4V3LC

Rnf38-ub-ubch5b-ub complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
b'EQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
publication title Activation of a Primed Ring E3-E2-Ubiquitin Complex by Non-Covalent Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4v3lC00
4I7CA 5LKXA 4O64A 1HYIA 3O35A 4NN2A 4L58A 4CA1A 1Z6UA 3O70A 2FUIA 2KWKA 1WEVA 4UI9B 1FP0A 4V3KC 2VPDA 1WEPA 2Y1NA 4AP4A 3ZNIA 1ZBDB 2E6SA 2M6MA 2MNZA 5TBNA 3M62A 1WIMA 5DINA 2KGGA 4WA6A 2EA6A 2L43A 1JM7A 5FB1A 2KREA 2JMDA 5KH3A 3HTKC 1HYJA 3SHBA 1T1HA 4IC2A 3LQHA 2KWOA 2UZGA 5LKUA 2KWJA 1VYXA 2OXQC 5D1KB 1LDKC 2YQMA 1V87A 1WGMA 2ECIA 2L75A 2LRIC 3N9LA 4Q6FA 5H1VA 4B7YC 4B86C 2YSJA 2K1JA 2G6QA 5LKTA 4LKAA 5KH7A 1WILA 5DKAA 2MIQA 4LK9A 2YU4A 4FK5A 1WEEA 2VPGA 2YUCA 4R8PK 3O37A 4LADB 5B78A 3RPGB 5EYAF 3ZVYA 2PUYA 3LRQA 3O36A 1WEOA 5C13A 5LCWB 5KH9A 2Y1MA 4I7BA 1CHCA 2VJFB 4AYCB 5G04B 3ZPVE 5AIUA 1Z2QA 2QIZA 4C9ZA 1FBVA 2G45A 3VK6A 2ECNA 2VPBA 2Y43A 2F6NA 4V3LC 2LXHC 3LQIA 2LGVA 3HCUA 4A49A 3V43A 4MSXA 4MVTA 1WENA 5J3XA 3KNVA 1MM2A 2RSDA 4N4FA 3QZVA 5G05B 2VJEB 4UP0A 1Z60A 1F62A 4ZUXU 3U5NA 4GNDA 5TDRA 2MD8C 2H0DB 3ZYQA 2KE1A 3PHDA 4L7XA 4FIPA 2JMIA 3ZPV1 3ASLA 2YYRA 3C6WA 2VJFA 4AYCA 2F6JA 4AVXA 4IC3A 2BAYA 3L1XA 5B75A 1BORA 2ECVA 3SOXA 2VP7A 2YSMA 4A0CD 3LQJA 1WEWA 4YBMA 2E6RA 2IDAA 2MA5A 2CT2A 5FEYA 3U5OA 4YATA 2NAAA 4LLBA 5TABA 3EB5A 2VJEA 1X4IA 4UP5A 2MD7B 2AN6A 4BHWA 2KWNA 3O34A 1N87A 3M99A 4YADA 2L5UA 3C5KA 2M3HA 3GL6A 3HCSA 3ZVZB 2KFTA 2F42A 4AUQB 1WEQA 4P5OB 4ZQLA 2VNFA 1IYMA 2ECWA 2LDRA 2L80A 3MHSA 1X4JA 2HYED 2KR4A 3SOUA 5FB0A 3GV4A 1JOCA 5H9MA 4YC9A 5H1UA 1WEMA 2C2VS 4YAXA 2KIZA 4WZ0A 4PPEA 4PTBA 5B77A 1G25A 3O33A 1WE9A 3T6RA 1LDJB 2JMJA 4YBTA 4S3OB 2I50A 3T7LA 2K16A 2PNXA 2KGIA 2RI7A 5JG6A 5LKZA 5D1MB 4BBQA 4YABA 5G0FA 3RPGC 2XEUA 2MT5A 3N9OA 3NG2A 4YBSA 1VD4A 2M1RA 2XB1A 2QICA 4R7EA 5H1TA 2KYUA 2JRJA 4GB0A 4ZDTA 3M63A 2FUUA 2LXPC 4QF2A 2LN0A 4CCGX 4GNEA 4A4BA 4GNGA 2VPEA 2ZETC 2CKLB 4F52B 3DQVR 2MUMA 2QJ0A 2K4DA 4S3OC 3RTRB 2EODA 2ECJA 2HDPA 1WEUA 2LGGA 4N3WA 2LGLA 3DPLR 5FERA 2MA6A 3FL2A 2CSYA 5B76A 4XI1A 3U5PA 2LQ6A 3ZTGA 1K2FA 1MM3A 2H0DA 2K17A 5B8DA 1U6GB 1X4UA 2CSZA 1WESA 3L1ZB 1WFKA 2EGPA 4GNFA 4WZ2A 5B79A 4TKPB 2YW8A 4WZ3B 3N9QA 1DVPA 4R2YA 3EB6A 2FSAA 3N9MA 2G43A 4LJNA 3IHPA 4QF3A 2DX8A 3U5MA 3SOWA 2YT5A 2CKLA 4FJCA 4FO9A 3KQIA 2YURA 2M85A 3I2DA 5AITA 3N9NA 2LV9A 4I7DA 3KV5A 4W4UA 2LGKA 5TRBA 2D8SA 3L11A 5I3LA 4X3GA 3KV6A 5C11A 3MHHA 1JM7B 2MNYA 2YQLA 1VFYA 3PURA 3N9PA 2ECTA 2YHNA 3PUQA 2YHOA 2C2LA 2YREA 1E4UA 2L0BA 5D1LB 4A4CA 3HCTA 2ECGA 3O7AA 1RMDA 2KU3A 5TDWA 1XWHA
