4V3LC

Rnf38-ub-ubch5b-ub complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
EQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
publication title Activation of a Primed Ring E3-E2-Ubiquitin Complex by Non-Covalent Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4v3lC00
4YBSA 2L43A 2K1JA 2G6QA 4ZQLA 1WEQA 2ZETC 2KFTA 3FL2A 2EODA 5H9MA 1E4UA 4WA6A 1HYIA 2BAYA 5B75A 4X3GA 3T6RA 3O35A 5AITA 3N9OA 3RPGB 3PUQA 2LN0A 3C6WA 5DKAA 4YBMA 2JMIA 1Z60A 2YU4A 4AVXA 5H1VA 1WEOA 4PTBA 3N9QA 4UP0A 3C5KA 2KE1A 2C2VS 1T1HA 3U5NA 2L0BA 3U5MA 1DVPA 4L7XA 4A49A 4ZDTA 1FP0A 4A4CA 2F6JA 3SOXA 4WZ0A 2C2LA 2PUYA 4FIPA 3L1ZB 4I7BA 1WIMA 2KR4A 2QIZA 2G43A 5LKUA 2CSYA 2VJEA 2Y43A 3ZVZB 5J3XA 3ZPVE 2FSAA 5H1TA 2VJEB 2CSZA 2M85A 4YAXA 4AYCA 3HCSA 3M99A 2YREA 4LADB 2MD7B 2ECVA 2M1RA 3LQJA 2IDAA 4W4UA 5C11A 4FO9A 5FB0A 5LKXA 2KWNA 5C13A 2K4DA 2MUMA 4S3OB 3N9MA 1WGMA 3O70A 1MM2A 4GNGA 2RI7A 4LJNA 4R8PK 2VPDA 1VD4A 5B76A 3ZVYA 3HCTA 1VFYA 2YURA 3O7AA 2ECIA 1WEVA 3KNVA 2LGGA 2ECWA 5I3LA 2M3HA 1XWHA 3N9NA 2HDPA 5DINA 5LKTA 1CHCA 2L80A 3SOWA 1N87A 4GB0A 2KYUA 2M6MA 2MNYA 4FK5A 5G0FA 3ASLA 4AP4A 5KH3A 1X4IA 2LXHC 5D1MB 2HYED 1V87A 2Y1NA 4P5OB 5B79A 1WEUA 1U6GB 3KV6A 4BBQA 2EA6A 2ECNA 1JM7A 3ZYQA 5G04B 5G05B 4B86C 2LDRA 1JM7B 5D1KB 5TBNA 4GNDA 5B77A 4TKPB 4YBTA 2YW8A 5TABA 1X4JA 1WEWA 4CCGX 4LLBA 3IHPA 2KWKA 3LRQA 2F42A 2L75A 2NAAA 3L1XA 2VPEA 2VJFA 2YUCA 1IYMA 1LDKC 4A0CD 2VJFB 2VP7A 2YQMA 4IC2A 2JMJA 3RPGC 4C9ZA 2JRJA 1WILA 2KWJA 3PURA 4AYCB 1RMDA 1MM3A 3O34A 2YHNA 2K17A 5KH9A 2KIZA 2QJ0A 4MVTA 2QICA 4NN2A 3U5PA 2YT5A 2YSJA 3RTRB 2DX8A 3N9LA 3O36A 1Z2QA 2H0DA 3LQIA 2D8SA 4I7DA 3VK6A 2H0DB 5B78A 1BORA 2E6SA 1WEPA 3DPLR 5TDWA 2VPBA 3M63A 4UI9B 4XI1A 2G45A 2LQ6A 2YQLA 3N9PA 2MD8C 5FEYA 4YABA 2XEUA 3HCUA 4B7YC 3ZNIA 2PNXA 2CKLA 3PHDA 2MT5A 2UZGA 1ZBDB 1Z6UA 4IC3A 5EYAF 2CKLB 2YHOA 4CA1A 5LCWB 1JOCA 2Y1MA 1WEMA 3QZVA 2MNZA 4R2YA 3EB6A 2ECJA 4LK9A 5TDRA 3SOUA 2K16A 1WE9A 3O33A 3MHHA 2KWOA 3NG2A 2MA5A 5AIUA 2EGPA 1K2FA 1WESA 1HYJA 1FBVA 4O64A 5FERA 2LGVA 5TRBA 4YC9A 3DQVR 3MHSA 2E6RA 2L5UA 3V43A 5B8DA 3ZPV1 1WENA 4GNFA 4N3WA 1G25A 3I2DA 4FJCA 2OXQC 4V3KC 2I50A 1X4UA 2KGIA 4F52B 5D1LB 2FUIA 4N4FA 4A4BA 4PPEA 4UP5A 2CT2A 3GL6A 4I7CA 2KU3A 4QF3A 2JMDA 2YYRA 5KH7A 2LV9A 4V3LC 4WZ2A 4LKAA 4QF2A 2LXPC 5FB1A 2VNFA 4WZ3B 3LQHA 3ZTGA 4Q6FA 2ECGA 3EB5A 2LGLA 2MIQA 2YSMA 4AUQB 2XB1A 2AN6A 2VPGA 3KQIA 2ECTA 2MA6A 3M62A 2LGKA 4R7EA 1LDJB 4BHWA 4MSXA 1VYXA 3GV4A 1WEEA 2LRIC 5H1UA 3KV5A 3O37A 4L58A 2KGGA 1F62A 4ZUXU 5LKZA 3L11A 2F6NA 2FUUA 3T7LA 5JG6A 2RSDA 4YATA 4S3OC 4GNEA 2KREA 3SHBA 1WFKA 3U5OA 4YADA 3HTKC
