5TDRA

Set3 phd finger in complex with histone h3k4me2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MGIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transcription
molecule keywords SET domain-containing protein 3
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tdrA00
1WEPA 3HCTA 5H1VA 2YUCA 4I7CA 5AIUA 2KWJA 4A4CA 2L43A 2LN0A 3SOUA 4GNFA 3RPGB 5B78A 4QF3A 3ZTGA 5LKUA 2MNYA 1MM3A 2LQ6A 2I50A 4QF2A 4YC9A 2H0DB 3N9QA 2BAYA 4A4BA 2KU3A 1E4UA 1ZBDB 2LRIC 5G0FA 3O37A 5B77A 2YW8A 2MNZA 2F6JA 2KE1A 1X4IA 2L80A 2JRJA 3NG2A 4FO9A 2F6NA 5TABA 2CSYA 2Y1MA 4YBSA 4ZQLA 2QICA 2LXHC 2LGVA 1WESA 2KGGA 2KWNA 3QZVA 4UP5A 4R7EA 4A0CD 2KREA 3C6WA 2K16A 2EGPA 3U5NA 4LLBA 2MIQA 3O7AA 1Z60A 5DINA 2KGIA 4AYCA 4C9ZA 2PUYA 2KFTA 3GV4A 4I7BA 2OXQC 2KIZA 4GB0A 5H1TA 5DKAA 2ZETC 2EODA 4YADA 2G45A 5JG6A 1N87A 5G04B 5KH7A 2L0BA 1V87A 4F52B 4LJNA 1MM2A 2HYED 2VJEB 1RMDA 2K1JA 2MD7B 5LCWB 5TRBA 1WEQA 3ZNIA 3KQIA 2EA6A 3LQIA 5AITA 4AVXA 2UZGA 1K2FA 3O70A 2ECTA 2Y43A 2YU4A 4TKPB 3SHBA 4WA6A 3M99A 3M62A 5TDRA 2M85A 4FIPA 1IYMA 5C13A 4V3KC 4AUQB 2E6RA 2KWOA 3N9OA 4N4FA 1WEUA 2KWKA 2LGKA 2FUUA 2XEUA 5KH3A 4R8PK 2YSJA 1WEWA 4MVTA 3DQVR 4X3GA 1JM7B 5B76A 1XWHA 1WE9A 3DPLR 1X4UA 3KV6A 2VNFA 2PNXA 3ZVYA 2JMIA 2K17A 1T1HA 3KV5A 2VPDA 4GNGA 4XI1A 2M6MA 2YT5A 2G43A 3ZYQA 3KNVA 3N9MA 4FK5A 1CHCA 1WEMA 2H0DA 4GNEA 3LRQA 5J3XA 2VPEA 4S3OB 3RTRB 3N9LA 1WGMA 4BBQA 2ECIA 1WEVA 3ZPV1 3VK6A 2VJFA 4B86C 1JM7A 4WZ2A 4O64A 1WENA 4A49A 4AYCB 4N3WA 4CA1A 1VYXA 2RI7A 1LDJB 4ZUXU 2VP7A 2L5UA 1JOCA 4I7DA 5B79A 4FJCA 4LKAA 2AN6A 2FSAA 3L11A 2LGLA 5G05B 1WEEA 2LV9A 3ZVZB 3MHHA 1Z2QA 2YQMA 2YSMA 5TDWA 4S3OC 2C2LA 3ZPVE 2M1RA 3L1XA 2CSZA 4NN2A 2LGGA 3SOWA 2DX8A 3N9NA 2F42A 3N9PA 4LK9A 4YAXA 2ECNA 4CCGX 5TBNA 3GL6A 1BORA 4L7XA 3HCSA 2FUIA 2RSDA 2ECJA 2IDAA 4GNDA 4WZ0A 3FL2A 2QJ0A 2QIZA 3ASLA 4UI9B 5FB0A 1WFKA 2NAAA 5LKTA 4MSXA 1VD4A 1WEOA 1Z6UA 3T6RA 3T7LA 4ZDTA 2YREA 4BHWA 3PHDA 2HDPA 2MD8C 3U5OA 5D1MB 3O33A 2ECGA 4R2YA 2YHNA 2YYRA 3PURA 5D1LB 2MA5A 2M3HA 4YBTA 4YBMA 5FERA 4Q6FA 4YATA 2JMDA 4WZ3B 4YABA 2E6SA 3C5KA 5LKZA 5D1KB 4IC3A 1F62A 4L58A 5KH9A 2LXPC 5B8DA 2K4DA 2VPBA 2ECVA 2YHOA 3MHSA 2Y1NA 5I3LA 3LQHA 1X4JA 4PTBA 3V43A 5C11A 4PPEA 