chains in the Genus database with same CATH superfamily
4I7CA 3LVRE 5LKXA 4O64A 1HYIA 5SVIA 3O35A 4NN2A 4L58A 4CA1A 1Z6UA 3O70A 2FUIA 2KWKA 1WEVA 4UI9B 1FP0A 4V3KC 2VPDA 1WEPA 2Y1NA 4AP4A 3ZNIA 1ZBDB 2E6SA 2M6MA 2MNZA 5TBNA 3M62A 1WIMA 5DINA 2KGGA 4OGCA 4WA6A 2EA6A 3PLWA 2L43A 1JM7A 4QQ4A 3LVQE 5FB1A 2KREA 2JMDA 5KH3A 3HTKC 1HYJA 3SHBA 1T1HA 4IC2A 3LQHA 2KWOA 2UZGA 5LKUA 2KWJA 1VYXA 2OXQC 5D1KB 1LDKC 2YQMA 1V87A 1WGMA 2ECIA 2L75A 2LRIC 3N9LA 2OWAA 4Q6FA 3E2DA 5H1VA 4B7YC 4B86C 2YSJA 2K1JA 2G6QA 5LKTA 4LKAA 5KH7A 1WILA 2B0OE 5DKAA 2MIQA 4LK9A 2YU4A 4FK5A 1WEEA 2VPGA 2YUCA 4R8PK 3O37A 4LADB 2D8UA 5B78A 3RPGB 5EYAF 3ZVYA 2PUYA 3LRQA 4H9DA 3O36A 2EXUA 1WEOA 5C13A 5LCWB 5KH9A 2Y1MA 4I7BA 3KDEC 1CHCA 2VJFB 2CSVA 4AYCB 2M13A 5G04B 3ZPVE 5AIUA 2LAUA 1Z2QA 2QIZA 4C9ZA 1FBVA 2G45A 3VK6A 2ECNA 2VPBA 2Y43A 2F6NA 4V3LC 2LXHC 3M7KA 4OGEA 3LQIA 2LGVA 3HCUA 4A49A 3V43A 4MSXA 4MVTA 1WENA 2L7PA 5J3XA 3FAOA 3KNVA 1MM2A 2RSDA 4N4FA 3QZVA 5G05B 2VJEB 4UP0A 1Z60A 2KKYA 1F62A 4ZUXU 3U5NA 3DDTA 4GNDA 5TDRA 2MD8C 2H0DB 3ZYQA 3LJUX 2KE1A 3PHDA 3LDYA 4L7XA 3FM8C 4FIPA 2JMIA 3ZPV1 3ASLA 2P57A 2YYRA 3C6WA 2VJFA 4AYCA 2F6JA 4AVXA 4IC3A 2IQJA 2BAYA 3L1XA 5B75A 1BORA 2ECVA 3SOXA 2VP7A 2YSMA 4A0CD 3LQJA 1WEWA 4YBMA 3FANA 2E6RA 2IDAA 2MA5A 2CT2A 5FEYA 3U5OA 4YATA 2NAAA 2XOCA 4LLBA 5TABA 3EB5A 2VJEA 3SUBA 1X4IA 4UP5A 2MD7B 2AN6A 4BHWA 4Z0OA 2KWNA 3O34A 1N87A 2DSMA 3M99A 4YADA 2L5UA 3C5KA 2CONA 2M3HA 3GL6A 2JM3A 3HCSA 3ZVZB 2CRWA 3T9KA 2KFTA 4O62A 2F42A 4AUQB 1WEQA 4P5OB 4ZQLA 2VNFA 1IYMA 2ECWA 2LDRA 2L80A 3MHSA 1X4JA 2HYED 2KR4A 3SOUA 2KKXA 5FB0A 3GV4A 2RR4A 1JOCA 5H9MA 4YC9A 5H1UA 1WEMA 2C2VS 2KIZA 4YAXA 4WZ0A 4PPEA 4PTBA 5B77A 1G25A 3O33A 1WE9A 3T6RA 1LDJB 2JMJA 4YBTA 3DWDA 2JUNA 3FEHA 4S3OB 2I50A 3T7LA 2K16A 2PNXA 2KGIA 2RI7A 5JG6A 5LKZA 5D1MB 4BBQA 4YABA 5G0FA 3RPGC 2XEUA 2MT5A 3N9OA 3NG2A 4YBSA 1VD4A 2M1RA 2XB1A 2QICA 4R7EA 5H1TA 2XOYA 2KYUA 2JRJA 4GB0A 4ZDTA 3M63A 2FUUA 2LXPC 4QF2A 2LN0A 4CCGX 4GNEA 4A4BA 2E61A 4GNGA 5SVXA 2VPEA 2ZETC 2XP0A 2CKLB 4F52B 3DQVR 2MUMA 2CRRA 2K4DA 2QJ0A 4S3OC 3RTRB 2EODA 2ECJA 2HDPA 1WEUA 3O47A 2LGGA 4N3WA 2LGLA 3DPLR 5FERA 