chains in the Genus database with same CATH superfamily
3H7HA 4YBSA 2L43A 2K1JA 2G6QA 4ZQLA 1WEQA 2ZETC 2KFTA 3FL2A 2EODA 3JUEA 2XP0A 5H9MA 1E4UA 4WA6A 1HYIA 2BAYA 2EXUA 5B75A 4X3GA 3T6RA 3O35A 5AITA 3N9OA 3RPGB 3PUQA 2LN0A 2FD4A 3C6WA 5DKAA 3E2DA 4YBMA 2JMIA 1Z60A 2YU4A 4AVXA 5H1VA 2D8UA 1WEOA 4PTBA 3N9QA 4UP0A 3C5KA 4H9DA 2KE1A 2C2VS 2YVRA 1T1HA 3U5NA 2L0BA 3U5MA 1DVPA 4L7XA 4A49A 4ZDTA 1FP0A 4A4CA 2F6JA 5SVXA 3SOXA 4WZ0A 3FM8C 2C2LA 2PUYA 4FIPA 3L1ZB 4I7BA 1WIMA 2KR4A 2QIZA 2G43A 5LKUA 2CSYA 2VJEA 2XOZA 2Y43A 3ZVZB 5J3XA 3ZPVE 2FSAA 5H1TA 2VJEB 2CSZA 2M85A 4YAXA 4AYCA 3HCSA 3M99A 2YREA 4LADB 2MD7B 2ECVA 2CRRA 1MBMA 2M1RA 3LQJA 3Q1DA 2IDAA 4W4UA 5C11A 4FO9A 5FB0A 2L7PA 5LKXA 2KWNA 5C13A 2K4DA 2MUMA 4QQ4A 4S3OB 2XOYA 3N9MA 1WGMA 2RR4A 3O70A 1MM2A 4GNGA 2RI7A 4LJNA 4R8PK 2VPDA 2CSVA 1VD4A 4Z0OA 5B76A 3LVRE 3ZVYA 3HCTA 1VFYA 2YURA 3FEHA 3O7AA 2KKXA 2ECIA 1WEVA 3KNVA 2LGGA 2ECWA 5I3LA 2M3HA 1XWHA 3N9NA 2HDPA 4OGEA 5DINA 5LKTA 1CHCA 2L80A 3SOWA 1N87A 4GB0A 2KYUA 2M6MA 2MNYA 4FK5A 5G0FA 3M7KA 3ASLA 4AP4A 5KH3A 1X4IA 2LXHC 5D1MB 3LVQE 2HYED 1V87A 2Y1NA 4P5OB 5B79A 1WEUA 1U6GB 3KV6A 4BBQA 2EA6A 2ECNA 1JM7A 3ZYQA 5G04B 5G05B 4B86C 2LDRA 1JM7B 5D1KB 5TBNA 3KDEC 4GNDA 5B77A 4TKPB 4YBTA 2KKYA 2YW8A 5TABA 1X4JA 1WEWA 4CCGX 4LLBA 3IHPA 2KWKA 3LRQA 2E61A 2F42A 2MKEA 2L75A 4Z0RA 2NAAA 3L1XA 2VPEA 2VJFA 2YUCA 1IYMA 1LDKC 4A0CD 2VJFB 2VP7A 2YQMA 4IC2A 2JMJA 3RPGC 4C9ZA 5SVIA 2JRJA 1WILA 2KWJA 3PURA 4AYCB 5SVIB 1RMDA 1MM3A 2LAUA 2FFWA 3O34A 2YHNA 2K17A 5KH9A 2KIZA 2QJ0A 4MVTA 2QICA 4NN2A 3U5PA 2YT5A 2YSJA 3RTRB 2DX8A 3N9LA 3O36A 1Z2QA 2H0DA 3LQIA 2D8SA 4I7DA 3VK6A 2H0DB 5B78A 1BORA 5SVYA 2CRWA 3O47A 2E6SA 2IQJA 3LJUX 1WEPA 2OWAA 3DPLR 5TDWA 2VPBA 3M63A 4UI9B 4XI1A 2G45A 2LQ6A 2YQLA 3N9PA 2MD8C 5FEYA 4YABA 2XEUA 3HCUA 4B7YC 3ZNIA 2PNXA 2CKLA 3PHDA 2MT5A 2UZGA 2B0OE 1ZBDB 1Z6UA 4IC3A 5EYAF 2CKLB 2YHOA 4CA1A 5LCWB 2DJAA 1JOCA 2Y1MA 3PLWA 1WEMA 3QZVA 3MDBC 2MNZA 2XOCA 4R2YA 3EB6A 2ECJA 4LK9A 5TDRA 3SOUA 2K16A 1WE9A 3O33A 3MHHA 2KWOA 2P57A 3NG2A 3FANA 2MA5A 5AIUA 2M13A 2EGPA 1K2FA 1WESA 1HYJA 1FBVA 4O64A 4OGCA 5FERA 2CONA 2LGVA 5TRBA 4YC9A 3DQVR 