3M63A 1WILA 1U6GB 3SOXA 1VFYA 4UP0A 2CT2A 1WIMA 2VJEA 1DVPA 3EB6A 3RPGC 3EB5A 3LQJA 1LDKC 1HYJA 1G25A 4IC2A 3U5MA 2CKLA 3HCUA 2YURA 2XB1A 3O36A 2ECWA 5FEYA 5H1UA 5LKXA 2YQLA 5FB1A 2D8SA 2KYUA 3U5PA 2C2VS 3PUQA 3HTKC 2VPGA 1FBVA 3IHPA 2JMJA 4AP4A 1HYIA 5H9MA 2G6QA 4B7YC 2MA6A 3L1ZB 2KR4A 3O34A 5EYAF 2MUMA 2L75A 2VJFB 2MT5A 4V3LC 2CKLB 2LDRA 4P5OB 3I2DA 4LADB 5B75A 3O35A 1FP0A 4W4UA
chains in the Genus database with same CATH superfamily
1WEPA 3HCTA 5H1VA 2YUCA 4I7CA 5AIUA 3M7KA 2L7PA 2KWJA 4A4CA 2L43A 2LN0A 3SOUA 4GNFA 3RPGB 5B78A 4H9DA 4QF3A 3ZTGA 5LKUA 2MNYA 1MM3A 2LQ6A 2I50A 4QF2A 4YC9A 2H0DB 3N9QA 2BAYA 4A4BA 2KU3A 1E4UA 1ZBDB 2LRIC 5G0FA 3O37A 5B77A 2YW8A 2MNZA 2F6JA 2KE1A 1X4IA 4F1PA 2L80A 2JRJA 3NG2A 4FO9A 2F6NA 5SVYA 5TABA 2CSYA 2XOCA 2Y1MA 4YBSA 4ZQLA 2QICA 2LXHC 3KDEC 2LGVA 1WESA 2P57A 2KGGA 2KWNA 3QZVA 4UP5A 4R7EA 4A0CD 2KREA 3C6WA 2K16A 2EGPA 3U5NA 4LLBA 2MIQA 3O7AA 1Z60A 5DINA 2KGIA 4AYCA 4C9ZA 2PUYA 2KFTA 3GV4A 2XOYA 4I7BA 2OXQC 2KIZA 3FANA 4GB0A 5H1TA 5DKAA 2ZETC 2EODA 4YADA 2CONA 2G45A 5JG6A 1N87A 5G04B 3MDBC 5KH7A 2L0BA 1V87A 4F52B 4LJNA 1MM2A 2HYED 2VJEB 1RMDA 2K1JA 2MD7B 5LCWB 3E2DA 5TRBA 1WEQA 3ZNIA 3KQIA 2EA6A 3LQIA 2FD4A 3LVQE 5AITA 4AVXA 2UZGA 1K2FA 3O70A 2ECTA 3FEHA 4Z0OA 3Q1DA 2Y43A 4OGEA 2YU4A 4TKPB 3SHBA 4WA6A 3M99A 3M62A 5TDRA 2M85A 4FIPA 1IYMA 5C13A 4V3KC 4AUQB 2E6RA 2KWOA 3N9OA 4N4FA 1WEUA 2KWKA 2LGKA 2FUUA 2XEUA 5SVIA 5KH3A 2JM3A 3LJUX 4R8PK 2YSJA 1WEWA 4MVTA 3DQVR 4X3GA 1JM7B 5B76A 2MKEA 1XWHA 1WE9A 3DPLR 1X4UA 3KV6A 2VNFA 2PNXA 3ZVYA 2JMIA 2K17A 1T1HA 3KV5A 2VPDA 4GNGA 4XI1A 2M6MA 2YT5A 2DSMA 2G43A 3ZYQA 3KNVA 2CRRA 2CRWA 3N9MA 4FK5A 1CHCA 1WEMA 2H0DA 4GNEA 1MBMA 3LRQA 5J3XA 2VPEA 4S3OB 3RTRB 3N9LA 1DCQA 1WGMA 4BBQA 2ECIA 1WEVA 3ZPV1 3VK6A 2VJFA 4B86C 1JM7A 4WZ2A 4O64A 1WENA 4A49A 4AYCB 4N3WA 4CA1A 3H7HA 4O62A 1VYXA 2RI7A 1LDJB 4ZUXU 2VP7A 2EGMA 2L5UA 1JOCA 4I7DA 5B79A 4FJCA 4LKAA 2AN6A 2E61A 2FSAA 3L11A 5G05B 2LGLA 2B0OE 1WEEA 2LV9A 3ZVZB 4OGCA 3LDYA 2EXUA 3MHHA 1Z2QA 3FM8C 2YQMA 2YSMA 4S3OC 5TDWA 2C2LA 3DDTA 2DJAA 3ZPVE 2M1RA 3L1XA 2CSZA 4NN2A 2LGGA 3DWDA 3SOWA 2DX8A 3N9NA 2F42A 3N9PA 4LK9A 4YAXA 2ECNA 2XP0A 3SUBA 2OWAA 4CCGX 5TBNA 3GL6A 1BORA 4L7XA 3HCSA 2FUIA 