4LJNA

Crystal structure of moz double phd finger
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
120
Chain Sequence
ELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
total genus 24
structure length 120
sequence length 124
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ljnA00
5KH3A 4ZQLA 4YBTA 2ECNA 3N9PA 4YAXA 5D1LB 4A4BA 3L1ZB 2Y1NA 4PTBA 4F52B 1DVPA 1U6GB 4WZ0A 2K17A 2CKLA 5B76A 2JMDA 3QZVA 5H1VA 4R8PK 1VYXA 4I7BA 2Y43A 4QF2A 2LQ6A 4LJNA 3L1XA 2EGPA 3O36A 2YQLA 3LQHA 2YHOA 4YADA 1CHCA 3T7LA 2VNFA 2LGGA 1E4UA 5B79A 1XWHA 4UP0A 4IC2A 4WZ2A 1HYJA 4YBMA 1T1HA 1K2FA 1WEQA 3LQJA 2MNYA 4X3GA 3O35A 3PUQA 2ECIA 4XI1A 2ECTA 5FB1A 4FIPA 2CSYA 3U5PA 2H0DB 4MSXA 5B75A 5LKXA 2KREA 3ZNIA 4WZ3B 2K16A 2K4DA 5DINA 4GNDA 1RMDA 3DQVR 2G6QA 5H9MA 5TRBA 1JM7A 5TBNA 3O34A 4LADB 5B78A 4S3OB 3KV6A 2XB1A 3PHDA 5B8DA 2LV9A 3O37A 3L11A 2AN6A 3SOUA 2KWOA 3SOWA 1HYIA 2QICA 1G25A 3M62A 2YT5A 2CT2A 5FERA 3LRQA 2JMIA 5C11A 1LDKC 2LGKA 3KV5A 5C13A 2M6MA 2YQMA 4UP5A 2L0BA 2VPBA 4TKPB 2E6RA 4CCGX 2C2LA 1LDJB 2M1RA 4AVXA 2CSZA 5KH7A 4B86C 2OXQC 4NN2A 3T6RA 5LCWB 2LN0A 3ASLA 2MT5A 2YW8A 1IYMA 3C5KA 2G43A 3O33A 3O70A 1WENA 1BORA 4BHWA 2YYRA 4S3OC 5G04B 2VPGA 3PURA 2EA6A 4L58A 2VJFB 5FEYA 2VPDA 5KH9A 3FL2A 1WEMA 2G45A 2JRJA 2KWNA 4R7EA 4BBQA 1JOCA 4A4CA 2HYED 2RI7A 3GL6A 4IC3A 2IDAA 2F6JA 4W4UA 2CKLB 3LQIA 4YC9A 2FSAA 4GB0A 3N9OA 3U5NA 3M99A 1X4IA 2NAAA 5AIUA 5H1UA 2DX8A 5B77A 2EODA 2D8SA 1WFKA 1WILA 5LKTA 5D1KB 5LKUA 2L75A 2MIQA 3RPGB 3ZVZB 3HTKC 5LKZA 4FO9A 2JMJA 1Z60A 4A0CD 3ZPVE 2MA6A 3EB5A 3ZPV1 5G0FA 3RTRB 2KR4A 2KWKA 2MUMA 1ZBDB 4N4FA 4Q6FA 4ZUXU 1X4UA 4YBSA 4O64A 1JM7B 2F6NA 3HCSA 1FBVA 3SOXA 4LKAA 3GV4A 1WEOA 2YUCA 1WEUA 2ECGA 3V43A 1Z2QA 5EYAF 1WEWA 5J3XA 2FUIA 4A49A 3MHHA 4N3WA 1WESA 2RSDA 3N9LA 5H1TA 2ZETC 4B7YC 3O7AA 3IHPA 2MA5A 4YATA 3KQIA 2QJ0A 3I2DA 2ECVA 3EB6A 1WEPA 2LXPC 5G05B 4R2YA 2ECWA 4YABA 2H0DA 4GNGA 2M3HA 3SHBA 2YSJA 2LGVA 5TDRA 2Y1MA 1VD4A 3HCUA 4MVTA 2KGIA 2C2VS 2KFTA 2PNXA 2KIZA 2YU4A 4WA6A 1WEEA 3ZYQA 4FJCA 2QIZA 3N9NA 4UI9B 5TDWA 2F42A 4FK5A 5AITA 2M85A 3N9QA 2LDRA 5JG6A 4AYCA 2LGLA 4P5OB 2K1JA 3C6WA 4LLBA 2YREA 2KWJA 4ZDTA 4CA1A 3VK6A 4V3LC 3RPGC 2FUUA 5DKAA 2VPEA 2LXHC 4QF3A 3ZTGA 2LRIC 2MD7B 4LK9A 3DPLR 2L43A 4V3KC 5TABA 1WIMA 5FB0A 4GNFA 2KE1A 2VJEB 1VFYA 2YHNA 2I50A 3NG2A 2UZGA 5I3LA 4AP4A 2E6SA 2ECJA 2KGGA 1Z6UA 2BAYA 1FP0A 3MHSA 1MM2A 1F62A 4PPEA 3U5MA 1N87A 4AYCB 4L7XA 2MNZA 3N9MA 3HCTA 2VJFA 1MM3A 1WGMA 2HDPA 3ZVYA 4AUQB 2L5UA 2VJEA 2YSMA 4I7DA 2VP7A 2KU3A 3M63A 1WE9A 2MD8C 1X4JA 1V87A 2YURA 2XEUA 2L80A 3KNVA 2KYUA 5D1MB 4GNEA 1WEVA 4C9ZA 3U5OA 4I7CA 2PUYA