2MA6A 3FL2A 2CSYA 5B76A 4XI1A 3U5PA 2LQ6A 3ZTGA 1K2FA 5SVYA 1MM3A 2H0DA 2K17A 5B8DA 1U6GB 1X4UA 2CSZA 1WESA 3L1ZB 1WFKA 2EGPA 4GNFA 4WZ2A 5B79A 1DCQA 4TKPB 2YW8A 4WZ3B 3N9QA 3H7HA 1DVPA 4R2YA 3EB6A 2FSAA 3N9MA 2G43A 4LJNA 3IHPA 4QF3A 5SVIB 2DX8A 3U5MA 3SOWA 2EGMA 2FFWA 2YT5A 2CKLA 4FJCA 4FO9A 3KQIA 2YURA 2M85A 3I2DA 5AITA 3Q1DA 2DJAA 3N9NA 2LV9A 4I7DA 3KV5A 2XOZA 4W4UA 2LGKA 3FJUB 5TRBA 2D8SA 3JUEA 2FD4A 3L11A 5I3LA 4X3GA 3KV6A 5C11A 3MHHA 1JM7B 2MNYA 1MBMA 2YQLA 1VFYA 3MDBC 3PURA 3N9PA 4F1PA 4Z0RA 2ECTA 2YHNA 2MKEA 3PUQA 5K3QA 2YHOA 2C2LA 2YREA 1E4UA 2L0BA 5D1LB 4A4CA 3HCTA 2ECGA 3O7AA 1RMDA 2KU3A 2YVRA 5TDWA 1XWHA
chains in the Genus database with same CATH topology
4I7CA 5LKXA 4O64A 1HYIA 3O35A 4NN2A 4L58A 4CA1A 1Z6UA 3O70A 2FUIA 2KWKA 1WEVA 4UI9B 1FP0A 4V3KC 2VPDA 1WEPA 2Y1NA 4AP4A 3ZNIA 1ZBDB 2E6SA 2M6MA 2MNZA 5TBNA 3M62A 1WIMA 5DINA 2KGGA 4WA6A 2EA6A 2L43A 1JM7A 5FB1A 2KREA 2JMDA 5KH3A 3HTKC 1HYJA 3SHBA 1T1HA 4IC2A 3LQHA 2KWOA 2UZGA 5LKUA 2KWJA 1VYXA 2OXQC 5D1KB 1LDKC 2YQMA 1V87A 1WGMA 2ECIA 2L75A 2LRIC 3N9LA 4Q6FA 5H1VA 4B7YC 4B86C 2YSJA 2K1JA 2G6QA 5LKTA 4LKAA 5KH7A 1WILA 5DKAA 2MIQA 4LK9A 2YU4A 4FK5A 1WEEA 2VPGA 2YUCA 4R8PK 3O37A 4LADB 5B78A 3RPGB 5EYAF 3ZVYA 2PUYA 3LRQA 3O36A 1WEOA 5C13A 5LCWB 5KH9A 2Y1MA 4I7BA 1CHCA 2VJFB 4AYCB 5G04B 3ZPVE 5AIUA 1Z2QA 2QIZA 4C9ZA 1FBVA 2G45A 3VK6A 2ECNA 2VPBA 2Y43A 2F6NA 4V3LC 2LXHC 3LQIA 2LGVA 3HCUA 4A49A 3V43A 4MSXA 4MVTA 1WENA 5J3XA 3KNVA 1MM2A 2RSDA 4N4FA 3QZVA 5G05B 2VJEB 4UP0A 1Z60A 1F62A 4ZUXU 3U5NA 4GNDA 5TDRA 2MD8C 2H0DB 3ZYQA 2KE1A 3PHDA 4L7XA 4FIPA 2JMIA 3ZPV1 3ASLA 2YYRA 3C6WA 2VJFA 4AYCA 2F6JA 4AVXA 4IC3A 2BAYA 3L1XA 5B75A 1BORA 2ECVA 3SOXA 2VP7A 2YSMA 4A0CD 3LQJA 1WEWA 4YBMA 2E6RA 2IDAA 2MA5A 2CT2A 5FEYA 3U5OA 4YATA 2NAAA 4LLBA 5TABA 3EB5A 2VJEA 1X4IA 4UP5A 2MD7B 2AN6A 4BHWA 2KWNA 3O34A 1N87A 3M99A 4YADA 2L5UA 3C5KA 2M3HA 3GL6A 3HCSA 3ZVZB 2KFTA 2F42A 4AUQB 1WEQA 4P5OB 4ZQLA 2VNFA 1IYMA 2ECWA 2LDRA 2L80A 3MHSA 1X4JA 2HYED 2KR4A 3SOUA 5FB0A 3GV4A 1JOCA 5H9MA 4YC9A 5H1UA 1WEMA 2C2VS 4YAXA 2KIZA 4WZ0A 4PPEA 4PTBA 5B77A 1G25A 3O33A 1WE9A 3T6RA 1LDJB 2JMJA 4YBTA 4S3OB 2I50A 3T7LA 2K16A 2PNXA 2KGIA 2RI7A 5JG6A 5LKZA 5D1MB 4BBQA 4YABA 5G0FA 3RPGC 2XEUA 2MT5A 3N9OA 3NG2A 4YBSA 1VD4A 2M1RA 2XB1A 2QICA 4R7EA 5H1TA 2KYUA 2JRJA 4GB0A 4ZDTA 3M63A 2FUUA 2LXPC 4QF2A 2LN0A 4CCGX 4GNEA 4A4BA 4GNGA 2VPEA 2ZETC 