2RSDA 2ECJA 2IDAA 4GNDA 4WZ0A 3FL2A 3JUEA 2QJ0A 2QIZA 2FFWA 3ASLA 4UI9B 5FB0A 3FAOA 1WFKA 2NAAA 5LKTA 4MSXA 2CSVA 4QQ4A 1VD4A 1WEOA 1Z6UA 3T6RA 3T7LA 4ZDTA 2YREA 4BHWA 3PHDA 2HDPA 2MD8C 3U5OA 5D1MB 3O33A 2ECGA 4R2YA 2YHNA 2LAUA 2YYRA 3PURA 5D1LB 2MA5A 2M3HA 4YBTA 4YBMA 5FERA 4Q6FA 4YATA 2JMDA 4WZ3B 4YABA 2E6SA 5SVIB 3C5KA 5LKZA 5D1KB 4IC3A 1F62A 4L58A 2JUNA 5KH9A 2LXPC 5B8DA 2KKYA 3T9KA 2K4DA 2VPBA 2ECVA 2YHOA 3MHSA 2IQJA 2Y1NA 5I3LA 3LQHA 1X4JA 2D8UA 4PTBA 3V43A 5C11A 3LVRE 4PPEA 3M63A 1WILA 1U6GB 3SOXA 2KKXA 1VFYA 4UP0A 2RR4A 2CT2A 1WIMA 2VJEA 1DVPA 3EB6A 3RPGC 3EB5A 3LQJA 2M13A 1LDKC 1HYJA 1G25A 4IC2A 3U5MA 2CKLA 3FJUB 3HCUA 5K3QA 2YURA 2XB1A 3O36A 2ECWA 5FEYA 5H1UA 5LKXA 2YQLA 5FB1A 2D8SA 2KYUA 3U5PA 2C2VS 3PUQA 3HTKC 2VPGA 3O47A 3PLWA 1FBVA 3IHPA 2JMJA 5SVXA 4AP4A 1HYIA 2YVRA 5H9MA 2G6QA 4B7YC 2MA6A 3L1ZB 2KR4A 3O34A 5EYAF 2MUMA 2L75A 2VJFB 2MT5A 2XOZA 4V3LC 2CKLB 2LDRA 4P5OB 3I2DA 4Z0RA 4LADB 5B75A 3O35A 1FP0A 4W4UA
chains in the Genus database with same CATH topology
1WEPA 3HCTA 5H1VA 2YUCA 4I7CA 5AIUA 2KWJA 4A4CA 2L43A 2LN0A 3SOUA 4GNFA 3RPGB 5B78A 4QF3A 3ZTGA 5LKUA 2MNYA 1MM3A 2LQ6A 2I50A 4QF2A 4YC9A 2H0DB 3N9QA 2BAYA 4A4BA 2KU3A 1E4UA 1ZBDB 2LRIC 5G0FA 3O37A 5B77A 2YW8A 2MNZA 2F6JA 2KE1A 1X4IA 2L80A 2JRJA 3NG2A 4FO9A 2F6NA 5TABA 2CSYA 2Y1MA 4YBSA 4ZQLA 2QICA 2LXHC 2LGVA 1WESA 2KGGA 2KWNA 3QZVA 4UP5A 4R7EA 4A0CD 2KREA 3C6WA 2K16A 2EGPA 3U5NA 4LLBA 2MIQA 3O7AA 1Z60A 5DINA 2KGIA 4AYCA 4C9ZA 2PUYA 2KFTA 3GV4A 4I7BA 2OXQC 2KIZA 4GB0A 5H1TA 5DKAA 2ZETC 2EODA 4YADA 2G45A 5JG6A 1N87A 5G04B 5KH7A 2L0BA 1V87A 4F52B 4LJNA 1MM2A 2HYED 2VJEB 1RMDA 2K1JA 2MD7B 5LCWB 5TRBA 1WEQA 3ZNIA 3KQIA 2EA6A 3LQIA 5AITA 4AVXA 2UZGA 1K2FA 3O70A 2ECTA 2Y43A 2YU4A 4TKPB 3SHBA 4WA6A 3M99A 3M62A 5TDRA 2M85A 4FIPA 1IYMA 5C13A 4V3KC 4AUQB 2E6RA 2KWOA 3N9OA 4N4FA 1WEUA 2KWKA 2LGKA 2FUUA 2XEUA 5KH3A 4R8PK 2YSJA 1WEWA 4MVTA 3DQVR 4X3GA 1JM7B 5B76A 1XWHA 1WE9A 3DPLR 1X4UA 3KV6A 2VNFA 2PNXA 3ZVYA 2JMIA 2K17A 1T1HA 3KV5A 2VPDA 4GNGA 4XI1A 2M6MA 2YT5A 2G43A 3ZYQA 3KNVA 3N9MA 4FK5A 1CHCA 1WEMA 2H0DA 4GNEA 3LRQA 5J3XA 2VPEA 4S3OB 3RTRB 3N9LA 1WGMA 4BBQA 2ECIA 1WEVA 3ZPV1 3VK6A 2VJFA 4B86C 1JM7A 4WZ2A 4O64A 1WENA 4A49A 4AYCB 4N3WA 