chains in the Genus database with same CATH superfamily
5KH3A 2CRWA 4ZQLA 4YBTA 2ECNA 3N9PA 4YAXA 5D1LB 4A4BA 3L1ZB 2Y1NA 3O47A 4PTBA 4F52B 1U6GB 1DVPA 4WZ0A 2K17A 4Z0RA 2CKLA 5B76A 2JMDA 3QZVA 5H1VA 4R8PK 1VYXA 4I7BA 2Y43A 4QF2A 2LQ6A 3M7KA 4LJNA 3L1XA 2EGPA 3O36A 2YQLA 2CRRA 3LQHA 2YHOA 3FJUB 3LJUX 4YADA 1CHCA 2L7PA 3T7LA 2VNFA 2LGGA 1E4UA 5B79A 1XWHA 4UP0A 2JUNA 4IC2A 4WZ2A 1HYJA 4YBMA 1T1HA 3FAOA 1K2FA 1WEQA 5SVIA 3LQJA 2MNYA 2XOZA 4X3GA 3O35A 3PUQA 2ECIA 2KKXA 4XI1A 3T9KA 2ECTA 5FB1A 4FIPA 4H9DA 2CSYA 3U5PA 2H0DB 4MSXA 5B75A 5LKXA 2KREA 3ZNIA 4WZ3B 2K16A 2K4DA 2YVRA 3KDEC 5DINA 4GNDA 1RMDA 3DQVR 3JUEA 2G6QA 5H9MA 1DCQA 5TRBA 1JM7A 3FEHA 3O34A 5TBNA 4LADB 5B78A 4S3OB 3KV6A 2XB1A 3PHDA 5B8DA 2LV9A 2JM3A 2E61A 3O37A 3Q1DA 3L11A 2AN6A 3SOUA 2KWOA 3SOWA 1HYIA 2QICA 1G25A 2XP0A 3M62A 2YT5A 2CT2A 5FERA 3LRQA 2JMIA 5C11A 1LDKC 2LGKA 3KV5A 5C13A 2M6MA 2YQMA 2DSMA 4UP5A 2RR4A 2L0BA 2VPBA 4TKPB 3LVRE 2E6RA 4CCGX 2C2LA 1LDJB 2M1RA 4AVXA 2CSZA 5KH7A 4B86C 2OXQC 4NN2A 3T6RA 5LCWB 2LN0A 3ASLA 2MT5A 2YW8A 1IYMA 3C5KA 2G43A 3O33A 3O70A 1WENA 1BORA 4BHWA 2YYRA 4S3OC 5G04B 4O62A 2VPGA 3PURA 2EA6A 4L58A 2VJFB 5FEYA 2IQJA 2VPDA 5KH9A 3FL2A 1WEMA 2G45A 2JRJA 2KWNA 3LDYA 2LAUA 4R7EA 2EXUA 4BBQA 1JOCA 5K3QA 4A4CA 2HYED 3FANA 4IC3A 2RI7A 3DWDA 3GL6A 2IDAA 2F6JA 4W4UA 2CKLB 3LQIA 4YC9A 2FSAA 4GB0A 4QQ4A 3N9OA 3U5NA 2XOYA 3M99A 1X4IA 2NAAA 5AIUA 5H1UA 2EGMA 5SVXA 2DX8A 5B77A 2EODA 2D8SA 1WFKA 1WILA 2D8UA 5LKTA 5D1KB 3PLWA 5LKUA 2L75A 2MIQA 3RPGB 3ZVZB 3HTKC 5LKZA 4FO9A 2JMJA 1Z60A 4A0CD 3ZPVE 2MA6A 3EB5A 2CSVA 3ZPV1 5G0FA 3RTRB 2KR4A 2KWKA 2MUMA 1ZBDB 4N4FA 4Q6FA 2MKEA 4ZUXU 1X4UA 4YBSA 4O64A 1JM7B 2F6NA 3HCSA 1FBVA 3SOXA 4LKAA 3GV4A 1WEOA 2FD4A 2YUCA 1WEUA 2ECGA 3V43A 1Z2QA 5EYAF 1WEWA 5J3XA 2FUIA 4A49A 3MHHA 4N3WA 1WESA 2RSDA 3N9LA 5H1TA 2ZETC 4B7YC 3O7AA 3IHPA 2MA5A 4YATA 3KQIA 3E2DA 2QJ0A 3I2DA 4Z0OA 2ECVA 3EB6A 1WEPA 2LXPC 5G05B 4R2YA 2FFWA 2ECWA 4GNGA 2H0DA 4YABA 2M3HA 3SHBA 2YSJA 2LGVA 5TDRA 2XOCA 2Y1MA 1VD4A 3HCUA 3SUBA 3LVQE 2KGIA 3MDBC 4MVTA 2C2VS 2KFTA 2OWAA 2PNXA 2KIZA 2YU4A 4WA6A 1WEEA 3ZYQA 4FJCA 2DJAA 2QIZA 3N9NA 5SVIB 4UI9B 