4V3LC

Rnf38-ub-ubch5b-ub complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
EQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
publication title Activation of a Primed Ring E3-E2-Ubiquitin Complex by Non-Covalent Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4v3lC00
2F42A 2LGVA 5KH3A 3VK6A 2YYRA 3N9LA 2OXQC 4FO9A 4WZ3B 3DPLR 2MIQA 4PPEA 4BHWA 5FB0A 5FEYA 5G05B 4YC9A 2YU4A 5B8DA 2KR4A 4XI1A 2H0DB 2KWKA 2VPEA 2VPGA 3N9NA 3N9PA 1VD4A 3N9OA 4N3WA 1MM2A 2I50A 4BBQA 4YABA 2ECTA 3NG2A 2JMDA 4R2YA 2E6RA 2MNZA 5C13A 2LRIC 1WEVA 5JG6A 4I7CA 3LQIA 4AVXA 2QICA 3M62A 5B76A 1X4JA 2XB1A 4S3OC 4I7DA 1E4UA 3U5PA 1T1HA 4V3LC 4MSXA 2DX8A 2CT2A 3M99A 3O34A 4UP5A 2KWOA 1HYJA 5G04B 1WEEA 1JM7B 2XEUA 1WEUA 3GV4A 2ECVA 2L5UA 4GNGA 4L58A 4CCGX 2FUUA 2F6NA 1LDJB 2EGPA 2UZGA 4B86C 2JMJA 4GNFA 2KREA 1X4IA 4A4BA 4P5OB 4YATA 4YBSA 4FIPA 3V43A 3C5KA 3SOUA 1JOCA 3PHDA 4QF2A 2ECGA 3ASLA 2F6JA 1WENA 2YUCA 4LJNA 2G45A 3EB6A 3ZNIA 3N9MA 2JRJA 2PNXA 2ECJA 2KYUA 5B75A 3LQHA 2YREA 3KQIA 3U5OA 1VFYA 2VJFB 4GB0A 3O33A 2VJEB 1FP0A 4YBMA 5H9MA 5C11A 2EODA 3L1ZB 2KWJA 4TKPB 3HTKC 4WZ0A 1U6GB 2K4DA 1WEOA 1RMDA 1WEMA 3O36A 2G6QA 2CKLA 4YAXA 1CHCA 5D1MB 2KGGA 4A0CD 5TDRA 3QZVA 1Z6UA 2M3HA 2YURA 2LV9A 3LRQA 5KH9A 2RI7A 2EA6A 4YADA 1FBVA 4PTBA 2YT5A 3C6WA 2LGLA 4C9ZA 3ZYQA 2YSJA 5DKAA 2KFTA 1WEWA 3SOWA 4O64A 5I3LA 2JMIA 1LDKC 2C2LA 5TDWA 5TABA 5LKTA 3MHSA 3U5NA 2KWNA 2VNFA 4WA6A 1WGMA 3SHBA 4N4FA 3DQVR 3HCUA 2YQLA 3MHHA 5LKZA 2MD8C 3SOXA 2M1RA 2L75A 2FUIA 3FL2A 5G0FA 1X4UA 2LQ6A 3O37A 4ZQLA 2K17A 4LADB 1G25A 2YSMA 1XWHA 5FERA 1WILA 5EYAF 2MD7B 3I2DA 4F52B 2RSDA 2LGGA 3O70A 3U5MA 1WE9A 2QJ0A 4IC3A 5AITA 4W4UA 4Q6FA 2L43A 1WEQA 4AYCA 2Y1MA 3RPGC 5LCWB 2MA5A 4R8PK 2VPDA 2VPBA 3GL6A 5B78A 2ZETC 3RPGB 5D1LB 2LDRA 5D1KB 5AIUA 3RTRB 4GNEA 5TBNA 2HYED 4FK5A 3KV6A 5FB1A 3PUQA 2ECNA 2H0DA 4NN2A 4A49A 3HCSA 2HDPA 5H1VA 1F62A 5LKUA 2L80A 2E6SA 2PUYA 2K16A 3LQJA 4V3KC 5J3XA 2MUMA 5KH7A 4B7YC 4CA1A 1MM3A 2NAAA 3HCTA 3T7LA 2AN6A 2CKLB 3KV5A 2KGIA 2M85A 2LXPC 5H1UA 4UP0A 2MA6A 2YHOA 1VYXA 2KE1A 2M6MA 2MNYA 1WESA 3ZTGA 5B79A 4FJCA 4X3GA 5LKXA 4LKAA 3IHPA 1ZBDB 2Y43A 4AP4A 2KU3A 2QIZA 3KNVA 4QF3A 4ZUXU 3ZVYA 3ZPVE 1JM7A 1Z60A 2G43A 2VP7A 1WFKA 3L1XA 3O35A 3ZPV1 3M63A 2LN0A 4L7XA 2BAYA 2D8SA 2Y1NA 4R7EA 2IDAA 4ZDTA 1WEPA 4MVTA 2L0BA 2CSYA 4S3OB 4GNDA 3N9QA 1WIMA 3EB5A 3O7AA 2K1JA 4WZ2A 3ZVZB 4LLBA 2ECIA 2YHNA 1Z2QA 2MT5A 1IYMA 1DVPA 5B77A 3L11A 2C2VS 2YW8A 2LXHC 2LGKA 1N87A 2FSAA 2KIZA 2YQMA 2ECWA 4A4CA 1BORA 3PURA 2VJFA 4YBTA 4IC2A 4LK9A 2VJEA 5H1TA 4AYCB 3T6RA 1K2FA 4AUQB 2CSZA 4I7BA 1V87A 1HYIA 4UI9B 5DINA 5TRBA