2CKLB 4F52B 3DQVR 2MUMA 2QJ0A 2K4DA 4S3OC 3RTRB 2EODA 2ECJA 2HDPA 1WEUA 2LGGA 4N3WA 2LGLA 3DPLR 5FERA 2MA6A 3FL2A 2CSYA 5B76A 4XI1A 3U5PA 2LQ6A 3ZTGA 1K2FA 1MM3A 2H0DA 2K17A 5B8DA 1U6GB 1X4UA 2CSZA 1WESA 3L1ZB 1WFKA 2EGPA 4GNFA 4WZ2A 5B79A 4TKPB 2YW8A 4WZ3B 3N9QA 1DVPA 4R2YA 3EB6A 2FSAA 3N9MA 2G43A 4LJNA 3IHPA 4QF3A 2DX8A 3U5MA 3SOWA 2YT5A 2CKLA 4FJCA 4FO9A 3KQIA 2YURA 2M85A 3I2DA 5AITA 3N9NA 2LV9A 4I7DA 3KV5A 4W4UA 2LGKA 5TRBA 2D8SA 3L11A 5I3LA 4X3GA 3KV6A 5C11A 3MHHA 1JM7B 2MNYA 2YQLA 1VFYA 3PURA 3N9PA 2ECTA 2YHNA 3PUQA 2YHOA 2C2LA 2YREA 1E4UA 2L0BA 5D1LB 4A4CA 3HCTA 2ECGA 3O7AA 1RMDA 2KU3A 5TDWA 1XWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7C A;  5LKX A;  4O64 A;  1HYI A;  3O35 A;  4NN2 A;  4L58 A;  4CA1 A;  1Z6U A;  3O70 A;  2FUI A;  2KWK A;  1WEV A;  4UI9 B;  1FP0 A;  4V3K C;  2VPD A;  1WEP A;  2Y1N A;  4AP4 A;  3ZNI A;  1ZBD B;  2E6S A;  2M6M A;  2MNZ A;  5TBN A;  3M62 A;  1WIM A;  5DIN A;  2KGG A;  4WA6 A;  2EA6 A;  2L43 A;  1JM7 A;  5FB1 A;  2KRE A;  2JMD A;  5KH3 A;  3HTK C;  1HYJ A;  3SHB A;  1T1H A;  4IC2 A;  3LQH A;  2KWO A;  2UZG A;  5LKU A;  2KWJ A;  1VYX A;  2OXQ C;  5D1K B;  1LDK C;  2YQM A;  1V87 A;  1WGM A;  2ECI A;  2L75 A;  2LRI C;  3N9L A;  4Q6F A;  5H1V A;  4B7Y C;  4B86 C;  2YSJ A;  2K1J A;  2G6Q A;  5LKT A;  4LKA A;  5KH7 A;  1WIL A;  5DKA A;  2MIQ A;  4LK9 A;  2YU4 A;  4FK5 A;  1WEE A;  2VPG A;  2YUC A;  4R8P K;  3O37 A;  4LAD B;  5B78 A;  3RPG B;  5EYA F;  3ZVY A;  2PUY A;  3LRQ A;  3O36 A;  1WEO A;  5C13 A;  5LCW B;  5KH9 A;  2Y1M A;  4I7B A;  1CHC A;  2VJF B;  4AYC B;  5G04 B;  3ZPV E;  5AIU A;  1Z2Q A;  2QIZ A;  4C9Z A;  1FBV A;  2G45 A;  3VK6 A;  2ECN A;  2VPB A;  2Y43 A;  2F6N A;  4V3L C;  2LXH C;  3LQI A;  2LGV A;  3HCU A;  4A49 A;  3V43 A;  4MSX A;  4MVT A;  1WEN A;  5J3X A;  3KNV A;  1MM2 A;  2RSD A;  4N4F A;  3QZV A;  5G05 B;  2VJE B;  4UP0 A;  1Z60 A;  1F62 A;  4ZUX U;  3U5N A;  4GND A;  5TDR A;  2MD8 C;  2H0D B;  3ZYQ A;  2KE1 A;  3PHD A;  4L7X A;  4FIP A;  2JMI A;  3ZPV 1;  3ASL A;  2YYR A;  3C6W A;  2VJF A;  4AYC A;  2F6J A;  4AVX A;  4IC3 A;  2BAY A;  3L1X A;  5B75 A;  1BOR A;  2ECV A;  3SOX A;  2VP7 A;  2YSM A;  4A0C D;  3LQJ A;  1WEW A;  4YBM A;  2E6R A;  2IDA A;  2MA5 A;  2CT2 A;  5FEY A;  3U5O A;  4YAT A;  2NAA A;  4LLB A;  5TAB A;  3EB5 A;  2VJE A;  1X4I A;  4UP5 A;  2MD7 B;  2AN6 A;  4BHW