5TDWA 2F42A 4FK5A 2KKYA 5AITA 4OGCA 2M85A 1MBMA 3N9QA 4F1PA 2LDRA 5JG6A 5SVYA 4AYCA 2LGLA 4P5OB 2K1JA 3C6WA 3FM8C 4LLBA 2YREA 2KWJA 4ZDTA 2M13A 4CA1A 3VK6A 4V3LC 3RPGC 2FUUA 5DKAA 2VPEA 2LXHC 2P57A 4QF3A 3ZTGA 2LRIC 2MD7B 4LK9A 3DPLR 2L43A 4V3KC 2CONA 3H7HA 5TABA 1WIMA 5FB0A 4GNFA 2KE1A 2VJEB 1VFYA 2YHNA 2I50A 3NG2A 2UZGA 5I3LA 4AP4A 2E6SA 2ECJA 2KGGA 1Z6UA 2BAYA 1FP0A 3MHSA 1MM2A 1F62A 2B0OE 4PPEA 3U5MA 1N87A 4AYCB 4L7XA 2MNZA 3N9MA 3HCTA 2VJFA 1MM3A 4OGEA 1WGMA 2HDPA 3ZVYA 4AUQB 2L5UA 2VJEA 2YSMA 4I7DA 2VP7A 2KU3A 3M63A 1WE9A 2MD8C 3DDTA 1X4JA 1V87A 2YURA 2XEUA 2L80A 3KNVA 2KYUA 5D1MB 4GNEA 1WEVA 4C9ZA 3U5OA 4I7CA 2PUYA
chains in the Genus database with same CATH topology
5KH3A 4ZQLA 4YBTA 2ECNA 3N9PA 4YAXA 5D1LB 4A4BA 3L1ZB 2Y1NA 4PTBA 4F52B 1DVPA 1U6GB 4WZ0A 2K17A 2CKLA 5B76A 2JMDA 3QZVA 5H1VA 4R8PK 1VYXA 4I7BA 2Y43A 4QF2A 2LQ6A 4LJNA 3L1XA 2EGPA 3O36A 2YQLA 3LQHA 2YHOA 4YADA 1CHCA 3T7LA 2VNFA 2LGGA 1E4UA 5B79A 1XWHA 4UP0A 4IC2A 4WZ2A 1HYJA 4YBMA 1T1HA 1K2FA 1WEQA 3LQJA 2MNYA 4X3GA 3O35A 3PUQA 2ECIA 4XI1A 2ECTA 5FB1A 4FIPA 2CSYA 3U5PA 2H0DB 4MSXA 5B75A 5LKXA 2KREA 3ZNIA 4WZ3B 2K16A 2K4DA 5DINA 4GNDA 1RMDA 3DQVR 2G6QA 5H9MA 5TRBA 1JM7A 5TBNA 3O34A 4LADB 5B78A 4S3OB 3KV6A 2XB1A 3PHDA 5B8DA 2LV9A 3O37A 3L11A 2AN6A 3SOUA 2KWOA 3SOWA 1HYIA 2QICA 1G25A 3M62A 2YT5A 2CT2A 5FERA 3LRQA 2JMIA 5C11A 1LDKC 2LGKA 3KV5A 5C13A 2M6MA 2YQMA 4UP5A 2L0BA 2VPBA 4TKPB 2E6RA 4CCGX 2C2LA 1LDJB 2M1RA 4AVXA 2CSZA 5KH7A 4B86C 2OXQC 4NN2A 3T6RA 5LCWB 2LN0A 3ASLA 2MT5A 2YW8A 1IYMA 3C5KA 2G43A 3O33A 3O70A 1WENA 1BORA 4BHWA 2YYRA 4S3OC 5G04B 2VPGA 3PURA 2EA6A 4L58A 2VJFB 5FEYA 2VPDA 5KH9A 3FL2A 1WEMA 2G45A 2JRJA 2KWNA 4R7EA 4BBQA 1JOCA 4A4CA 2HYED 2RI7A 3GL6A 4IC3A 2IDAA 2F6JA 4W4UA 2CKLB 3LQIA 4YC9A 2FSAA 4GB0A 3N9OA 3U5NA 3M99A 1X4IA 2NAAA 5AIUA 5H1UA 2DX8A 5B77A 2EODA 2D8SA 1WFKA 1WILA 5LKTA 5D1KB 5LKUA 2L75A 2MIQA 3RPGB 3ZVZB 3HTKC 5LKZA 4FO9A 2JMJA 1Z60A 4A0CD 3ZPVE 2MA6A 3EB5A 3ZPV1 5G0FA 3RTRB 2KR4A 2KWKA 2MUMA 1ZBDB 4N4FA 4Q6FA 4ZUXU 1X4UA 4YBSA 4O64A 1JM7B 2F6NA 3HCSA 1FBVA 3SOXA 4LKAA 3GV4A 1WEOA 2YUCA 1WEUA 2ECGA 3V43A 1Z2QA 5EYAF 1WEWA 5J3XA 2FUIA 4A49A 3MHHA 4N3WA 1WESA 2RSDA 3N9LA 5H1TA 2ZETC 4B7YC 3O7AA 3IHPA 2MA5A 4YATA 3KQIA 2QJ0A 3I2DA 2ECVA 3EB6A 1WEPA 2LXPC 5G05B 4R2YA 2ECWA 4YABA 2H0DA 4GNGA 2M3HA 3SHBA 2YSJA 2LGVA 5TDRA 2Y1MA 1VD4A 3HCUA 4MVTA 2KGIA 2C2VS 