chains in the Genus database with same CATH superfamily
2F42A 2LGVA 5KH3A 3VK6A 2YYRA 3N9LA 2OXQC 4FO9A 4WZ3B 3DPLR 2MIQA 4PPEA 2JUNA 4BHWA 4OGEA 5FB0A 5FEYA 5G05B 4YC9A 2YU4A 5B8DA 2KR4A 4XI1A 2H0DB 2KWKA 2VPEA 2VPGA 2XOCA 3N9NA 3N9PA 1VD4A 3N9OA 4N3WA 1MM2A 2I50A 4BBQA 4YABA 2ECTA 3NG2A 2JMDA 4R2YA 2YVRA 3SUBA 2E6RA 2MNZA 3MDBC 5C13A 2LRIC 1WEVA 5JG6A 4I7CA 3LQIA 4AVXA 4F1PA 2QICA 2P57A 3M62A 5B76A 1X4JA 2XB1A 4S3OC 4I7DA 1E4UA 3U5PA 2JM3A 1T1HA 4V3LC 4MSXA 2DX8A 2CT2A 3M99A 3O34A 4UP5A 2KWOA 1HYJA 5G04B 1WEEA 1JM7B 2XEUA 1WEUA 3GV4A 2ECVA 3FJUB 2L5UA 4GNGA 4L58A 4CCGX 2FUUA 2F6NA 1LDJB 2EGPA 2CRRA 2UZGA 2DJAA 4B86C 4O62A 2JMJA 4GNFA 2KREA 1X4IA 4A4BA 4P5OB 3FEHA 4YATA 4YBSA 2CSVA 4FIPA 3V43A 3C5KA 3O47A 3SOUA 1JOCA 3PHDA 4QF2A 2ECGA 3ASLA 2F6JA 1WENA 2XP0A 2YUCA 4LJNA 2G45A 3EB6A 3ZNIA 3N9MA 2JRJA 3Q1DA 2PNXA 2ECJA 2EGMA 2KYUA 5SVYA 5B75A 3LQHA 2IQJA 2YREA 3KQIA 3U5OA 1VFYA 2VJFB 4GB0A 3O33A 2VJEB 1FP0A 4YBMA 2RR4A 5H9MA 5C11A 2EODA 3T9KA 2E61A 3L1ZB 2KWJA 4TKPB 3HTKC 1DCQA 1U6GB 4WZ0A 2K4DA 2LAUA 1WEOA 1RMDA 1WEMA 3O36A 2G6QA 2CKLA 4YAXA 1CHCA 5D1MB 2KGGA 4A0CD 5TDRA 3QZVA 1Z6UA 2M3HA 2YURA 3KDEC 2LV9A 3LRQA 5KH9A 2RI7A 2EA6A 4YADA 1FBVA 4PTBA 2YT5A 3C6WA 2L7PA 2LGLA 2FFWA 2D8UA 3ZYQA 4C9ZA 2YSJA 5DKAA 2KFTA 1WEWA 3SOWA 4O64A 5I3LA 2JMIA 1LDKC 2C2LA 5TDWA 5TABA 5LKTA 3MHSA 3U5NA 2KWNA 2VNFA 4WA6A 1WGMA 3SHBA 4N4FA 3JUEA 3DQVR 3HCUA 2YQLA 3MHHA 5LKZA 2MD8C 3SOXA 2M1RA 5SVIA 2L75A 2FUIA 2M13A 3FL2A 5G0FA 1X4UA 2LQ6A 3O37A 4ZQLA 2CONA 2K17A 4LADB 3LDYA 1G25A 2YSMA 1XWHA 5FERA 5K3QA 1WILA 5EYAF 2MD7B 3I2DA 4F52B 2RSDA 2LGGA 2DSMA 3O70A 3PLWA 3LJUX 3U5MA 1WE9A 2QJ0A 4IC3A 5AITA 4W4UA 4Q6FA 3LVRE 2L43A 1WEQA 4AYCA 3DDTA 2Y1MA 2XOYA 3RPGC 5LCWB 2MA5A 4R8PK 2VPDA 2VPBA 3GL6A 5B78A 2ZETC 3RPGB 5D1LB 2LDRA 2CRWA 5D1KB 4OGCA 5AIUA 3RTRB 4GNEA 2EXUA 5TBNA 2HYED 4FK5A 3KV6A 5FB1A 3PUQA 2ECNA 2H0DA 4NN2A 4A49A 3HCSA 2HDPA 5H1VA 1F62A 5LKUA 2L80A 2E6SA 2PUYA 2K16A 3LQJA 4V3KC 5J3XA 3DWDA 5SVXA 2MUMA 5KH7A 4B7YC 3H7HA 4CA1A 1MM3A 4H9DA 2NAAA 4Z0OA 3HCTA 2AN6A 2CKLB 3KV5A 3T7LA 2KGIA 2M85A 2LXPC 5H1UA 4UP0A 2MA6A 3LVQE 2YHOA 1VYXA 2KE1A 2M6MA 