3LDYA 3MHSA 2E6RA 2L5UA 3V43A 5B8DA 3ZPV1 1WENA 4GNFA 4N3WA 1G25A 3I2DA 4FJCA 2OXQC 4V3KC 2I50A 1X4UA 2KGIA 4F52B 5D1LB 1DCQA 4F1PA 2FUIA 4N4FA 4A4BA 2JUNA 4PPEA 4UP5A 2CT2A 3GL6A 4I7CA 2KU3A 4QF3A 2JMDA 2YYRA 5KH7A 2LV9A 4V3LC 4WZ2A 4LKAA 4QF2A 2LXPC 5FB1A 2VNFA 4WZ3B 3LQHA 2DSMA 3ZTGA 4Q6FA 2ECGA 3EB5A 2LGLA 3T9KA 2MIQA 2EGMA 2YSMA 4AUQB 2XB1A 2AN6A 3FJUB 2VPGA 2JM3A 3KQIA 2ECTA 2MA6A 3M62A 2LGKA 5K3QA 3FAOA 3DWDA 4R7EA 3DDTA 1LDJB 4BHWA 4MSXA 1VYXA 3GV4A 1WEEA 2LRIC 5H1UA 3KV5A 3O37A 4L58A 4O62A 2KGGA 1F62A 4ZUXU 5LKZA 3L11A 2F6NA 2FUUA 3T7LA 5JG6A 2RSDA 3SUBA 4YATA 4S3OC 4GNEA 2KREA 3SHBA 1WFKA 3U5OA 4YADA 3HTKC
chains in the Genus database with same CATH topology
4YBSA 2L43A 2K1JA 2G6QA 4ZQLA 1WEQA 2ZETC 2KFTA 3FL2A 2EODA 5H9MA 1E4UA 4WA6A 1HYIA 2BAYA 5B75A 4X3GA 3T6RA 3O35A 5AITA 3N9OA 3RPGB 3PUQA 2LN0A 3C6WA 5DKAA 4YBMA 2JMIA 1Z60A 2YU4A 4AVXA 5H1VA 1WEOA 4PTBA 3N9QA 4UP0A 3C5KA 2KE1A 2C2VS 1T1HA 3U5NA 2L0BA 3U5MA 1DVPA 4L7XA 4A49A 4ZDTA 1FP0A 4A4CA 2F6JA 3SOXA 4WZ0A 2C2LA 2PUYA 4FIPA 3L1ZB 4I7BA 1WIMA 2KR4A 2QIZA 2G43A 5LKUA 2CSYA 2VJEA 2Y43A 3ZVZB 5J3XA 3ZPVE 2FSAA 5H1TA 2VJEB 2CSZA 2M85A 4YAXA 4AYCA 3HCSA 3M99A 2YREA 4LADB 2MD7B 2ECVA 2M1RA 3LQJA 2IDAA 4W4UA 5C11A 4FO9A 5FB0A 5LKXA 2KWNA 5C13A 2K4DA 2MUMA 4S3OB 3N9MA 1WGMA 3O70A 1MM2A 4GNGA 2RI7A 4LJNA 4R8PK 2VPDA 1VD4A 5B76A 3ZVYA 3HCTA 1VFYA 2YURA 3O7AA 2ECIA 1WEVA 3KNVA 2LGGA 2ECWA 5I3LA 2M3HA 1XWHA 3N9NA 2HDPA 5DINA 5LKTA 1CHCA 2L80A 3SOWA 1N87A 4GB0A 2KYUA 2M6MA 2MNYA 4FK5A 5G0FA 3ASLA 4AP4A 5KH3A 1X4IA 2LXHC 5D1MB 2HYED 1V87A 2Y1NA 4P5OB 5B79A 1WEUA 1U6GB 3KV6A 4BBQA 2EA6A 2ECNA 1JM7A 3ZYQA 5G04B 5G05B 4B86C 2LDRA 1JM7B 5D1KB 5TBNA 4GNDA 5B77A 4TKPB 4YBTA 2YW8A 5TABA 1X4JA 1WEWA 4CCGX 4LLBA 3IHPA 2KWKA 3LRQA 2F42A 2L75A 2NAAA 3L1XA 2VPEA 2VJFA 2YUCA 1IYMA 1LDKC 4A0CD 2VJFB 2VP7A 2YQMA 4IC2A 2JMJA 3RPGC 4C9ZA 2JRJA 1WILA 2KWJA 3PURA 4AYCB 1RMDA 1MM3A 3O34A 2YHNA 2K17A 5KH9A 2KIZA 2QJ0A 4MVTA 2QICA 4NN2A 3U5PA 2YT5A 2YSJA 3RTRB 2DX8A 3N9LA 3O36A 1Z2QA 2H0DA 3LQIA 2D8SA 4I7DA 3VK6A 2H0DB 5B78A 1BORA 2E6SA 1WEPA 3DPLR 5TDWA 2VPBA 3M63A 4UI9B 4XI1A 2G45A 2LQ6A 2YQLA 3N9PA 2MD8C 5FEYA 4YABA 2XEUA 3HCUA 4B7YC 3ZNIA 2PNXA 2CKLA 3PHDA 2MT5A 2UZGA 1ZBDB 1Z6UA 4IC3A 5EYAF 2CKLB 2YHOA 4CA1A 5LCWB 1JOCA 2Y1MA 1WEMA 3QZVA 2MNZA 4R2YA 3EB6A 2ECJA 4LK9A 5TDRA 3SOUA 2K16A 1WE9A 3O33A 3MHHA 2KWOA 3NG2A 