4CA1A 1VYXA 2RI7A 1LDJB 4ZUXU 2VP7A 2L5UA 1JOCA 4I7DA 5B79A 4FJCA 4LKAA 2AN6A 2FSAA 3L11A 2LGLA 5G05B 1WEEA 2LV9A 3ZVZB 3MHHA 1Z2QA 2YQMA 2YSMA 5TDWA 4S3OC 2C2LA 3ZPVE 2M1RA 3L1XA 2CSZA 4NN2A 2LGGA 3SOWA 2DX8A 3N9NA 2F42A 3N9PA 4LK9A 4YAXA 2ECNA 4CCGX 5TBNA 3GL6A 1BORA 4L7XA 3HCSA 2FUIA 2RSDA 2ECJA 2IDAA 4GNDA 4WZ0A 3FL2A 2QJ0A 2QIZA 3ASLA 4UI9B 5FB0A 1WFKA 2NAAA 5LKTA 4MSXA 1VD4A 1WEOA 1Z6UA 3T6RA 3T7LA 4ZDTA 2YREA 4BHWA 3PHDA 2HDPA 2MD8C 3U5OA 5D1MB 3O33A 2ECGA 4R2YA 2YHNA 2YYRA 3PURA 5D1LB 2MA5A 2M3HA 4YBTA 4YBMA 5FERA 4Q6FA 4YATA 2JMDA 4WZ3B 4YABA 2E6SA 3C5KA 5LKZA 5D1KB 4IC3A 1F62A 4L58A 5KH9A 2LXPC 5B8DA 2K4DA 2VPBA 2ECVA 2YHOA 3MHSA 2Y1NA 5I3LA 3LQHA 1X4JA 4PTBA 3V43A 5C11A 4PPEA 3M63A 1WILA 1U6GB 3SOXA 1VFYA 4UP0A 2CT2A 1WIMA 2VJEA 1DVPA 3EB6A 3RPGC 3EB5A 3LQJA 1LDKC 1HYJA 1G25A 4IC2A 3U5MA 2CKLA 3HCUA 2YURA 2XB1A 3O36A 2ECWA 5FEYA 5H1UA 5LKXA 2YQLA 5FB1A 2D8SA 2KYUA 3U5PA 2C2VS 3PUQA 3HTKC 2VPGA 1FBVA 3IHPA 2JMJA 4AP4A 1HYIA 5H9MA 2G6QA 4B7YC 2MA6A 3L1ZB 2KR4A 3O34A 5EYAF 2MUMA 2L75A 2VJFB 2MT5A 4V3LC 2CKLB 2LDRA 4P5OB 3I2DA 4LADB 5B75A 3O35A 1FP0A 4W4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEP A;  3HCT A;  5H1V A;  2YUC A;  4I7C A;  5AIU A;  2KWJ A;  4A4C A;  2L43 A;  2LN0 A;  3SOU A;  4GNF A;  3RPG B;  5B78 A;  4QF3 A;  3ZTG A;  5LKU A;  2MNY A;  1MM3 A;  2LQ6 A;  2I50 A;  4QF2 A;  4YC9 A;  2H0D B;  3N9Q A;  2BAY A;  4A4B A;  2KU3 A;  1E4U A;  1ZBD B;  2LRI C;  5G0F A;  3O37 A;  5B77 A;  2YW8 A;  2MNZ A;  2F6J A;  2KE1 A;  1X4I A;  2L80 A;  2JRJ A;  3NG2 A;  4FO9 A;  2F6N A;  5TAB A;  2CSY A;  2Y1M A;  4YBS A;  4ZQL A;  2QIC A;  2LXH C;  2LGV A;  1WES A;  2KGG A;  2KWN A;  3QZV A;  4UP5 A;  4R7E A;  4A0C D;  2KRE A;  3C6W A;  2K16 A;  2EGP A;  3U5N A;  4LLB A;  2MIQ A;  3O7A A;  1Z60 A;  5DIN A;  2KGI A;  4AYC A;  4C9Z A;  2PUY A;  2KFT A;  3GV4 A;  4I7B A;  2OXQ C;  2KIZ A;  4GB0 A;  5H1T A;  5DKA A;  2ZET C;  2EOD A;  4YAD A;  2G45 A;  5JG6 A;  1N87 A;  5G04 B;  5KH7 A;  2L0B A;  1V87 A;  4F52 B;  4LJN A;  1MM2 A;  2HYE D;  2VJE B;  1RMD A;  2K1J A;  2MD7 B;  5LCW B;  5TRB A;  1WEQ A;  3ZNI A;  3KQI A;  2EA6 A;  3LQI A;  5AIT A;  4AVX A;  2UZG A;  1K2F A;  3O70 A;  