3M7KA 2MNYA 1WESA 3ZTGA 5B79A 4FJCA 4X3GA 5LKXA 4LKAA 3IHPA 1ZBDB 2Y43A 4AP4A 2KU3A 2QIZA 3KNVA 4QF3A 4ZUXU 3FAOA 3ZVYA 4Z0RA 3ZPVE 1JM7A 1Z60A 2G43A 2VP7A 1WFKA 3L1XA 3O35A 3ZPV1 3M63A 2LN0A 2MKEA 3E2DA 4L7XA 2BAYA 2D8SA 2Y1NA 4R7EA 2IDAA 2KKXA 4ZDTA 1WEPA 4MVTA 2L0BA 2CSYA 4S3OB 4GNDA 5SVIB 3N9QA 1WIMA 3EB5A 3O7AA 2K1JA 4WZ2A 3ZVZB 4LLBA 2ECIA 2YHNA 1Z2QA 2MT5A 1IYMA 1DVPA 3FANA 5B77A 4QQ4A 3L11A 2C2VS 2YW8A 2XOZA 2LXHC 2LGKA 1N87A 2FSAA 2KIZA 2B0OE 2YQMA 2ECWA 3FM8C 2OWAA 4A4CA 1BORA 3PURA 2VJFA 4YBTA 4IC2A 4LK9A 2VJEA 5H1TA 4AYCB 3T6RA 1K2FA 4AUQB 2CSZA 1MBMA 4I7BA 1V87A 2KKYA 1HYIA 4UI9B 2FD4A 5DINA 5TRBA
chains in the Genus database with same CATH topology
2F42A 2LGVA 5KH3A 3VK6A 2YYRA 3N9LA 2OXQC 4FO9A 4WZ3B 3DPLR 2MIQA 4PPEA 4BHWA 5FB0A 5FEYA 5G05B 4YC9A 2YU4A 5B8DA 2KR4A 4XI1A 2H0DB 2KWKA 2VPEA 2VPGA 3N9NA 3N9PA 1VD4A 3N9OA 4N3WA 1MM2A 2I50A 4BBQA 4YABA 2ECTA 3NG2A 2JMDA 4R2YA 2E6RA 2MNZA 5C13A 2LRIC 1WEVA 5JG6A 4I7CA 3LQIA 4AVXA 2QICA 3M62A 5B76A 1X4JA 2XB1A 4S3OC 4I7DA 1E4UA 3U5PA 1T1HA 4V3LC 4MSXA 2DX8A 2CT2A 3M99A 3O34A 4UP5A 2KWOA 1HYJA 5G04B 1WEEA 1JM7B 2XEUA 1WEUA 3GV4A 2ECVA 2L5UA 4GNGA 4L58A 4CCGX 2FUUA 2F6NA 1LDJB 2EGPA 2UZGA 4B86C 2JMJA 4GNFA 2KREA 1X4IA 4A4BA 4P5OB 4YATA 4YBSA 4FIPA 3V43A 3C5KA 3SOUA 1JOCA 3PHDA 4QF2A 2ECGA 3ASLA 2F6JA 1WENA 2YUCA 4LJNA 2G45A 3EB6A 3ZNIA 3N9MA 2JRJA 2PNXA 2ECJA 2KYUA 5B75A 3LQHA 2YREA 3KQIA 3U5OA 1VFYA 2VJFB 4GB0A 3O33A 2VJEB 1FP0A 4YBMA 5H9MA 5C11A 2EODA 3L1ZB 2KWJA 4TKPB 3HTKC 4WZ0A 1U6GB 2K4DA 1WEOA 1RMDA 1WEMA 3O36A 2G6QA 2CKLA 4YAXA 1CHCA 5D1MB 2KGGA 4A0CD 5TDRA 3QZVA 1Z6UA 2M3HA 2YURA 2LV9A 3LRQA 5KH9A 2RI7A 2EA6A 4YADA 1FBVA 4PTBA 2YT5A 3C6WA 2LGLA 4C9ZA 3ZYQA 2YSJA 5DKAA 2KFTA 1WEWA 3SOWA 4O64A 5I3LA 2JMIA 1LDKC 2C2LA 5TDWA 5TABA 5LKTA 3MHSA 3U5NA 2KWNA 2VNFA 4WA6A 1WGMA 3SHBA 4N4FA 3DQVR 3HCUA 2YQLA 3MHHA 5LKZA 2MD8C 3SOXA 2M1RA 2L75A 2FUIA 3FL2A 5G0FA 1X4UA 2LQ6A 3O37A 4ZQLA 2K17A 4LADB 1G25A 2YSMA 1XWHA 5FERA 1WILA 5EYAF 2MD7B 3I2DA 4F52B 2RSDA 2LGGA 3O70A 3U5MA 1WE9A 2QJ0A 4IC3A 5AITA 4W4UA 4Q6FA 2L43A 1WEQA 4AYCA 2Y1MA 3RPGC 5LCWB 2MA5A 4R8PK 2VPDA 2VPBA 3GL6A 5B78A 2ZETC 3RPGB 5D1LB 2LDRA 5D1KB 5AIUA 3RTRB 4GNEA 5TBNA 2HYED 4FK5A 3KV6A 5FB1A 3PUQA 2ECNA 2H0DA 4NN2A 4A49A 3HCSA 2HDPA 5H1VA 1F62A 5LKUA 2L80A 2E6SA 2PUYA 2K16A 3LQJA 4V3KC 5J3XA 2MUMA 5KH7A 4B7YC 4CA1A 1MM3A 2NAAA 