  2C2L A;  2K1J A;  4WZ2 A;  2Y43 A;  2VPB A;  5B75 A;  4A49 A;  3ZPV E;  2QJ0 A;  3HTK C;  3U5N A;  2MT5 A;  3O37 A;  3C6W A;  4MVT A;  5H1T A;  2LGV A;  2RSD A;  4N3W A;  4YBS A;  4GNF A;  4IC3 A;  1E4U A;  2G6Q A;  2VJE B;  1WEV A;  4XI1 A;  5LKT A;  3U5M A;  5LKZ A;  3DPL R;  5FB1 A;  3M63 A;  4MSX A;  3RPG C;  1WEP A;  3MHH A;  5TRB A;  2KWK A;  5FEY A;  2YUR A;  5D1L B;  5B78 A;  3KV5 A;  1WEN A;  2LRI C;  1MM2 A;  3T6R A;  5B77 A;  3LRQ A;  2LGL A;  5DIN A;  2ECW A;  5D1K B;  4IC2 A;  2KFT A;  4V3L C;  2YHN A;  1WEM A;  3O35 A;  5TAB A;  1Z2Q A;  2I50 A;  2JMD A;  4WA6 A;  2LGK A;  4UP0 A;  1FP0 A;  3I2D A;  2KR4 A;  2VP7 A;  1WEO A;  5JG6 A;  5LKU A;  1WGM A;  2ECT A;  1RMD A;  3L1Z B;  2CKL B;  4I7D A;  4NN2 A;  4PTB A;  3O34 A;  2YW8 A;  4AYC A;  4W4U A;  3PUR A;  3O70 A;  3V43 A;  2YRE A;  5C13 A;  4YAT A;  5B79 A;  4S3O C;  4O64 A;  5KH9 A;  2ECG A;  2LDR A;  1WEU A;  3LQJ A;  2KWN A;  4R7E A;  3ZYQ A;  4LJN A;  5J3X A;  2L80 A;  3M99 A;  4PPE A;  2CSZ A;  3SOX A;  5B76 A;  4QF3 A;  1DVP A;  3SOU A;  4WZ3 B;  2EOD A;  2M85 A;  5H1U A;  3SOW A;  2F6J A;  4YBT A;  2YQL A;  2VPG A;  1HYI A;  4F52 B;  2D8S A;  3MHS A;  2MNZ A;  3RPG B;  4CA1 A;  4AVX A;  1WIM A;  4FO9 A;  3HCT A;  4YC9 A;  1IYM A;  2YSM A;  5G04 B;  2KWO A;  1WES A;  2L0B A;  2YQM A;  3N9P A;  1XWH A;  1Z60 A;  3PUQ A;  2MNY A;  4FK5 A;  2KRE A;  1N87 A;  3N9M A;  2PUY A;  4QF2 A;  3EB5 A;  2AN6 A;  3KNV A;  1VD4 A;  5H9M A;  2YU4 A;  3ASL A;  2C2V S;  2F42 A;  1JM7 A;  1K2F A;  3U5P A;  4BHW A;  1FBV A;  2EGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...