2ECT A;  2Y43 A;  2YU4 A;  4TKP B;  3SHB A;  4WA6 A;  3M99 A;  3M62 A;  5TDR A;  2M85 A;  4FIP A;  1IYM A;  5C13 A;  4V3K C;  4AUQ B;  2E6R A;  2KWO A;  3N9O A;  4N4F A;  1WEU A;  2KWK A;  2LGK A;  2FUU A;  2XEU A;  5KH3 A;  4R8P K;  2YSJ A;  1WEW A;  4MVT A;  3DQV R;  4X3G A;  1JM7 B;  5B76 A;  1XWH A;  1WE9 A;  3DPL R;  1X4U A;  3KV6 A;  2VNF A;  2PNX A;  3ZVY A;  2JMI A;  2K17 A;  1T1H A;  3KV5 A;  2VPD A;  4GNG A;  4XI1 A;  2M6M A;  2YT5 A;  2G43 A;  3ZYQ A;  3KNV A;  3N9M A;  4FK5 A;  1CHC A;  1WEM A;  2H0D A;  4GNE A;  3LRQ A;  5J3X A;  2VPE A;  4S3O B;  3RTR B;  3N9L A;  1WGM A;  4BBQ A;  2ECI A;  1WEV A;  3ZPV 1;  3VK6 A;  2VJF A;  4B86 C;  1JM7 A;  4WZ2 A;  4O64 A;  1WEN A;  4A49 A;  4AYC B;  4N3W A;  4CA1 A;  1VYX A;  2RI7 A;  1LDJ B;  4ZUX U;  2VP7 A;  2L5U A;  1JOC A;  4I7D A;  5B79 A;  4FJC A;  4LKA A;  2AN6 A;  2FSA A;  3L11 A;  2LGL A;  5G05 B;  1WEE A;  2LV9 A;  3ZVZ B;  3MHH A;  1Z2Q A;  2YQM A;  2YSM A;  5TDW A;  4S3O C;  2C2L A;  3ZPV E;  2M1R A;  3L1X A;  2CSZ A;  4NN2 A;  2LGG A;  3SOW A;  2DX8 A;  3N9N A;  2F42 A;  3N9P A;  4LK9 A;  4YAX A;  2ECN A;  4CCG X;  5TBN A;  3GL6 A;  1BOR A;  4L7X A;  3HCS A;  2FUI A;  2RSD A;  2ECJ A;  2IDA A;  4GND A;  4WZ0 A;  3FL2 A;  2QJ0 A;  2QIZ A;  3ASL A;  4UI9 B;  5FB0 A;  1WFK A;  2NAA A;  5LKT A;  4MSX A;  1VD4 A;  1WEO A;  1Z6U A;  3T6R A;  3T7L A;  4ZDT A;  2YRE A;  4BHW A;  3PHD A;  2HDP A;  2MD8 C;  3U5O A;  5D1M B;  3O33 A;  2ECG A;  4R2Y A;  2YHN A;  2YYR A;  3PUR A;  5D1L B;  2MA5 A;  2M3H A;  4YBT A;  4YBM A;  5FER A;  4Q6F A;  4YAT A;  2JMD A;  4WZ3 B;  4YAB A;  2E6S A;  3C5K A;  5LKZ A;  5D1K B;  4IC3 A;  1F62 A;  4L58 A;  5KH9 A;  2LXP C;  5B8D A;  2K4D A;  2VPB A;  2ECV A;  2YHO A;  3MHS A;  2Y1N A;  5I3L A;  3LQH A;  1X4J A;  4PTB A;  3V43 A;  5C11 A;  4PPE A;  3M63 A;  1WIL A;  1U6G B;  3SOX A;  1VFY A;  4UP0 A;  2CT2 A;  1WIM A;  2VJE A;  1DVP A;  3EB6 A;  3RPG C;  3EB5 A;  3LQJ A;  1LDK C;  1HYJ A;  1G25 A;  4IC2 A;  3U5M A;  2CKL A;  3HCU A;  2YUR A;  2XB1 A;  3O36 A;  2ECW A;  5FEY A;  5H1U A;  5LKX A;  2YQL A;  5FB1 A;  2D8S A;  2KYU A;  3U5P A;  2C2V S;  3PUQ A;  3HTK C;  2VPG A;  1FBV A;  3IHP A;  2JMJ A;  4AP4 A;  1HYI A;  5H9M A;  2G6Q A;  4B7Y C;  2MA6 A;  3L1Z B;  2KR4 A;  3O34 A;  5EYA F;  2MUM A;  2L75 A;  2VJF B;  2MT5 A;  4V3L C;  2CKL B;  2LDR A;  4P5O B;  3I2D A;  4LAD B;  5B75 A;  3O35 A;  1FP0 A;  4W4U A; 