A;  2KWN A;  3O34 A;  1N87 A;  3M99 A;  4YAD A;  2L5U A;  3C5K A;  2M3H A;  3GL6 A;  3HCS A;  3ZVZ B;  2KFT A;  2F42 A;  4AUQ B;  1WEQ A;  4P5O B;  4ZQL A;  2VNF A;  1IYM A;  2ECW A;  2LDR A;  2L80 A;  3MHS A;  1X4J A;  2HYE D;  2KR4 A;  3SOU A;  5FB0 A;  3GV4 A;  1JOC A;  5H9M A;  4YC9 A;  5H1U A;  1WEM A;  2C2V S;  4YAX A;  2KIZ A;  4WZ0 A;  4PPE A;  4PTB A;  5B77 A;  1G25 A;  3O33 A;  1WE9 A;  3T6R A;  1LDJ B;  2JMJ A;  4YBT A;  4S3O B;  2I50 A;  3T7L A;  2K16 A;  2PNX A;  2KGI A;  2RI7 A;  5JG6 A;  5LKZ A;  5D1M B;  4BBQ A;  4YAB A;  5G0F A;  3RPG C;  2XEU A;  2MT5 A;  3N9O A;  3NG2 A;  4YBS A;  1VD4 A;  2M1R A;  2XB1 A;  2QIC A;  4R7E A;  5H1T A;  2KYU A;  2JRJ A;  4GB0 A;  4ZDT A;  3M63 A;  2FUU A;  2LXP C;  4QF2 A;  2LN0 A;  4CCG X;  4GNE A;  4A4B A;  4GNG A;  2VPE A;  2ZET C;  2CKL B;  4F52 B;  3DQV R;  2MUM A;  2QJ0 A;  2K4D A;  4S3O C;  3RTR B;  2EOD A;  2ECJ A;  2HDP A;  1WEU A;  2LGG A;  4N3W A;  2LGL A;  3DPL R;  5FER A;  2MA6 A;  3FL2 A;  2CSY A;  5B76 A;  4XI1 A;  3U5P A;  2LQ6 A;  3ZTG A;  1K2F A;  1MM3 A;  2H0D A;  2K17 A;  5B8D A;  1U6G B;  1X4U A;  2CSZ A;  1WES A;  3L1Z B;  1WFK A;  2EGP A;  4GNF A;  4WZ2 A;  5B79 A;  4TKP B;  2YW8 A;  4WZ3 B;  3N9Q A;  1DVP A;  4R2Y A;  3EB6 A;  2FSA A;  3N9M A;  2G43 A;  4LJN A;  3IHP A;  4QF3 A;  2DX8 A;  3U5M A;  3SOW A;  2YT5 A;  2CKL A;  4FJC A;  4FO9 A;  3KQI A;  2YUR A;  2M85 A;  3I2D A;  5AIT A;  3N9N A;  2LV9 A;  4I7D A;  3KV5 A;  4W4U A;  2LGK A;  5TRB A;  2D8S A;  3L11 A;  5I3L A;  4X3G A;  3KV6 A;  5C11 A;  3MHH A;  1JM7 B;  2MNY A;  2YQL A;  1VFY A;  3PUR A;  3N9P A;  2ECT A;  2YHN A;  3PUQ A;  2YHO A;  2C2L A;  2YRE A;  1E4U A;  2L0B A;  5D1L B;  4A4C A;  3HCT A;  2ECG A;  3O7A A;  1RMD A;  2KU3 A;  5TDW A;  1XWH A; 
#chains in the Genus database with same CATH topology
 4I7C A;  3LVR E;  5LKX A;  4O64 A;  1HYI A;  5SVI A;  3O35 A;  4NN2 A;  4L58 A;  4CA1 A;  1Z6U A;  3O70 A;  2FUI A;  2KWK A;  1WEV A;  4UI9 B;  1FP0 A;  4V3K C;  2VPD A;  1WEP A;  2Y1N A;  4AP4 A;  3ZNI A;  1ZBD B;  2E6S A;  2M6M A;  2MNZ A;  5TBN A;  3M62 A;  1WIM A;  5DIN A;  2KGG A;  4OGC A;  4WA6 A;  2EA6 A;  3PLW A;  2L43 A;  1JM7 A;  4QQ4 A;  3LVQ E;  5FB1 A;  2KRE A;  2JMD A;  5KH3 A;  3HTK C;  1HYJ A;  3SHB A;  1T1H A;  4IC2 A;  3LQH A;  2KWO A;  2UZG A;  5LKU A;  2KWJ A;  1VYX A;  2OXQ C;  5D1K B;  1LDK C;  