2MA5A 5AIUA 2EGPA 1K2FA 1WESA 1HYJA 1FBVA 4O64A 5FERA 2LGVA 5TRBA 4YC9A 3DQVR 3MHSA 2E6RA 2L5UA 3V43A 5B8DA 3ZPV1 1WENA 4GNFA 4N3WA 1G25A 3I2DA 4FJCA 2OXQC 4V3KC 2I50A 1X4UA 2KGIA 4F52B 5D1LB 2FUIA 4N4FA 4A4BA 4PPEA 4UP5A 2CT2A 3GL6A 4I7CA 2KU3A 4QF3A 2JMDA 2YYRA 5KH7A 2LV9A 4V3LC 4WZ2A 4LKAA 4QF2A 2LXPC 5FB1A 2VNFA 4WZ3B 3LQHA 3ZTGA 4Q6FA 2ECGA 3EB5A 2LGLA 2MIQA 2YSMA 4AUQB 2XB1A 2AN6A 2VPGA 3KQIA 2ECTA 2MA6A 3M62A 2LGKA 4R7EA 1LDJB 4BHWA 4MSXA 1VYXA 3GV4A 1WEEA 2LRIC 5H1UA 3KV5A 3O37A 4L58A 2KGGA 1F62A 4ZUXU 5LKZA 3L11A 2F6NA 2FUUA 3T7LA 5JG6A 2RSDA 4YATA 4S3OC 4GNEA 2KREA 3SHBA 1WFKA 3U5OA 4YADA 3HTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBS A;  2L43 A;  2K1J A;  2G6Q A;  4ZQL A;  1WEQ A;  2ZET C;  2KFT A;  3FL2 A;  2EOD A;  5H9M A;  1E4U A;  4WA6 A;  1HYI A;  2BAY A;  5B75 A;  4X3G A;  3T6R A;  3O35 A;  5AIT A;  3N9O A;  3RPG B;  3PUQ A;  2LN0 A;  3C6W A;  5DKA A;  4YBM A;  2JMI A;  1Z60 A;  2YU4 A;  4AVX A;  5H1V A;  1WEO A;  4PTB A;  3N9Q A;  4UP0 A;  3C5K A;  2KE1 A;  2C2V S;  1T1H A;  3U5N A;  2L0B A;  3U5M A;  1DVP A;  4L7X A;  4A49 A;  4ZDT A;  1FP0 A;  4A4C A;  2F6J A;  3SOX A;  4WZ0 A;  2C2L A;  2PUY A;  4FIP A;  3L1Z B;  4I7B A;  1WIM A;  2KR4 A;  2QIZ A;  2G43 A;  5LKU A;  2CSY A;  2VJE A;  2Y43 A;  3ZVZ B;  5J3X A;  3ZPV E;  2FSA A;  5H1T A;  2VJE B;  2CSZ A;  2M85 A;  4YAX A;  4AYC A;  3HCS A;  3M99 A;  2YRE A;  4LAD B;  2MD7 B;  2ECV A;  2M1R A;  3LQJ A;  2IDA A;  4W4U A;  5C11 A;  4FO9 A;  5FB0 A;  5LKX A;  2KWN A;  5C13 A;  2K4D A;  2MUM A;  4S3O B;  3N9M A;  1WGM A;  3O70 A;  1MM2 A;  4GNG A;  2RI7 A;  4LJN A;  4R8P K;  2VPD A;  1VD4 A;  5B76 A;  3ZVY A;  3HCT A;  1VFY A;  2YUR A;  3O7A A;  2ECI A;  1WEV A;  3KNV A;  2LGG A;  2ECW A;  5I3L A;  2M3H A;  1XWH A;  3N9N A;  2HDP A;  5DIN A;  5LKT A;  1CHC A;  2L80 A;  3SOW A;  1N87 A;  4GB0 A;  2KYU A;  2M6M A;  2MNY A;  4FK5 A;  5G0F A;  3ASL A;  4AP4 A;  5KH3 A;  1X4I A;  2LXH C;  5D1M B;  2HYE D;  1V87 A;  2Y1N A;  4P5O B;  5B79 A;  1WEU A;  1U6G B;  3KV6 A;  4BBQ A;  2EA6 A;  2ECN A;  1JM7 A;  3ZYQ A;  5G04 B;  5G05 B;  4B86 C;  2LDR A;  1JM7 B;  5D1K B;  5TBN A;  4GND A;  5B77 A;  4TKP B;  4YBT A;  2YW8 A;  5TAB A;  1X4J A;  1WEW A;  4CCG X;  4LLB A;  3IHP A;  2KWK A;  3LRQ A;  2F42 A;  2L75 A;  2NAA A;  3L1X A;  2VPE A;  2VJF A;  2YUC A;  1IYM A;  1LDK C;  4A0C D;  