#chains in the Genus database with same CATH topology
 1WEP A;  3HCT A;  5H1V A;  2YUC A;  4I7C A;  5AIU A;  3M7K A;  2L7P A;  2KWJ A;  4A4C A;  2L43 A;  2LN0 A;  3SOU A;  4GNF A;  3RPG B;  5B78 A;  4H9D A;  4QF3 A;  3ZTG A;  5LKU A;  2MNY A;  1MM3 A;  2LQ6 A;  2I50 A;  4QF2 A;  4YC9 A;  2H0D B;  3N9Q A;  2BAY A;  4A4B A;  2KU3 A;  1E4U A;  1ZBD B;  2LRI C;  5G0F A;  3O37 A;  5B77 A;  2YW8 A;  2MNZ A;  2F6J A;  2KE1 A;  1X4I A;  4F1P A;  2L80 A;  2JRJ A;  3NG2 A;  4FO9 A;  2F6N A;  5SVY A;  5TAB A;  2CSY A;  2XOC A;  2Y1M A;  4YBS A;  4ZQL A;  2QIC A;  2LXH C;  3KDE C;  2LGV A;  1WES A;  2P57 A;  2KGG A;  2KWN A;  3QZV A;  4UP5 A;  4R7E A;  4A0C D;  2KRE A;  3C6W A;  2K16 A;  2EGP A;  3U5N A;  4LLB A;  2MIQ A;  3O7A A;  1Z60 A;  5DIN A;  2KGI A;  4AYC A;  4C9Z A;  2PUY A;  2KFT A;  3GV4 A;  2XOY A;  4I7B A;  2OXQ C;  2KIZ A;  3FAN A;  4GB0 A;  5H1T A;  5DKA A;  2ZET C;  2EOD A;  4YAD A;  2CON A;  2G45 A;  5JG6 A;  1N87 A;  5G04 B;  3MDB C;  5KH7 A;  2L0B A;  1V87 A;  4F52 B;  4LJN A;  1MM2 A;  2HYE D;  2VJE B;  1RMD A;  2K1J A;  2MD7 B;  5LCW B;  3E2D A;  5TRB A;  1WEQ A;  3ZNI A;  3KQI A;  2EA6 A;  3LQI A;  2FD4 A;  3LVQ E;  5AIT A;  4AVX A;  2UZG A;  1K2F A;  3O70 A;  2ECT A;  3FEH A;  4Z0O A;  3Q1D A;  2Y43 A;  4OGE A;  2YU4 A;  4TKP B;  3SHB A;  4WA6 A;  3M99 A;  3M62 A;  5TDR A;  2M85 A;  4FIP A;  1IYM A;  5C13 A;  4V3K C;  4AUQ B;  2E6R A;  2KWO A;  3N9O A;  4N4F A;  1WEU A;  2KWK A;  2LGK A;  2FUU A;  2XEU A;  5SVI A;  5KH3 A;  2JM3 A;  3LJU X;  4R8P K;  2YSJ A;  1WEW A;  4MVT A;  3DQV R;  4X3G A;  1JM7 B;  5B76 A;  2MKE A;  1XWH A;  1WE9 A;  3DPL R;  1X4U A;  3KV6 A;  2VNF A;  2PNX A;  3ZVY A;  2JMI A;  2K17 A;  1T1H A;  3KV5 A;  2VPD A;  4GNG A;  4XI1 A;  2M6M A;  2YT5 A;  2DSM A;  2G43 A;  3ZYQ A;  3KNV A;  2CRR A;  2CRW A;  3N9M A;  4FK5 A;  1CHC A;  1WEM A;  2H0D A;  4GNE A;  1MBM A;  3LRQ A;  5J3X A;  2VPE A;  4S3O B;  3RTR B;  3N9L A;  1DCQ A;  1WGM A;  4BBQ A;  2ECI A;  1WEV