3HCTA 3T7LA 2AN6A 2CKLB 3KV5A 2KGIA 2M85A 2LXPC 5H1UA 4UP0A 2MA6A 2YHOA 1VYXA 2KE1A 2M6MA 2MNYA 1WESA 3ZTGA 5B79A 4FJCA 4X3GA 5LKXA 4LKAA 3IHPA 1ZBDB 2Y43A 4AP4A 2KU3A 2QIZA 3KNVA 4QF3A 4ZUXU 3ZVYA 3ZPVE 1JM7A 1Z60A 2G43A 2VP7A 1WFKA 3L1XA 3O35A 3ZPV1 3M63A 2LN0A 4L7XA 2BAYA 2D8SA 2Y1NA 4R7EA 2IDAA 4ZDTA 1WEPA 4MVTA 2L0BA 2CSYA 4S3OB 4GNDA 3N9QA 1WIMA 3EB5A 3O7AA 2K1JA 4WZ2A 3ZVZB 4LLBA 2ECIA 2YHNA 1Z2QA 2MT5A 1IYMA 1DVPA 5B77A 3L11A 2C2VS 2YW8A 2LXHC 2LGKA 1N87A 2FSAA 2KIZA 2YQMA 2ECWA 4A4CA 1BORA 3PURA 2VJFA 4YBTA 4IC2A 4LK9A 2VJEA 5H1TA 4AYCB 3T6RA 1K2FA 4AUQB 2CSZA 4I7BA 1V87A 1HYIA 4UI9B 5DINA 5TRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F42 A;  2LGV A;  5KH3 A;  3VK6 A;  2YYR A;  3N9L A;  2OXQ C;  4FO9 A;  4WZ3 B;  3DPL R;  2MIQ A;  4PPE A;  4BHW A;  5FB0 A;  5FEY A;  5G05 B;  4YC9 A;  2YU4 A;  5B8D A;  2KR4 A;  4XI1 A;  2H0D B;  2KWK A;  2VPE A;  2VPG A;  3N9N A;  3N9P A;  1VD4 A;  3N9O A;  4N3W A;  1MM2 A;  2I50 A;  4BBQ A;  4YAB A;  2ECT A;  3NG2 A;  2JMD A;  4R2Y A;  2E6R A;  2MNZ A;  5C13 A;  2LRI C;  1WEV A;  5JG6 A;  4I7C A;  3LQI A;  4AVX A;  2QIC A;  3M62 A;  5B76 A;  1X4J A;  2XB1 A;  4S3O C;  4I7D A;  1E4U A;  3U5P A;  1T1H A;  4V3L C;  4MSX A;  2DX8 A;  2CT2 A;  3M99 A;  3O34 A;  4UP5 A;  2KWO A;  1HYJ A;  5G04 B;  1WEE A;  1JM7 B;  2XEU A;  1WEU A;  3GV4 A;  2ECV A;  2L5U A;  4GNG A;  4L58 A;  4CCG X;  2FUU A;  2F6N A;  1LDJ B;  2EGP A;  2UZG A;  4B86 C;  2JMJ A;  4GNF A;  2KRE A;  1X4I A;  4A4B A;  4P5O B;  4YAT A;  4YBS A;  4FIP A;  3V43 A;  3C5K A;  3SOU A;  1JOC A;  3PHD A;  4QF2 A;  2ECG A;  3ASL A;  2F6J A;  1WEN A;  2YUC A;  4LJN A;  2G45 A;  3EB6 A;  3ZNI A;  3N9M A;  2JRJ A;  2PNX A;  2ECJ A;  2KYU A;  5B75 A;  3LQH A;  2YRE A;  3KQI A;  3U5O A;  1VFY A;  2VJF B;  4GB0 A;  3O33 A;  2VJE B;  1FP0 A;  4YBM A;  5H9M A;  5C11 A;  2EOD A;  3L1Z B;  2KWJ A;  4TKP B;  3HTK C;  4WZ0 A;  1U6G B;  2K4D A;  1WEO A;  1RMD A;  1WEM A;  3O36 A;  2G6Q A;  2CKL A;  4YAX A;  1CHC A;  5D1M B;  2KGG A;  4A0C D;  5TDR A;  3QZV A;  1Z6U A;  2M3H A;  2YUR A;  2LV9 A;  3LRQ A;  5KH9 A;  2RI7 A;  2EA6 A;  4YAD A;  1FBV A;  4PTB A;  2YT5 A;  3C6W A;  2LGL A;  4C9Z A;  3ZYQ A;  2YSJ A;  5DKA A;  2KFT A;  1WEW A;  3SOW A;  4O64 A;  5I3L A;  2JMI A;  1LDK C;  2C2L A;  5TDW A;  5TAB A;  5LKT A;  3MHS A;  3U5N A;  2KWN A;  2VNF A;  4WA6 A;  