2VJF B;  2VP7 A;  2YQM A;  4IC2 A;  2JMJ A;  3RPG C;  4C9Z A;  2JRJ A;  1WIL A;  2KWJ A;  3PUR A;  4AYC B;  1RMD A;  1MM3 A;  3O34 A;  2YHN A;  2K17 A;  5KH9 A;  2KIZ A;  2QJ0 A;  4MVT A;  2QIC A;  4NN2 A;  3U5P A;  2YT5 A;  2YSJ A;  3RTR B;  2DX8 A;  3N9L A;  3O36 A;  1Z2Q A;  2H0D A;  3LQI A;  2D8S A;  4I7D A;  3VK6 A;  2H0D B;  5B78 A;  1BOR A;  2E6S A;  1WEP A;  3DPL R;  5TDW A;  2VPB A;  3M63 A;  4UI9 B;  4XI1 A;  2G45 A;  2LQ6 A;  2YQL A;  3N9P A;  2MD8 C;  5FEY A;  4YAB A;  2XEU A;  3HCU A;  4B7Y C;  3ZNI A;  2PNX A;  2CKL A;  3PHD A;  2MT5 A;  2UZG A;  1ZBD B;  1Z6U A;  4IC3 A;  5EYA F;  2CKL B;  2YHO A;  4CA1 A;  5LCW B;  1JOC A;  2Y1M A;  1WEM A;  3QZV A;  2MNZ A;  4R2Y A;  3EB6 A;  2ECJ A;  4LK9 A;  5TDR A;  3SOU A;  2K16 A;  1WE9 A;  3O33 A;  3MHH A;  2KWO A;  3NG2 A;  2MA5 A;  5AIU A;  2EGP A;  1K2F A;  1WES A;  1HYJ A;  1FBV A;  4O64 A;  5FER A;  2LGV A;  5TRB A;  4YC9 A;  3DQV R;  3MHS A;  2E6R A;  2L5U A;  3V43 A;  5B8D A;  3ZPV 1;  1WEN A;  4GNF A;  4N3W A;  1G25 A;  3I2D A;  4FJC A;  2OXQ C;  4V3K C;  2I50 A;  1X4U A;  2KGI A;  4F52 B;  5D1L B;  2FUI A;  4N4F A;  4A4B A;  4PPE A;  4UP5 A;  2CT2 A;  3GL6 A;  4I7C A;  2KU3 A;  4QF3 A;  2JMD A;  2YYR A;  5KH7 A;  2LV9 A;  4V3L C;  4WZ2 A;  4LKA A;  4QF2 A;  2LXP C;  5FB1 A;  2VNF A;  4WZ3 B;  3LQH A;  3ZTG A;  4Q6F A;  2ECG A;  3EB5 A;  2LGL A;  2MIQ A;  2YSM A;  4AUQ B;  2XB1 A;  2AN6 A;  2VPG A;  3KQI A;  2ECT A;  2MA6 A;  3M62 A;  2LGK A;  4R7E A;  1LDJ B;  4BHW A;  4MSX A;  1VYX A;  3GV4 A;  1WEE A;  2LRI C;  5H1U A;  3KV5 A;  3O37 A;  4L58 A;  2KGG A;  1F62 A;  4ZUX U;  5LKZ A;  3L11 A;  2F6N A;  2FUU A;  3T7L A;  5JG6 A;  2RSD A;  4YAT A;  4S3O C;  4GNE A;  2KRE A;  3SHB A;  1WFK A;  3U5O A;  4YAD A;  3HTK C; 
#chains in the Genus database with same CATH topology
 3H7H A;  4YBS A;  2L43 A;  2K1J A;  2G6Q A;  4ZQL A;  1WEQ A;  2ZET C;  2KFT A;  3FL2 A;  2EOD A;  3JUE A;  2XP0 A;  5H9M A;  1E4U A;  4WA6 A;  1HYI A;  2BAY A;  2EXU A;  5B75 A;  4X3G A;  3T6R A;  3O35 A;  5AIT A;  3N9O A;  3RPG B;  3PUQ A;  2LN0 A;  2FD4 A;  3C6W A;  5DKA A;  3E2D A;  4YBM A;  2JMI A;  1Z60 A;  2YU4 A;  4AVX A;  5H1V A;  2D8U A;  1WEO A;  4PTB A;  3N9Q A;  4UP0 A;  3C5K A;  4H9D A;  2KE1 A;  2C2V S;  2YVR A;  1T1H A;  3U5N A;  2L0B A;  3U5M A;  1DVP A;  4L7X A;  4A49 A;  4ZDT A;  1FP0 A;  4A4C A;  