A;  3ZPV 1;  3VK6 A;  2VJF A;  4B86 C;  1JM7 A;  4WZ2 A;  4O64 A;  1WEN A;  4A49 A;  4AYC B;  4N3W A;  4CA1 A;  3H7H A;  4O62 A;  1VYX A;  2RI7 A;  1LDJ B;  4ZUX U;  2VP7 A;  2EGM A;  2L5U A;  1JOC A;  4I7D A;  5B79 A;  4FJC A;  4LKA A;  2AN6 A;  2E61 A;  2FSA A;  3L11 A;  5G05 B;  2LGL A;  2B0O E;  1WEE A;  2LV9 A;  3ZVZ B;  4OGC A;  3LDY A;  2EXU A;  3MHH A;  1Z2Q A;  3FM8 C;  2YQM A;  2YSM A;  4S3O C;  5TDW A;  2C2L A;  3DDT A;  2DJA A;  3ZPV E;  2M1R A;  3L1X A;  2CSZ A;  4NN2 A;  2LGG A;  3DWD A;  3SOW A;  2DX8 A;  3N9N A;  2F42 A;  3N9P A;  4LK9 A;  4YAX A;  2ECN A;  2XP0 A;  3SUB A;  2OWA A;  4CCG X;  5TBN A;  3GL6 A;  1BOR A;  4L7X A;  3HCS A;  2FUI A;  2RSD A;  2ECJ A;  2IDA A;  4GND A;  4WZ0 A;  3FL2 A;  3JUE A;  2QJ0 A;  2QIZ A;  2FFW A;  3ASL A;  4UI9 B;  5FB0 A;  3FAO A;  1WFK A;  2NAA A;  5LKT A;  4MSX A;  2CSV A;  4QQ4 A;  1VD4 A;  1WEO A;  1Z6U A;  3T6R A;  3T7L A;  4ZDT A;  2YRE A;  4BHW A;  3PHD A;  2HDP A;  2MD8 C;  3U5O A;  5D1M B;  3O33 A;  2ECG A;  4R2Y A;  2YHN A;  2LAU A;  2YYR A;  3PUR A;  5D1L B;  2MA5 A;  2M3H A;  4YBT A;  4YBM A;  5FER A;  4Q6F A;  4YAT A;  2JMD A;  4WZ3 B;  4YAB A;  2E6S A;  5SVI B;  3C5K A;  5LKZ A;  5D1K B;  4IC3 A;  1F62 A;  4L58 A;  2JUN A;  5KH9 A;  2LXP C;  5B8D A;  2KKY A;  3T9K A;  2K4D A;  2VPB A;  2ECV A;  2YHO A;  3MHS A;  2IQJ A;  2Y1N A;  5I3L A;  3LQH A;  1X4J A;  2D8U A;  4PTB A;  3V43 A;  5C11 A;  3LVR E;  4PPE A;  3M63 A;  1WIL A;  1U6G B;  3SOX A;  2KKX A;  1VFY A;  4UP0 A;  2RR4 A;  2CT2 A;  1WIM A;  2VJE A;  1DVP A;  3EB6 A;  3RPG C;  3EB5 A;  3LQJ A;  2M13 A;  1LDK C;  1HYJ A;  1G25 A;  4IC2 A;  3U5M A;  2CKL A;  3FJU B;  3HCU A;  5K3Q A;  2YUR A;  2XB1 A;  3O36 A;  2ECW A;  5FEY A;  5H1U A;  5LKX A;  2YQL A;  5FB1 A;  2D8S A;  2KYU A;  3U5P A;  2C2V S;  3PUQ A;  3HTK C;  2VPG A;  3O47 A;  3PLW A;  1FBV A;  3IHP A;  2JMJ A;  5SVX A;  4AP4 A;  1HYI A;  2YVR A;  5H9M A;  2G6Q A;  4B7Y C;  2MA6 A;  3L1Z B;  2KR4 A;  3O34 A;  5EYA F;  2MUM A;  2L75 A;  2VJF B;  2MT5 A;  2XOZ A;  4V3L C;  2CKL B;  2LDR A;  4P5O B;  3I2D A;  4Z0R A;  4LAD B;  5B75 A;  3O35 A;  1FP0 A;  4W4U A; 
#chains in the Genus database with same CATH homology