2YQM A;  1V87 A;  1WGM A;  2ECI A;  2L75 A;  2LRI C;  3N9L A;  2OWA A;  4Q6F A;  3E2D A;  5H1V A;  4B7Y C;  4B86 C;  2YSJ A;  2K1J A;  2G6Q A;  5LKT A;  4LKA A;  5KH7 A;  1WIL A;  2B0O E;  5DKA A;  2MIQ A;  4LK9 A;  2YU4 A;  4FK5 A;  1WEE A;  2VPG A;  2YUC A;  4R8P K;  3O37 A;  4LAD B;  2D8U A;  5B78 A;  3RPG B;  5EYA F;  3ZVY A;  2PUY A;  3LRQ A;  4H9D A;  3O36 A;  2EXU A;  1WEO A;  5C13 A;  5LCW B;  5KH9 A;  2Y1M A;  4I7B A;  3KDE C;  1CHC A;  2VJF B;  2CSV A;  4AYC B;  2M13 A;  5G04 B;  3ZPV E;  5AIU A;  2LAU A;  1Z2Q A;  2QIZ A;  4C9Z A;  1FBV A;  2G45 A;  3VK6 A;  2ECN A;  2VPB A;  2Y43 A;  2F6N A;  4V3L C;  2LXH C;  3M7K A;  4OGE A;  3LQI A;  2LGV A;  3HCU A;  4A49 A;  3V43 A;  4MSX A;  4MVT A;  1WEN A;  2L7P A;  5J3X A;  3FAO A;  3KNV A;  1MM2 A;  2RSD A;  4N4F A;  3QZV A;  5G05 B;  2VJE B;  4UP0 A;  1Z60 A;  2KKY A;  1F62 A;  4ZUX U;  3U5N A;  3DDT A;  4GND A;  5TDR A;  2MD8 C;  2H0D B;  3ZYQ A;  3LJU X;  2KE1 A;  3PHD A;  3LDY A;  4L7X A;  3FM8 C;  4FIP A;  2JMI A;  3ZPV 1;  3ASL A;  2P57 A;  2YYR A;  3C6W A;  2VJF A;  4AYC A;  2F6J A;  4AVX A;  4IC3 A;  2IQJ A;  2BAY A;  3L1X A;  5B75 A;  1BOR A;  2ECV A;  3SOX A;  2VP7 A;  2YSM A;  4A0C D;  3LQJ A;  1WEW A;  4YBM A;  3FAN A;  2E6R A;  2IDA A;  2MA5 A;  2CT2 A;  5FEY A;  3U5O A;  4YAT A;  2NAA A;  2XOC A;  4LLB A;  5TAB A;  3EB5 A;  2VJE A;  3SUB A;  1X4I A;  4UP5 A;  2MD7 B;  2AN6 A;  4BHW A;  4Z0O A;  2KWN A;  3O34 A;  1N87 A;  2DSM A;  3M99 A;  4YAD A;  2L5U A;  3C5K A;  2CON A;  2M3H A;  3GL6 A;  2JM3 A;  3HCS A;  3ZVZ B;  2CRW A;  3T9K A;  2KFT A;  4O62 A;  2F42 A;  4AUQ B;  1WEQ A;  4P5O B;  4ZQL A;  2VNF A;  1IYM A;  2ECW A;  2LDR A;  2L80 A;  3MHS A;  1X4J A;  2HYE D;  2KR4 A;  3SOU A;  2KKX A;  5FB0 A;  3GV4 A;  2RR4 A;  1JOC A;  5H9M A;  4YC9 A;  5H1U A;  1WEM A;  2C2V S;  2KIZ A;  4YAX A;  4WZ0 A;  4PPE A;  4PTB A;  5B77 A;  1G25 A;  3O33 A;  1WE9 A;  3T6R A;  1LDJ B;  2JMJ A;  4YBT A;  3DWD A;  2JUN A;  3FEH A;  4S3O B;  2I50 A;  3T7L A;  2K16 A;  2PNX A;  2KGI A;  2RI7 A;  5JG6 A;  5LKZ A;  5D1M B;  4BBQ A;  4YAB A;  5G0F A;  3RPG C;  2XEU A;  2MT5 A;  3N9O A;  3NG2 A;  4YBS A;  1VD4 A;  2M1R A;  2XB1 A;  2QIC A;  4R7E A;  5H1T A;  2XOY A;  2KYU A;  2JRJ A;  4GB0 A;  4ZDT A;  3M63 A;  2FUU A;  2LXP C;  4QF2 A;  2LN0 A;  4CCG X;  4GNE A;  4A4B A;  2E61 A;  4GNG A;  5SVX A;  