1WGM A;  3SHB A;  4N4F A;  3DQV R;  3HCU A;  2YQL A;  3MHH A;  5LKZ A;  2MD8 C;  3SOX A;  2M1R A;  2L75 A;  2FUI A;  3FL2 A;  5G0F A;  1X4U A;  2LQ6 A;  3O37 A;  4ZQL A;  2K17 A;  4LAD B;  1G25 A;  2YSM A;  1XWH A;  5FER A;  1WIL A;  5EYA F;  2MD7 B;  3I2D A;  4F52 B;  2RSD A;  2LGG A;  3O70 A;  3U5M A;  1WE9 A;  2QJ0 A;  4IC3 A;  5AIT A;  4W4U A;  4Q6F A;  2L43 A;  1WEQ A;  4AYC A;  2Y1M A;  3RPG C;  5LCW B;  2MA5 A;  4R8P K;  2VPD A;  2VPB A;  3GL6 A;  5B78 A;  2ZET C;  3RPG B;  5D1L B;  2LDR A;  5D1K B;  5AIU A;  3RTR B;  4GNE A;  5TBN A;  2HYE D;  4FK5 A;  3KV6 A;  5FB1 A;  3PUQ A;  2ECN A;  2H0D A;  4NN2 A;  4A49 A;  3HCS A;  2HDP A;  5H1V A;  1F62 A;  5LKU A;  2L80 A;  2E6S A;  2PUY A;  2K16 A;  3LQJ A;  4V3K C;  5J3X A;  2MUM A;  5KH7 A;  4B7Y C;  4CA1 A;  1MM3 A;  2NAA A;  3HCT A;  3T7L A;  2AN6 A;  2CKL B;  3KV5 A;  2KGI A;  2M85 A;  2LXP C;  5H1U A;  4UP0 A;  2MA6 A;  2YHO A;  1VYX A;  2KE1 A;  2M6M A;  2MNY A;  1WES A;  3ZTG A;  5B79 A;  4FJC A;  4X3G A;  5LKX A;  4LKA A;  3IHP A;  1ZBD B;  2Y43 A;  4AP4 A;  2KU3 A;  2QIZ A;  3KNV A;  4QF3 A;  4ZUX U;  3ZVY A;  3ZPV E;  1JM7 A;  1Z60 A;  2G43 A;  2VP7 A;  1WFK A;  3L1X A;  3O35 A;  3ZPV 1;  3M63 A;  2LN0 A;  4L7X A;  2BAY A;  2D8S A;  2Y1N A;  4R7E A;  2IDA A;  4ZDT A;  1WEP A;  4MVT A;  2L0B A;  2CSY A;  4S3O B;  4GND A;  3N9Q A;  1WIM A;  3EB5 A;  3O7A A;  2K1J A;  4WZ2 A;  3ZVZ B;  4LLB A;  2ECI A;  2YHN A;  1Z2Q A;  2MT5 A;  1IYM A;  1DVP A;  5B77 A;  3L11 A;  2C2V S;  2YW8 A;  2LXH C;  2LGK A;  1N87 A;  2FSA A;  2KIZ A;  2YQM A;  2ECW A;  4A4C A;  1BOR A;  3PUR A;  2VJF A;  4YBT A;  4IC2 A;  4LK9 A;  2VJE A;  5H1T A;  4AYC B;  3T6R A;  1K2F A;  4AUQ B;  2CSZ A;  4I7B A;  1V87 A;  1HYI A;  4UI9 B;  5DIN A;  5TRB A; 
#chains in the Genus database with same CATH topology
 2F42 A;  2LGV A;  5KH3 A;  3VK6 A;  2YYR A;  3N9L A;  2OXQ C;  4FO9 A;  4WZ3 B;  3DPL R;  2MIQ A;  4PPE A;  2JUN A;  4BHW A;  4OGE A;  5FB0 A;  5FEY A;  5G05 B;  4YC9 A;  2YU4 A;  5B8D A;  2KR4 A;  4XI1 A;  2H0D B;  2KWK A;  2VPE A;  2VPG A;  2XOC A;  3N9N A;  3N9P A;  1VD4 A;  3N9O A;  4N3W A;  1MM2 A;  2I50 A;  4BBQ A;  4YAB A;  2ECT A;  3NG2 A;  2JMD A;  4R2Y A;  2YVR A;  3SUB A;  2E6R A;  2MNZ A;  3MDB C;  5C13 A;  2LRI C;  1WEV A;  5JG6 A;  4I7C A;  3LQI A;  4AVX A;  4F1P A;  2QIC A;  2P57 A;  3M62 A;  5B76 A;  