2KFTA 2PNXA 2KIZA 2YU4A 4WA6A 1WEEA 3ZYQA 4FJCA 2QIZA 3N9NA 4UI9B 5TDWA 2F42A 4FK5A 5AITA 2M85A 3N9QA 2LDRA 5JG6A 4AYCA 2LGLA 4P5OB 2K1JA 3C6WA 4LLBA 2YREA 2KWJA 4ZDTA 4CA1A 3VK6A 4V3LC 3RPGC 2FUUA 5DKAA 2VPEA 2LXHC 4QF3A 3ZTGA 2LRIC 2MD7B 4LK9A 3DPLR 2L43A 4V3KC 5TABA 1WIMA 5FB0A 4GNFA 2KE1A 2VJEB 1VFYA 2YHNA 2I50A 3NG2A 2UZGA 5I3LA 4AP4A 2E6SA 2ECJA 2KGGA 1Z6UA 2BAYA 1FP0A 3MHSA 1MM2A 1F62A 4PPEA 3U5MA 1N87A 4AYCB 4L7XA 2MNZA 3N9MA 3HCTA 2VJFA 1MM3A 1WGMA 2HDPA 3ZVYA 4AUQB 2L5UA 2VJEA 2YSMA 4I7DA 2VP7A 2KU3A 3M63A 1WE9A 2MD8C 1X4JA 1V87A 2YURA 2XEUA 2L80A 3KNVA 2KYUA 5D1MB 4GNEA 1WEVA 4C9ZA 3U5OA 4I7CA 2PUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH3 A;  4ZQL A;  4YBT A;  2ECN A;  3N9P A;  4YAX A;  5D1L B;  4A4B A;  3L1Z B;  2Y1N A;  4PTB A;  4F52 B;  1DVP A;  1U6G B;  4WZ0 A;  2K17 A;  2CKL A;  5B76 A;  2JMD A;  3QZV A;  5H1V A;  4R8P K;  1VYX A;  4I7B A;  2Y43 A;  4QF2 A;  2LQ6 A;  4LJN A;  3L1X A;  2EGP A;  3O36 A;  2YQL A;  3LQH A;  2YHO A;  4YAD A;  1CHC A;  3T7L A;  2VNF A;  2LGG A;  1E4U A;  5B79 A;  1XWH A;  4UP0 A;  4IC2 A;  4WZ2 A;  1HYJ A;  4YBM A;  1T1H A;  1K2F A;  1WEQ A;  3LQJ A;  2MNY A;  4X3G A;  3O35 A;  3PUQ A;  2ECI A;  4XI1 A;  2ECT A;  5FB1 A;  4FIP A;  2CSY A;  3U5P A;  2H0D B;  4MSX A;  5B75 A;  5LKX A;  2KRE A;  3ZNI A;  4WZ3 B;  2K16 A;  2K4D A;  5DIN A;  4GND A;  1RMD A;  3DQV R;  2G6Q A;  5H9M A;  5TRB A;  1JM7 A;  5TBN A;  3O34 A;  4LAD B;  5B78 A;  4S3O B;  3KV6 A;  2XB1 A;  3PHD A;  5B8D A;  2LV9 A;  3O37 A;  3L11 A;  2AN6 A;  3SOU A;  2KWO A;  3SOW A;  1HYI A;  2QIC A;  1G25 A;  3M62 A;  2YT5 A;  2CT2 A;  5FER A;  3LRQ A;  2JMI A;  5C11 A;  1LDK C;  2LGK A;  3KV5 A;  5C13 A;  2M6M A;  2YQM A;  4UP5 A;  2L0B A;  2VPB A;  4TKP B;  2E6R A;  4CCG X;  2C2L A;  1LDJ B;  2M1R A;  4AVX A;  2CSZ A;  5KH7 A;  4B86 C;  2OXQ C;  4NN2 A;  3T6R A;  5LCW B;  2LN0 A;  3ASL A;  2MT5 A;  2YW8 A;  1IYM A;  3C5K A;  2G43 A;  3O33 A;  3O70 A;  1WEN A;  1BOR A;  4BHW A;  2YYR A;  4S3O C;  5G04 B;  2VPG A;  3PUR A;  2EA6 A;  4L58 A;  2VJF B;  5FEY A;  2VPD A;  5KH9 A;  3FL2 A;  1WEM A;  2G45 A;  2JRJ A;  2KWN A;  4R7E A;  4BBQ A;  1JOC A;  4A4C A;  2HYE D;  2RI7 A;  3GL6 A;  4IC3 A;  2IDA A;  2F6J A;  4W4U A;  2CKL B;  3LQI A;  4YC9 A;  2FSA A;  4GB0 A;  3N9O A;  3U5N A;  3M99 A;  1X4I A;  2NAA A;  5AIU A;  5H1U A;  2DX8 A;  5B77 