2VPE A;  2ZET C;  2XP0 A;  2CKL B;  4F52 B;  3DQV R;  2MUM A;  2CRR A;  2K4D A;  2QJ0 A;  4S3O C;  3RTR B;  2EOD A;  2ECJ A;  2HDP A;  1WEU A;  3O47 A;  2LGG A;  4N3W A;  2LGL A;  3DPL R;  5FER A;  2MA6 A;  3FL2 A;  2CSY A;  5B76 A;  4XI1 A;  3U5P A;  2LQ6 A;  3ZTG A;  1K2F A;  5SVY A;  1MM3 A;  2H0D A;  2K17 A;  5B8D A;  1U6G B;  1X4U A;  2CSZ A;  1WES A;  3L1Z B;  1WFK A;  2EGP A;  4GNF A;  4WZ2 A;  5B79 A;  1DCQ A;  4TKP B;  2YW8 A;  4WZ3 B;  3N9Q A;  3H7H A;  1DVP A;  4R2Y A;  3EB6 A;  2FSA A;  3N9M A;  2G43 A;  4LJN A;  3IHP A;  4QF3 A;  5SVI B;  2DX8 A;  3U5M A;  3SOW A;  2EGM A;  2FFW A;  2YT5 A;  2CKL A;  4FJC A;  4FO9 A;  3KQI A;  2YUR A;  2M85 A;  3I2D A;  5AIT A;  3Q1D A;  2DJA A;  3N9N A;  2LV9 A;  4I7D A;  3KV5 A;  2XOZ A;  4W4U A;  2LGK A;  3FJU B;  5TRB A;  2D8S A;  3JUE A;  2FD4 A;  3L11 A;  5I3L A;  4X3G A;  3KV6 A;  5C11 A;  3MHH A;  1JM7 B;  2MNY A;  1MBM A;  2YQL A;  1VFY A;  3MDB C;  3PUR A;  3N9P A;  4F1P A;  4Z0R A;  2ECT A;  2YHN A;  2MKE A;  3PUQ A;  5K3Q A;  2YHO A;  2C2L A;  2YRE A;  1E4U A;  2L0B A;  5D1L B;  4A4C A;  3HCT A;  2ECG A;  3O7A A;  1RMD A;  2KU3 A;  2YVR A;  5TDW A;  1XWH A; 
#chains in the Genus database with same CATH homology
 4I7C A;  5LKX A;  4O64 A;  1HYI A;  3O35 A;  4NN2 A;  4L58 A;  4CA1 A;  1Z6U A;  3O70 A;  2FUI A;  2KWK A;  1WEV A;  4UI9 B;  1FP0 A;  4V3K C;  2VPD A;  1WEP A;  2Y1N A;  4AP4 A;  3ZNI A;  1ZBD B;  2E6S A;  2M6M A;  2MNZ A;  5TBN A;  3M62 A;  1WIM A;  5DIN A;  2KGG A;  4WA6 A;  2EA6 A;  2L43 A;  1JM7 A;  5FB1 A;  2KRE A;  2JMD A;  5KH3 A;  3HTK C;  1HYJ A;  3SHB A;  1T1H A;  4IC2 A;  3LQH A;  2KWO A;  2UZG A;  5LKU A;  2KWJ A;  1VYX A;  2OXQ C;  5D1K B;  1LDK C;  2YQM A;  1V87 A;  1WGM A;  2ECI A;  2L75 A;  2LRI C;  3N9L A;  4Q6F A;  5H1V A;  4B7Y C;  4B86 C;  2YSJ A;  2K1J A;  2G6Q A;  5LKT A;  4LKA A;  5KH7 A;  1WIL A;  5DKA A;  2MIQ A;  4LK9 A;  2YU4 A;  4FK5 A;  1WEE A;  2VPG A;  2YUC A;  4R8P K;  3O37 A;  4LAD B;  5B78 A;  3RPG B;  5EYA F;  3ZVY A;  2PUY A;  3LRQ A;  3O36 A;  1WEO A;  5C13 A;  5LCW B;  5KH9 A;  2Y1M A;  4I7B A;  1CHC A;  2VJF B;  4AYC B;  5G04 B;  3ZPV E;  5AIU A;  1Z2Q A;  2QIZ A;  4C9Z A;  1FBV A;  2G45 A;  3VK6 A;  2ECN A;  2VPB A;  2Y43 A;  2F6N A;  4V3L C;  2LXH C;  3LQI A;  2LGV A;  3HCU A;  4A49 A;  3V43 A;  4MSX A;  4MVT A;  1WEN A;  5J3X A;  3KNV A;  1MM2 