1X4J A;  2XB1 A;  4S3O C;  4I7D A;  1E4U A;  3U5P A;  2JM3 A;  1T1H A;  4V3L C;  4MSX A;  2DX8 A;  2CT2 A;  3M99 A;  3O34 A;  4UP5 A;  2KWO A;  1HYJ A;  5G04 B;  1WEE A;  1JM7 B;  2XEU A;  1WEU A;  3GV4 A;  2ECV A;  3FJU B;  2L5U A;  4GNG A;  4L58 A;  4CCG X;  2FUU A;  2F6N A;  1LDJ B;  2EGP A;  2CRR A;  2UZG A;  2DJA A;  4B86 C;  4O62 A;  2JMJ A;  4GNF A;  2KRE A;  1X4I A;  4A4B A;  4P5O B;  3FEH A;  4YAT A;  4YBS A;  2CSV A;  4FIP A;  3V43 A;  3C5K A;  3O47 A;  3SOU A;  1JOC A;  3PHD A;  4QF2 A;  2ECG A;  3ASL A;  2F6J A;  1WEN A;  2XP0 A;  2YUC A;  4LJN A;  2G45 A;  3EB6 A;  3ZNI A;  3N9M A;  2JRJ A;  3Q1D A;  2PNX A;  2ECJ A;  2EGM A;  2KYU A;  5SVY A;  5B75 A;  3LQH A;  2IQJ A;  2YRE A;  3KQI A;  3U5O A;  1VFY A;  2VJF B;  4GB0 A;  3O33 A;  2VJE B;  1FP0 A;  4YBM A;  2RR4 A;  5H9M A;  5C11 A;  2EOD A;  3T9K A;  2E61 A;  3L1Z B;  2KWJ A;  4TKP B;  3HTK C;  1DCQ A;  1U6G B;  4WZ0 A;  2K4D A;  2LAU A;  1WEO A;  1RMD A;  1WEM A;  3O36 A;  2G6Q A;  2CKL A;  4YAX A;  1CHC A;  5D1M B;  2KGG A;  4A0C D;  5TDR A;  3QZV A;  1Z6U A;  2M3H A;  2YUR A;  3KDE C;  2LV9 A;  3LRQ A;  5KH9 A;  2RI7 A;  2EA6 A;  4YAD A;  1FBV A;  4PTB A;  2YT5 A;  3C6W A;  2L7P A;  2LGL A;  2FFW A;  2D8U A;  3ZYQ A;  4C9Z A;  2YSJ A;  5DKA A;  2KFT A;  1WEW A;  3SOW A;  4O64 A;  5I3L A;  2JMI A;  1LDK C;  2C2L A;  5TDW A;  5TAB A;  5LKT A;  3MHS A;  3U5N A;  2KWN A;  2VNF A;  4WA6 A;  1WGM A;  3SHB A;  4N4F A;  3JUE A;  3DQV R;  3HCU A;  2YQL A;  3MHH A;  5LKZ A;  2MD8 C;  3SOX A;  2M1R A;  5SVI A;  2L75 A;  2FUI A;  2M13 A;  3FL2 A;  5G0F A;  1X4U A;  2LQ6 A;  3O37 A;  4ZQL A;  2CON A;  2K17 A;  4LAD B;  3LDY A;  1G25 A;  2YSM A;  1XWH A;  5FER A;  5K3Q A;  1WIL A;  5EYA F;  2MD7 B;  3I2D A;  4F52 B;  2RSD A;  2LGG A;  2DSM A;  3O70 A;  3PLW A;  3LJU X;  3U5M A;  1WE9 A;  2QJ0 A;  4IC3 A;  5AIT A;  4W4U A;  4Q6F A;  3LVR E;  2L43 A;  1WEQ A;  4AYC A;  3DDT A;  2Y1M A;  2XOY A;  3RPG C;  5LCW B;  2MA5 A;  4R8P K;  2VPD A;  2VPB A;  3GL6 A;  5B78 A;  2ZET C;  3RPG B;  5D1L B;  2LDR A;  2CRW A;  5D1K B;  4OGC A;  5AIU A;  3RTR B;  4GNE A;  2EXU A;  5TBN A;  2HYE D;  4FK5 A;  3KV6 A;  5FB1 A;  3PUQ A;  2ECN A;  2H0D A;  4NN2 A;  4A49 A;  3HCS A;  2HDP A;  5H1V A;  1F62 A;  5LKU A;  2L80 A;  2E6S A;  2PUY A;  2K16 A;  3LQJ A;  4V3K C;  5J3X A;  3DWD A;  5SVX A;  2MUM A;  5KH7 A;  