A;  2EOD A;  2D8S A;  1WFK A;  1WIL A;  5LKT A;  5D1K B;  5LKU A;  2L75 A;  2MIQ A;  3RPG B;  3ZVZ B;  3HTK C;  5LKZ A;  4FO9 A;  2JMJ A;  1Z60 A;  4A0C D;  3ZPV E;  2MA6 A;  3EB5 A;  3ZPV 1;  5G0F A;  3RTR B;  2KR4 A;  2KWK A;  2MUM A;  1ZBD B;  4N4F A;  4Q6F A;  4ZUX U;  1X4U A;  4YBS A;  4O64 A;  1JM7 B;  2F6N A;  3HCS A;  1FBV A;  3SOX A;  4LKA A;  3GV4 A;  1WEO A;  2YUC A;  1WEU A;  2ECG A;  3V43 A;  1Z2Q A;  5EYA F;  1WEW A;  5J3X A;  2FUI A;  4A49 A;  3MHH A;  4N3W A;  1WES A;  2RSD A;  3N9L A;  5H1T A;  2ZET C;  4B7Y C;  3O7A A;  3IHP A;  2MA5 A;  4YAT A;  3KQI A;  2QJ0 A;  3I2D A;  2ECV A;  3EB6 A;  1WEP A;  2LXP C;  5G05 B;  4R2Y A;  2ECW A;  4YAB A;  2H0D A;  4GNG A;  2M3H A;  3SHB A;  2YSJ A;  2LGV A;  5TDR A;  2Y1M A;  1VD4 A;  3HCU A;  4MVT A;  2KGI A;  2C2V S;  2KFT A;  2PNX A;  2KIZ A;  2YU4 A;  4WA6 A;  1WEE A;  3ZYQ A;  4FJC A;  2QIZ A;  3N9N A;  4UI9 B;  5TDW A;  2F42 A;  4FK5 A;  5AIT A;  2M85 A;  3N9Q A;  2LDR A;  5JG6 A;  4AYC A;  2LGL A;  4P5O B;  2K1J A;  3C6W A;  4LLB A;  2YRE A;  2KWJ A;  4ZDT A;  4CA1 A;  3VK6 A;  4V3L C;  3RPG C;  2FUU A;  5DKA A;  2VPE A;  2LXH C;  4QF3 A;  3ZTG A;  2LRI C;  2MD7 B;  4LK9 A;  3DPL R;  2L43 A;  4V3K C;  5TAB A;  1WIM A;  5FB0 A;  4GNF A;  2KE1 A;  2VJE B;  1VFY A;  2YHN A;  2I50 A;  3NG2 A;  2UZG A;  5I3L A;  4AP4 A;  2E6S A;  2ECJ A;  2KGG A;  1Z6U A;  2BAY A;  1FP0 A;  3MHS A;  1MM2 A;  1F62 A;  4PPE A;  3U5M A;  1N87 A;  4AYC B;  4L7X A;  2MNZ A;  3N9M A;  3HCT A;  2VJF A;  1MM3 A;  1WGM A;  2HDP A;  3ZVY A;  4AUQ B;  2L5U A;  2VJE A;  2YSM A;  4I7D A;  2VP7 A;  2KU3 A;  3M63 A;  1WE9 A;  2MD8 C;  1X4J A;  1V87 A;  2YUR A;  2XEU A;  2L80 A;  3KNV A;  2KYU A;  5D1M B;  4GNE A;  1WEV A;  4C9Z A;  3U5O A;  4I7C A;  2PUY A; 
#chains in the Genus database with same CATH topology
 5KH3 A;  2CRW A;  4ZQL A;  4YBT A;  2ECN A;  3N9P A;  4YAX A;  5D1L B;  4A4B A;  3L1Z B;  2Y1N A;  3O47 A;  4PTB A;  4F52 B;  1U6G B;  1DVP A;  4WZ0 A;  2K17 A;  4Z0R A;  2CKL A;  5B76 A;  2JMD A;  3QZV A;  5H1V A;  4R8P K;  1VYX A;  4I7B A;  2Y43 A;  4QF2 A;  2LQ6 A;  3M7K A;  4LJN A;  3L1X A;  2EGP A;  3O36 A;  2YQL A;  2CRR A;  3LQH A;  2YHO A;  3FJU B;  3LJU X;  4YAD A;  1CHC A;  2L7P A;  3T7L A;  2VNF A;  2LGG A;  1E4U A;  5B79 A;  1XWH A;  4UP0 A;  2JUN A;  4IC2 A;  4WZ2 A;  1HYJ A;  4YBM A;  1T1H A;  3FAO