A;  2RSD A;  4N4F A;  3QZV A;  5G05 B;  2VJE B;  4UP0 A;  1Z60 A;  1F62 A;  4ZUX U;  3U5N A;  4GND A;  5TDR A;  2MD8 C;  2H0D B;  3ZYQ A;  2KE1 A;  3PHD A;  4L7X A;  4FIP A;  2JMI A;  3ZPV 1;  3ASL A;  2YYR A;  3C6W A;  2VJF A;  4AYC A;  2F6J A;  4AVX A;  4IC3 A;  2BAY A;  3L1X A;  5B75 A;  1BOR A;  2ECV A;  3SOX A;  2VP7 A;  2YSM A;  4A0C D;  3LQJ A;  1WEW A;  4YBM A;  2E6R A;  2IDA A;  2MA5 A;  2CT2 A;  5FEY A;  3U5O A;  4YAT A;  2NAA A;  4LLB A;  5TAB A;  3EB5 A;  2VJE A;  1X4I A;  4UP5 A;  2MD7 B;  2AN6 A;  4BHW A;  2KWN A;  3O34 A;  1N87 A;  3M99 A;  4YAD A;  2L5U A;  3C5K A;  2M3H A;  3GL6 A;  3HCS A;  3ZVZ B;  2KFT A;  2F42 A;  4AUQ B;  1WEQ A;  4P5O B;  4ZQL A;  2VNF A;  1IYM A;  2ECW A;  2LDR A;  2L80 A;  3MHS A;  1X4J A;  2HYE D;  2KR4 A;  3SOU A;  5FB0 A;  3GV4 A;  1JOC A;  5H9M A;  4YC9 A;  5H1U A;  1WEM A;  2C2V S;  4YAX A;  2KIZ A;  4WZ0 A;  4PPE A;  4PTB A;  5B77 A;  1G25 A;  3O33 A;  1WE9 A;  3T6R A;  1LDJ B;  2JMJ A;  4YBT A;  4S3O B;  2I50 A;  3T7L A;  2K16 A;  2PNX A;  2KGI A;  2RI7 A;  5JG6 A;  5LKZ A;  5D1M B;  4BBQ A;  4YAB A;  5G0F A;  3RPG C;  2XEU A;  2MT5 A;  3N9O A;  3NG2 A;  4YBS A;  1VD4 A;  2M1R A;  2XB1 A;  2QIC A;  4R7E A;  5H1T A;  2KYU A;  2JRJ A;  4GB0 A;  4ZDT A;  3M63 A;  2FUU A;  2LXP C;  4QF2 A;  2LN0 A;  4CCG X;  4GNE A;  4A4B A;  4GNG A;  2VPE A;  2ZET C;  2CKL B;  4F52 B;  3DQV R;  2MUM A;  2QJ0 A;  2K4D A;  4S3O C;  3RTR B;  2EOD A;  2ECJ A;  2HDP A;  1WEU A;  2LGG A;  4N3W A;  2LGL A;  3DPL R;  5FER A;  2MA6 A;  3FL2 A;  2CSY A;  5B76 A;  4XI1 A;  3U5P A;  2LQ6 A;  3ZTG A;  1K2F A;  1MM3 A;  2H0D A;  2K17 A;  5B8D A;  1U6G B;  1X4U A;  2CSZ A;  1WES A;  3L1Z B;  1WFK A;  2EGP A;  4GNF A;  4WZ2 A;  5B79 A;  4TKP B;  2YW8 A;  4WZ3 B;  3N9Q A;  1DVP A;  4R2Y A;  3EB6 A;  2FSA A;  3N9M A;  2G43 A;  4LJN A;  3IHP A;  4QF3 A;  2DX8 A;  3U5M A;  3SOW A;  2YT5 A;  2CKL A;  4FJC A;  4FO9 A;  3KQI A;  2YUR A;  2M85 A;  3I2D A;  5AIT A;  3N9N A;  2LV9 A;  4I7D A;  3KV5 A;  4W4U A;  2LGK A;  5TRB A;  2D8S A;  3L11 A;  5I3L A;  4X3G A;  3KV6 A;  5C11 A;  3MHH A;  1JM7 B;  2MNY A;  2YQL A;  1VFY A;  3PUR A;  3N9P A;  2ECT A;  2YHN A;  3PUQ A;  2YHO A;  2C2L A;  2YRE A;  1E4U A;  2L0B A;  5D1L B;  4A4C A;  3HCT A;  2ECG A;  3O7A A;  1RMD A;  2KU3 A;  5TDW A;  1XWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...