4B7Y C;  3H7H A;  4CA1 A;  1MM3 A;  4H9D A;  2NAA A;  4Z0O A;  3HCT A;  2AN6 A;  2CKL B;  3KV5 A;  3T7L A;  2KGI A;  2M85 A;  2LXP C;  5H1U A;  4UP0 A;  2MA6 A;  3LVQ E;  2YHO A;  1VYX A;  2KE1 A;  2M6M A;  3M7K A;  2MNY A;  1WES A;  3ZTG A;  5B79 A;  4FJC A;  4X3G A;  5LKX A;  4LKA A;  3IHP A;  1ZBD B;  2Y43 A;  4AP4 A;  2KU3 A;  2QIZ A;  3KNV A;  4QF3 A;  4ZUX U;  3FAO A;  3ZVY A;  4Z0R A;  3ZPV E;  1JM7 A;  1Z60 A;  2G43 A;  2VP7 A;  1WFK A;  3L1X A;  3O35 A;  3ZPV 1;  3M63 A;  2LN0 A;  2MKE A;  3E2D A;  4L7X A;  2BAY A;  2D8S A;  2Y1N A;  4R7E A;  2IDA A;  2KKX A;  4ZDT A;  1WEP A;  4MVT A;  2L0B A;  2CSY A;  4S3O B;  4GND A;  5SVI B;  3N9Q A;  1WIM A;  3EB5 A;  3O7A A;  2K1J A;  4WZ2 A;  3ZVZ B;  4LLB A;  2ECI A;  2YHN A;  1Z2Q A;  2MT5 A;  1IYM A;  1DVP A;  3FAN A;  5B77 A;  4QQ4 A;  3L11 A;  2C2V S;  2YW8 A;  2XOZ A;  2LXH C;  2LGK A;  1N87 A;  2FSA A;  2KIZ A;  2B0O E;  2YQM A;  2ECW A;  3FM8 C;  2OWA A;  4A4C A;  1BOR A;  3PUR A;  2VJF A;  4YBT A;  4IC2 A;  4LK9 A;  2VJE A;  5H1T A;  4AYC B;  3T6R A;  1K2F A;  4AUQ B;  2CSZ A;  1MBM A;  4I7B A;  1V87 A;  2KKY A;  1HYI A;  4UI9 B;  2FD4 A;  5DIN A;  5TRB A; 
#chains in the Genus database with same CATH homology
 2F42 A;  2LGV A;  5KH3 A;  3VK6 A;  2YYR A;  3N9L A;  2OXQ C;  4FO9 A;  4WZ3 B;  3DPL R;  2MIQ A;  4PPE A;  4BHW A;  5FB0 A;  5FEY A;  5G05 B;  4YC9 A;  2YU4 A;  5B8D A;  2KR4 A;  4XI1 A;  2H0D B;  2KWK A;  2VPE A;  2VPG A;  3N9N A;  3N9P A;  1VD4 A;  3N9O A;  4N3W A;  1MM2 A;  2I50 A;  4BBQ A;  4YAB A;  2ECT A;  3NG2 A;  2JMD A;  4R2Y A;  2E6R A;  2MNZ A;  5C13 A;  2LRI C;  1WEV A;  5JG6 A;  4I7C A;  3LQI A;  4AVX A;  2QIC A;  3M62 A;  5B76 A;  1X4J A;  2XB1 A;  4S3O C;  4I7D A;  1E4U A;  3U5P A;  1T1H A;  4V3L C;  4MSX A;  2DX8 A;  2CT2 A;  3M99 A;  3O34 A;  4UP5 A;  2KWO A;  1HYJ A;  5G04 B;  1WEE A;  1JM7 B;  2XEU A;  1WEU A;  3GV4 A;  2ECV A;  2L5U A;  4GNG A;  4L58 A;  4CCG X;  2FUU A;  2F6N A;  1LDJ B;  2EGP A;  2UZG A;  4B86 C;  2JMJ A;  4GNF A;  2KRE A;  1X4I A;  4A4B A;  4P5O B;  4YAT A;  4YBS A;  4FIP A;  3V43 A;  3C5K A;  3SOU A;  1JOC A;  3PHD A;  4QF2 A;  2ECG A;  3ASL A;  2F6J A;  1WEN A;  2YUC A;  4LJN A;  2G45 A;  3EB6 A;  3ZNI A;  3N9M A;  2JRJ A;  2PNX A;  2ECJ A;  2KYU A;  5B75 A;  3LQH A;  2YRE A;  3KQI A;  3U5O A;  1VFY A;  2VJF B;  4GB0 A;  3O33 A;  2VJE B;  1FP0 