A;  1K2F A;  1WEQ A;  5SVI A;  3LQJ A;  2MNY A;  2XOZ A;  4X3G A;  3O35 A;  3PUQ A;  2ECI A;  2KKX A;  4XI1 A;  3T9K A;  2ECT A;  5FB1 A;  4FIP A;  4H9D A;  2CSY A;  3U5P A;  2H0D B;  4MSX A;  5B75 A;  5LKX A;  2KRE A;  3ZNI A;  4WZ3 B;  2K16 A;  2K4D A;  2YVR A;  3KDE C;  5DIN A;  4GND A;  1RMD A;  3DQV R;  3JUE A;  2G6Q A;  5H9M A;  1DCQ A;  5TRB A;  1JM7 A;  3FEH A;  3O34 A;  5TBN A;  4LAD B;  5B78 A;  4S3O B;  3KV6 A;  2XB1 A;  3PHD A;  5B8D A;  2LV9 A;  2JM3 A;  2E61 A;  3O37 A;  3Q1D A;  3L11 A;  2AN6 A;  3SOU A;  2KWO A;  3SOW A;  1HYI A;  2QIC A;  1G25 A;  2XP0 A;  3M62 A;  2YT5 A;  2CT2 A;  5FER A;  3LRQ A;  2JMI A;  5C11 A;  1LDK C;  2LGK A;  3KV5 A;  5C13 A;  2M6M A;  2YQM A;  2DSM A;  4UP5 A;  2RR4 A;  2L0B A;  2VPB A;  4TKP B;  3LVR E;  2E6R A;  4CCG X;  2C2L A;  1LDJ B;  2M1R A;  4AVX A;  2CSZ A;  5KH7 A;  4B86 C;  2OXQ C;  4NN2 A;  3T6R A;  5LCW B;  2LN0 A;  3ASL A;  2MT5 A;  2YW8 A;  1IYM A;  3C5K A;  2G43 A;  3O33 A;  3O70 A;  1WEN A;  1BOR A;  4BHW A;  2YYR A;  4S3O C;  5G04 B;  4O62 A;  2VPG A;  3PUR A;  2EA6 A;  4L58 A;  2VJF B;  5FEY A;  2IQJ A;  2VPD A;  5KH9 A;  3FL2 A;  1WEM A;  2G45 A;  2JRJ A;  2KWN A;  3LDY A;  2LAU A;  4R7E A;  2EXU A;  4BBQ A;  1JOC A;  5K3Q A;  4A4C A;  2HYE D;  3FAN A;  4IC3 A;  2RI7 A;  3DWD A;  3GL6 A;  2IDA A;  2F6J A;  4W4U A;  2CKL B;  3LQI A;  4YC9 A;  2FSA A;  4GB0 A;  4QQ4 A;  3N9O A;  3U5N A;  2XOY A;  3M99 A;  1X4I A;  2NAA A;  5AIU A;  5H1U A;  2EGM A;  5SVX A;  2DX8 A;  5B77 A;  2EOD A;  2D8S A;  1WFK A;  1WIL A;  2D8U A;  5LKT A;  5D1K B;  3PLW A;  5LKU A;  2L75 A;  2MIQ A;  3RPG B;  3ZVZ B;  3HTK C;  5LKZ A;  4FO9 A;  2JMJ A;  1Z60 A;  4A0C D;  3ZPV E;  2MA6 A;  3EB5 A;  2CSV A;  3ZPV 1;  5G0F A;  3RTR B;  2KR4 A;  2KWK A;  2MUM A;  1ZBD B;  4N4F A;  4Q6F A;  2MKE A;  4ZUX U;  1X4U A;  4YBS A;  4O64 A;  1JM7 B;  2F6N A;  3HCS A;  1FBV A;  3SOX A;  4LKA A;  3GV4 A;  1WEO A;  2FD4 A;  2YUC A;  1WEU A;  2ECG A;  3V43 A;  1Z2Q A;  5EYA F;  1WEW A;  5J3X A;  2FUI A;  4A49 A;  3MHH A;  4N3W A;  1WES A;  2RSD A;  3N9L A;  5H1T A;  2ZET C;  4B7Y C;  3O7A A;  3IHP A;  2MA5 A;  4YAT A;  3KQI A;  3E2D A;  2QJ0 A;  3I2D A;  4Z0O A;  2ECV A;  3EB6 A;  1WEP A;  2LXP C;  5G05 B;  4R2Y A;  2FFW A;  2ECW A;  4GNG A;  2H0D A;  4YAB A;  2M3H A;  3SHB A;  2YSJ A;  2LGV A;  5TDR A;  2XOC A;  2Y1M A;  1VD4 A;  