2F6J A;  5SVX A;  3SOX A;  4WZ0 A;  3FM8 C;  2C2L A;  2PUY A;  4FIP A;  3L1Z B;  4I7B A;  1WIM A;  2KR4 A;  2QIZ A;  2G43 A;  5LKU A;  2CSY A;  2VJE A;  2XOZ A;  2Y43 A;  3ZVZ B;  5J3X A;  3ZPV E;  2FSA A;  5H1T A;  2VJE B;  2CSZ A;  2M85 A;  4YAX A;  4AYC A;  3HCS A;  3M99 A;  2YRE A;  4LAD B;  2MD7 B;  2ECV A;  2CRR A;  1MBM A;  2M1R A;  3LQJ A;  3Q1D A;  2IDA A;  4W4U A;  5C11 A;  4FO9 A;  5FB0 A;  2L7P A;  5LKX A;  2KWN A;  5C13 A;  2K4D A;  2MUM A;  4QQ4 A;  4S3O B;  2XOY A;  3N9M A;  1WGM A;  2RR4 A;  3O70 A;  1MM2 A;  4GNG A;  2RI7 A;  4LJN A;  4R8P K;  2VPD A;  2CSV A;  1VD4 A;  4Z0O A;  5B76 A;  3LVR E;  3ZVY A;  3HCT A;  1VFY A;  2YUR A;  3FEH A;  3O7A A;  2KKX A;  2ECI A;  1WEV A;  3KNV A;  2LGG A;  2ECW A;  5I3L A;  2M3H A;  1XWH A;  3N9N A;  2HDP A;  4OGE A;  5DIN A;  5LKT A;  1CHC A;  2L80 A;  3SOW A;  1N87 A;  4GB0 A;  2KYU A;  2M6M A;  2MNY A;  4FK5 A;  5G0F A;  3M7K A;  3ASL A;  4AP4 A;  5KH3 A;  1X4I A;  2LXH C;  5D1M B;  3LVQ E;  2HYE D;  1V87 A;  2Y1N A;  4P5O B;  5B79 A;  1WEU A;  1U6G B;  3KV6 A;  4BBQ A;  2EA6 A;  2ECN A;  1JM7 A;  3ZYQ A;  5G04 B;  5G05 B;  4B86 C;  2LDR A;  1JM7 B;  5D1K B;  5TBN A;  3KDE C;  4GND A;  5B77 A;  4TKP B;  4YBT A;  2KKY A;  2YW8 A;  5TAB A;  1X4J A;  1WEW A;  4CCG X;  4LLB A;  3IHP A;  2KWK A;  3LRQ A;  2E61 A;  2F42 A;  2MKE A;  2L75 A;  4Z0R A;  2NAA A;  3L1X A;  2VPE A;  2VJF A;  2YUC A;  1IYM A;  1LDK C;  4A0C D;  2VJF B;  2VP7 A;  2YQM A;  4IC2 A;  2JMJ A;  3RPG C;  4C9Z A;  5SVI A;  2JRJ A;  1WIL A;  2KWJ A;  3PUR A;  4AYC B;  5SVI B;  1RMD A;  1MM3 A;  2LAU A;  2FFW A;  3O34 A;  2YHN A;  2K17 A;  5KH9 A;  2KIZ A;  2QJ0 A;  4MVT A;  2QIC A;  4NN2 A;  3U5P A;  2YT5 A;  2YSJ A;  3RTR B;  2DX8 A;  3N9L A;  3O36 A;  1Z2Q A;  2H0D A;  3LQI A;  2D8S A;  4I7D A;  3VK6 A;  2H0D B;  5B78 A;  1BOR A;  5SVY A;  2CRW A;  3O47 A;  2E6S A;  2IQJ A;  3LJU X;  1WEP A;  2OWA A;  3DPL R;  5TDW A;  2VPB A;  3M63 A;  4UI9 B;  4XI1 A;  2G45 A;  2LQ6 A;  2YQL A;  3N9P A;  2MD8 C;  5FEY A;  4YAB A;  2XEU A;  3HCU A;  4B7Y C;  3ZNI A;  2PNX A;  2CKL A;  3PHD A;  2MT5 A;  2UZG A;  2B0O E;  1ZBD B;  1Z6U A;  4IC3 A;  5EYA F;  2CKL B;  2YHO A;  4CA1 A;  5LCW B;  2DJA A;  1JOC A;  2Y1M A;  3PLW A;  1WEM A;  3QZV A;  3MDB C;  2MNZ A;  2XOC A;  4R2Y A;  3EB6 A;  2ECJ A;  4LK9 A;  5TDR A;  3SOU A;  2K16 A;  1WE9 A;  