A;  4YBM A;  5H9M A;  5C11 A;  2EOD A;  3L1Z B;  2KWJ A;  4TKP B;  3HTK C;  4WZ0 A;  1U6G B;  2K4D A;  1WEO A;  1RMD A;  1WEM A;  3O36 A;  2G6Q A;  2CKL A;  4YAX A;  1CHC A;  5D1M B;  2KGG A;  4A0C D;  5TDR A;  3QZV A;  1Z6U A;  2M3H A;  2YUR A;  2LV9 A;  3LRQ A;  5KH9 A;  2RI7 A;  2EA6 A;  4YAD A;  1FBV A;  4PTB A;  2YT5 A;  3C6W A;  2LGL A;  4C9Z A;  3ZYQ A;  2YSJ A;  5DKA A;  2KFT A;  1WEW A;  3SOW A;  4O64 A;  5I3L A;  2JMI A;  1LDK C;  2C2L A;  5TDW A;  5TAB A;  5LKT A;  3MHS A;  3U5N A;  2KWN A;  2VNF A;  4WA6 A;  1WGM A;  3SHB A;  4N4F A;  3DQV R;  3HCU A;  2YQL A;  3MHH A;  5LKZ A;  2MD8 C;  3SOX A;  2M1R A;  2L75 A;  2FUI A;  3FL2 A;  5G0F A;  1X4U A;  2LQ6 A;  3O37 A;  4ZQL A;  2K17 A;  4LAD B;  1G25 A;  2YSM A;  1XWH A;  5FER A;  1WIL A;  5EYA F;  2MD7 B;  3I2D A;  4F52 B;  2RSD A;  2LGG A;  3O70 A;  3U5M A;  1WE9 A;  2QJ0 A;  4IC3 A;  5AIT A;  4W4U A;  4Q6F A;  2L43 A;  1WEQ A;  4AYC A;  2Y1M A;  3RPG C;  5LCW B;  2MA5 A;  4R8P K;  2VPD A;  2VPB A;  3GL6 A;  5B78 A;  2ZET C;  3RPG B;  5D1L B;  2LDR A;  5D1K B;  5AIU A;  3RTR B;  4GNE A;  5TBN A;  2HYE D;  4FK5 A;  3KV6 A;  5FB1 A;  3PUQ A;  2ECN A;  2H0D A;  4NN2 A;  4A49 A;  3HCS A;  2HDP A;  5H1V A;  1F62 A;  5LKU A;  2L80 A;  2E6S A;  2PUY A;  2K16 A;  3LQJ A;  4V3K C;  5J3X A;  2MUM A;  5KH7 A;  4B7Y C;  4CA1 A;  1MM3 A;  2NAA A;  3HCT A;  3T7L A;  2AN6 A;  2CKL B;  3KV5 A;  2KGI A;  2M85 A;  2LXP C;  5H1U A;  4UP0 A;  2MA6 A;  2YHO A;  1VYX A;  2KE1 A;  2M6M A;  2MNY A;  1WES A;  3ZTG A;  5B79 A;  4FJC A;  4X3G A;  5LKX A;  4LKA A;  3IHP A;  1ZBD B;  2Y43 A;  4AP4 A;  2KU3 A;  2QIZ A;  3KNV A;  4QF3 A;  4ZUX U;  3ZVY A;  3ZPV E;  1JM7 A;  1Z60 A;  2G43 A;  2VP7 A;  1WFK A;  3L1X A;  3O35 A;  3ZPV 1;  3M63 A;  2LN0 A;  4L7X A;  2BAY A;  2D8S A;  2Y1N A;  4R7E A;  2IDA A;  4ZDT A;  1WEP A;  4MVT A;  2L0B A;  2CSY A;  4S3O B;  4GND A;  3N9Q A;  1WIM A;  3EB5 A;  3O7A A;  2K1J A;  4WZ2 A;  3ZVZ B;  4LLB A;  2ECI A;  2YHN A;  1Z2Q A;  2MT5 A;  1IYM A;  1DVP A;  5B77 A;  3L11 A;  2C2V S;  2YW8 A;  2LXH C;  2LGK A;  1N87 A;  2FSA A;  2KIZ A;  2YQM A;  2ECW A;  4A4C A;  1BOR A;  3PUR A;  2VJF A;  4YBT A;  4IC2 A;  4LK9 A;  2VJE A;  5H1T A;  4AYC B;  3T6R A;  1K2F A;  4AUQ B;  2CSZ A;  4I7B A;  1V87 A;  1HYI A;  4UI9 B;  5DIN A;  5TRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...