3HCU A;  3SUB A;  3LVQ E;  2KGI A;  3MDB C;  4MVT A;  2C2V S;  2KFT A;  2OWA A;  2PNX A;  2KIZ A;  2YU4 A;  4WA6 A;  1WEE A;  3ZYQ A;  4FJC A;  2DJA A;  2QIZ A;  3N9N A;  5SVI B;  4UI9 B;  5TDW A;  2F42 A;  4FK5 A;  2KKY A;  5AIT A;  4OGC A;  2M85 A;  1MBM A;  3N9Q A;  4F1P A;  2LDR A;  5JG6 A;  5SVY A;  4AYC A;  2LGL A;  4P5O B;  2K1J A;  3C6W A;  3FM8 C;  4LLB A;  2YRE A;  2KWJ A;  4ZDT A;  2M13 A;  4CA1 A;  3VK6 A;  4V3L C;  3RPG C;  2FUU A;  5DKA A;  2VPE A;  2LXH C;  2P57 A;  4QF3 A;  3ZTG A;  2LRI C;  2MD7 B;  4LK9 A;  3DPL R;  2L43 A;  4V3K C;  2CON A;  3H7H A;  5TAB A;  1WIM A;  5FB0 A;  4GNF A;  2KE1 A;  2VJE B;  1VFY A;  2YHN A;  2I50 A;  3NG2 A;  2UZG A;  5I3L A;  4AP4 A;  2E6S A;  2ECJ A;  2KGG A;  1Z6U A;  2BAY A;  1FP0 A;  3MHS A;  1MM2 A;  1F62 A;  2B0O E;  4PPE A;  3U5M A;  1N87 A;  4AYC B;  4L7X A;  2MNZ A;  3N9M A;  3HCT A;  2VJF A;  1MM3 A;  4OGE A;  1WGM A;  2HDP A;  3ZVY A;  4AUQ B;  2L5U A;  2VJE A;  2YSM A;  4I7D A;  2VP7 A;  2KU3 A;  3M63 A;  1WE9 A;  2MD8 C;  3DDT A;  1X4J A;  1V87 A;  2YUR A;  2XEU A;  2L80 A;  3KNV A;  2KYU A;  5D1M B;  4GNE A;  1WEV A;  4C9Z A;  3U5O A;  4I7C A;  2PUY A; 
#chains in the Genus database with same CATH homology
 5KH3 A;  4ZQL A;  4YBT A;  2ECN A;  3N9P A;  4YAX A;  5D1L B;  4A4B A;  3L1Z B;  2Y1N A;  4PTB A;  4F52 B;  1DVP A;  1U6G B;  4WZ0 A;  2K17 A;  2CKL A;  5B76 A;  2JMD A;  3QZV A;  5H1V A;  4R8P K;  1VYX A;  4I7B A;  2Y43 A;  4QF2 A;  2LQ6 A;  4LJN A;  3L1X A;  2EGP A;  3O36 A;  2YQL A;  3LQH A;  2YHO A;  4YAD A;  1CHC A;  3T7L A;  2VNF A;  2LGG A;  1E4U A;  5B79 A;  1XWH A;  4UP0 A;  4IC2 A;  4WZ2 A;  1HYJ A;  4YBM A;  1T1H A;  1K2F A;  1WEQ A;  3LQJ A;  2MNY A;  4X3G A;  3O35 A;  3PUQ A;  2ECI A;  4XI1 A;  2ECT A;  5FB1 A;  4FIP A;  2CSY A;  3U5P A;  2H0D B;  4MSX A;  5B75 A;  5LKX A;  2KRE A;  3ZNI A;  4WZ3 B;  2K16 A;  2K4D A;  5DIN A;  4GND A;  1RMD A;  3DQV R;  2G6Q A;  5H9M A;  5TRB A;  1JM7 A;  5TBN A;  3O34 A;  4LAD B;  5B78 A;  4S3O B;  3KV6 A;  2XB1 A;  3PHD A;  5B8D A;  2LV9 A;  3O37 A;  3L11 A;  2AN6 A;  3SOU A;  2KWO A;  3SOW A;  1HYI A;  2QIC A;  1G25 A;  3M62 A;  2YT5 A;  2CT2 A;  5FER A;  3LRQ A;  2JMI A;  5C11 A;  1LDK C;  2LGK A;  3KV5 A;  5C13 A;  2M6M A;  2YQM A;  4UP5 A;  2L0B A;  2VPB A;  4TKP B;  2E6R A;  4CCG X;  2C2L A;  1LDJ B;  2M1R A;  4AVX A;  2CSZ A;  