3O33 A;  3MHH A;  2KWO A;  2P57 A;  3NG2 A;  3FAN A;  2MA5 A;  5AIU A;  2M13 A;  2EGP A;  1K2F A;  1WES A;  1HYJ A;  1FBV A;  4O64 A;  4OGC A;  5FER A;  2CON A;  2LGV A;  5TRB A;  4YC9 A;  3DQV R;  3LDY A;  3MHS A;  2E6R A;  2L5U A;  3V43 A;  5B8D A;  3ZPV 1;  1WEN A;  4GNF A;  4N3W A;  1G25 A;  3I2D A;  4FJC A;  2OXQ C;  4V3K C;  2I50 A;  1X4U A;  2KGI A;  4F52 B;  5D1L B;  1DCQ A;  4F1P A;  2FUI A;  4N4F A;  4A4B A;  2JUN A;  4PPE A;  4UP5 A;  2CT2 A;  3GL6 A;  4I7C A;  2KU3 A;  4QF3 A;  2JMD A;  2YYR A;  5KH7 A;  2LV9 A;  4V3L C;  4WZ2 A;  4LKA A;  4QF2 A;  2LXP C;  5FB1 A;  2VNF A;  4WZ3 B;  3LQH A;  2DSM A;  3ZTG A;  4Q6F A;  2ECG A;  3EB5 A;  2LGL A;  3T9K A;  2MIQ A;  2EGM A;  2YSM A;  4AUQ B;  2XB1 A;  2AN6 A;  3FJU B;  2VPG A;  2JM3 A;  3KQI A;  2ECT A;  2MA6 A;  3M62 A;  2LGK A;  5K3Q A;  3FAO A;  3DWD A;  4R7E A;  3DDT A;  1LDJ B;  4BHW A;  4MSX A;  1VYX A;  3GV4 A;  1WEE A;  2LRI C;  5H1U A;  3KV5 A;  3O37 A;  4L58 A;  4O62 A;  2KGG A;  1F62 A;  4ZUX U;  5LKZ A;  3L11 A;  2F6N A;  2FUU A;  3T7L A;  5JG6 A;  2RSD A;  3SUB A;  4YAT A;  4S3O C;  4GNE A;  2KRE A;  3SHB A;  1WFK A;  3U5O A;  4YAD A;  3HTK C; 
#chains in the Genus database with same CATH homology
 4YBS A;  2L43 A;  2K1J A;  2G6Q A;  4ZQL A;  1WEQ A;  2ZET C;  2KFT A;  3FL2 A;  2EOD A;  5H9M A;  1E4U A;  4WA6 A;  1HYI A;  2BAY A;  5B75 A;  4X3G A;  3T6R A;  3O35 A;  5AIT A;  3N9O A;  3RPG B;  3PUQ A;  2LN0 A;  3C6W A;  5DKA A;  4YBM A;  2JMI A;  1Z60 A;  2YU4 A;  4AVX A;  5H1V A;  1WEO A;  4PTB A;  3N9Q A;  4UP0 A;  3C5K A;  2KE1 A;  2C2V S;  1T1H A;  3U5N A;  2L0B A;  3U5M A;  1DVP A;  4L7X A;  4A49 A;  4ZDT A;  1FP0 A;  4A4C A;  2F6J A;  3SOX A;  4WZ0 A;  2C2L A;  2PUY A;  4FIP A;  3L1Z B;  4I7B A;  1WIM A;  2KR4 A;  2QIZ A;  2G43 A;  5LKU A;  2CSY A;  2VJE A;  2Y43 A;  3ZVZ B;  5J3X A;  3ZPV E;  2FSA A;  5H1T A;  2VJE B;  2CSZ A;  2M85 A;  4YAX A;  4AYC A;  3HCS A;  3M99 A;  2YRE A;  4LAD B;  2MD7 B;  2ECV A;  2M1R A;  3LQJ A;  2IDA A;  4W4U A;  5C11 A;  4FO9 A;  5FB0 A;  5LKX A;  2KWN A;  5C13 A;  2K4D A;  2MUM A;  4S3O B;  3N9M A;  1WGM A;  3O70 A;  1MM2 A;  4GNG A;  2RI7 A;  4LJN A;  4R8P K;  2VPD A;  1VD4 A;  5B76 A;  3ZVY A;  3HCT A;  1VFY A;  2YUR A;  3O7A A;  2ECI A;  1WEV A;  3KNV A;  2LGG A;  2ECW A;  5I3L A;  2M3H A;  1XWH A;  3N9N A;  2HDP A;  5DIN A;  5LKT A;  1CHC