5KH7 A;  4B86 C;  2OXQ C;  4NN2 A;  3T6R A;  5LCW B;  2LN0 A;  3ASL A;  2MT5 A;  2YW8 A;  1IYM A;  3C5K A;  2G43 A;  3O33 A;  3O70 A;  1WEN A;  1BOR A;  4BHW A;  2YYR A;  4S3O C;  5G04 B;  2VPG A;  3PUR A;  2EA6 A;  4L58 A;  2VJF B;  5FEY A;  2VPD A;  5KH9 A;  3FL2 A;  1WEM A;  2G45 A;  2JRJ A;  2KWN A;  4R7E A;  4BBQ A;  1JOC A;  4A4C A;  2HYE D;  2RI7 A;  3GL6 A;  4IC3 A;  2IDA A;  2F6J A;  4W4U A;  2CKL B;  3LQI A;  4YC9 A;  2FSA A;  4GB0 A;  3N9O A;  3U5N A;  3M99 A;  1X4I A;  2NAA A;  5AIU A;  5H1U A;  2DX8 A;  5B77 A;  2EOD A;  2D8S A;  1WFK A;  1WIL A;  5LKT A;  5D1K B;  5LKU A;  2L75 A;  2MIQ A;  3RPG B;  3ZVZ B;  3HTK C;  5LKZ A;  4FO9 A;  2JMJ A;  1Z60 A;  4A0C D;  3ZPV E;  2MA6 A;  3EB5 A;  3ZPV 1;  5G0F A;  3RTR B;  2KR4 A;  2KWK A;  2MUM A;  1ZBD B;  4N4F A;  4Q6F A;  4ZUX U;  1X4U A;  4YBS A;  4O64 A;  1JM7 B;  2F6N A;  3HCS A;  1FBV A;  3SOX A;  4LKA A;  3GV4 A;  1WEO A;  2YUC A;  1WEU A;  2ECG A;  3V43 A;  1Z2Q A;  5EYA F;  1WEW A;  5J3X A;  2FUI A;  4A49 A;  3MHH A;  4N3W A;  1WES A;  2RSD A;  3N9L A;  5H1T A;  2ZET C;  4B7Y C;  3O7A A;  3IHP A;  2MA5 A;  4YAT A;  3KQI A;  2QJ0 A;  3I2D A;  2ECV A;  3EB6 A;  1WEP A;  2LXP C;  5G05 B;  4R2Y A;  2ECW A;  4YAB A;  2H0D A;  4GNG A;  2M3H A;  3SHB A;  2YSJ A;  2LGV A;  5TDR A;  2Y1M A;  1VD4 A;  3HCU A;  4MVT A;  2KGI A;  2C2V S;  2KFT A;  2PNX A;  2KIZ A;  2YU4 A;  4WA6 A;  1WEE A;  3ZYQ A;  4FJC A;  2QIZ A;  3N9N A;  4UI9 B;  5TDW A;  2F42 A;  4FK5 A;  5AIT A;  2M85 A;  3N9Q A;  2LDR A;  5JG6 A;  4AYC A;  2LGL A;  4P5O B;  2K1J A;  3C6W A;  4LLB A;  2YRE A;  2KWJ A;  4ZDT A;  4CA1 A;  3VK6 A;  4V3L C;  3RPG C;  2FUU A;  5DKA A;  2VPE A;  2LXH C;  4QF3 A;  3ZTG A;  2LRI C;  2MD7 B;  4LK9 A;  3DPL R;  2L43 A;  4V3K C;  5TAB A;  1WIM A;  5FB0 A;  4GNF A;  2KE1 A;  2VJE B;  1VFY A;  2YHN A;  2I50 A;  3NG2 A;  2UZG A;  5I3L A;  4AP4 A;  2E6S A;  2ECJ A;  2KGG A;  1Z6U A;  2BAY A;  1FP0 A;  3MHS A;  1MM2 A;  1F62 A;  4PPE A;  3U5M A;  1N87 A;  4AYC B;  4L7X A;  2MNZ A;  3N9M A;  3HCT A;  2VJF A;  1MM3 A;  1WGM A;  2HDP A;  3ZVY A;  4AUQ B;  2L5U A;  2VJE A;  2YSM A;  4I7D A;  2VP7 A;  2KU3 A;  3M63 A;  1WE9 A;  2MD8 C;  1X4J A;  1V87 A;  2YUR A;  2XEU A;  2L80 A;  3KNV A;  2KYU A;  5D1M B;  4GNE A;  1WEV A;  4C9Z A;  3U5O A;  4I7C A;  2PUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...