A;  2L80 A;  3SOW A;  1N87 A;  4GB0 A;  2KYU A;  2M6M A;  2MNY A;  4FK5 A;  5G0F A;  3ASL A;  4AP4 A;  5KH3 A;  1X4I A;  2LXH C;  5D1M B;  2HYE D;  1V87 A;  2Y1N A;  4P5O B;  5B79 A;  1WEU A;  1U6G B;  3KV6 A;  4BBQ A;  2EA6 A;  2ECN A;  1JM7 A;  3ZYQ A;  5G04 B;  5G05 B;  4B86 C;  2LDR A;  1JM7 B;  5D1K B;  5TBN A;  4GND A;  5B77 A;  4TKP B;  4YBT A;  2YW8 A;  5TAB A;  1X4J A;  1WEW A;  4CCG X;  4LLB A;  3IHP A;  2KWK A;  3LRQ A;  2F42 A;  2L75 A;  2NAA A;  3L1X A;  2VPE A;  2VJF A;  2YUC A;  1IYM A;  1LDK C;  4A0C D;  2VJF B;  2VP7 A;  2YQM A;  4IC2 A;  2JMJ A;  3RPG C;  4C9Z A;  2JRJ A;  1WIL A;  2KWJ A;  3PUR A;  4AYC B;  1RMD A;  1MM3 A;  3O34 A;  2YHN A;  2K17 A;  5KH9 A;  2KIZ A;  2QJ0 A;  4MVT A;  2QIC A;  4NN2 A;  3U5P A;  2YT5 A;  2YSJ A;  3RTR B;  2DX8 A;  3N9L A;  3O36 A;  1Z2Q A;  2H0D A;  3LQI A;  2D8S A;  4I7D A;  3VK6 A;  2H0D B;  5B78 A;  1BOR A;  2E6S A;  1WEP A;  3DPL R;  5TDW A;  2VPB A;  3M63 A;  4UI9 B;  4XI1 A;  2G45 A;  2LQ6 A;  2YQL A;  3N9P A;  2MD8 C;  5FEY A;  4YAB A;  2XEU A;  3HCU A;  4B7Y C;  3ZNI A;  2PNX A;  2CKL A;  3PHD A;  2MT5 A;  2UZG A;  1ZBD B;  1Z6U A;  4IC3 A;  5EYA F;  2CKL B;  2YHO A;  4CA1 A;  5LCW B;  1JOC A;  2Y1M A;  1WEM A;  3QZV A;  2MNZ A;  4R2Y A;  3EB6 A;  2ECJ A;  4LK9 A;  5TDR A;  3SOU A;  2K16 A;  1WE9 A;  3O33 A;  3MHH A;  2KWO A;  3NG2 A;  2MA5 A;  5AIU A;  2EGP A;  1K2F A;  1WES A;  1HYJ A;  1FBV A;  4O64 A;  5FER A;  2LGV A;  5TRB A;  4YC9 A;  3DQV R;  3MHS A;  2E6R A;  2L5U A;  3V43 A;  5B8D A;  3ZPV 1;  1WEN A;  4GNF A;  4N3W A;  1G25 A;  3I2D A;  4FJC A;  2OXQ C;  4V3K C;  2I50 A;  1X4U A;  2KGI A;  4F52 B;  5D1L B;  2FUI A;  4N4F A;  4A4B A;  4PPE A;  4UP5 A;  2CT2 A;  3GL6 A;  4I7C A;  2KU3 A;  4QF3 A;  2JMD A;  2YYR A;  5KH7 A;  2LV9 A;  4V3L C;  4WZ2 A;  4LKA A;  4QF2 A;  2LXP C;  5FB1 A;  2VNF A;  4WZ3 B;  3LQH A;  3ZTG A;  4Q6F A;  2ECG A;  3EB5 A;  2LGL A;  2MIQ A;  2YSM A;  4AUQ B;  2XB1 A;  2AN6 A;  2VPG A;  3KQI A;  2ECT A;  2MA6 A;  3M62 A;  2LGK A;  4R7E A;  1LDJ B;  4BHW A;  4MSX A;  1VYX A;  3GV4 A;  1WEE A;  2LRI C;  5H1U A;  3KV5 A;  3O37 A;  4L58 A;  2KGG A;  1F62 A;  4ZUX U;  5LKZ A;  3L11 A;  2F6N A;  2FUU A;  3T7L A;  5JG6 A;  2RSD A;  4YAT A;  4S3O C;  4GNE A;  2KRE A;  3SHB A;  1WFK A;  3U5O A;  4YAD A;  3HTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...