 1WEP A;  3HCT A;  5H1V A;  2YUC A;  4I7C A;  5AIU A;  2KWJ A;  4A4C A;  2L43 A;  2LN0 A;  3SOU A;  4GNF A;  3RPG B;  5B78 A;  4QF3 A;  3ZTG A;  5LKU A;  2MNY A;  1MM3 A;  2LQ6 A;  2I50 A;  4QF2 A;  4YC9 A;  2H0D B;  3N9Q A;  2BAY A;  4A4B A;  2KU3 A;  1E4U A;  1ZBD B;  2LRI C;  5G0F A;  3O37 A;  5B77 A;  2YW8 A;  2MNZ A;  2F6J A;  2KE1 A;  1X4I A;  2L80 A;  2JRJ A;  3NG2 A;  4FO9 A;  2F6N A;  5TAB A;  2CSY A;  2Y1M A;  4YBS A;  4ZQL A;  2QIC A;  2LXH C;  2LGV A;  1WES A;  2KGG A;  2KWN A;  3QZV A;  4UP5 A;  4R7E A;  4A0C D;  2KRE A;  3C6W A;  2K16 A;  2EGP A;  3U5N A;  4LLB A;  2MIQ A;  3O7A A;  1Z60 A;  5DIN A;  2KGI A;  4AYC A;  4C9Z A;  2PUY A;  2KFT A;  3GV4 A;  4I7B A;  2OXQ C;  2KIZ A;  4GB0 A;  5H1T A;  5DKA A;  2ZET C;  2EOD A;  4YAD A;  2G45 A;  5JG6 A;  1N87 A;  5G04 B;  5KH7 A;  2L0B A;  1V87 A;  4F52 B;  4LJN A;  1MM2 A;  2HYE D;  2VJE B;  1RMD A;  2K1J A;  2MD7 B;  5LCW B;  5TRB A;  1WEQ A;  3ZNI A;  3KQI A;  2EA6 A;  3LQI A;  5AIT A;  4AVX A;  2UZG A;  1K2F A;  3O70 A;  2ECT A;  2Y43 A;  2YU4 A;  4TKP B;  3SHB A;  4WA6 A;  3M99 A;  3M62 A;  5TDR A;  2M85 A;  4FIP A;  1IYM A;  5C13 A;  4V3K C;  4AUQ B;  2E6R A;  2KWO A;  3N9O A;  4N4F A;  1WEU A;  2KWK A;  2LGK A;  2FUU A;  2XEU A;  5KH3 A;  4R8P K;  2YSJ A;  1WEW A;  4MVT A;  3DQV R;  4X3G A;  1JM7 B;  5B76 A;  1XWH A;  1WE9 A;  3DPL R;  1X4U A;  3KV6 A;  2VNF A;  2PNX A;  3ZVY A;  2JMI A;  2K17 A;  1T1H A;  3KV5 A;  2VPD A;  4GNG A;  4XI1 A;  2M6M A;  2YT5 A;  2G43 A;  3ZYQ A;  3KNV A;  3N9M A;  4FK5 A;  1CHC A;  1WEM A;  2H0D A;  4GNE A;  3LRQ A;  5J3X A;  2VPE A;  4S3O B;  3RTR B;  3N9L A;  1WGM A;  4BBQ A;  2ECI A;  1WEV A;  3ZPV 1;  3VK6 A;  2VJF A;  4B86 C;  1JM7 A;  4WZ2 A;  4O64 A;  1WEN A;  4A49 A;  4AYC B;  4N3W A;  4CA1 A;  1VYX A;  2RI7 A;  1LDJ B;  4ZUX U;  2VP7 A;  2L5U A;  1JOC A;  4I7D A;  5B79 A;  4FJC A;  4LKA A;  2AN6 A;  2FSA A;  3L11 A;  2LGL A;  5G05 B;  1WEE A;  2LV9 A;  3ZVZ B;  3MHH A;  1Z2Q A;  2YQM A;  2YSM A;  5TDW A;  4S3O C;  2C2L A;  3ZPV E;  2M1R A;  3L1X A;  2CSZ A;  4NN2 A;  2LGG A;  3SOW A;  2DX8 A;  3N9N A;  2F42 A;  3N9P A;  4LK9 A;  4YAX A;  2ECN A;  4CCG X;  5TBN A;  3GL6 A;  1BOR A;  4L7X A;  3HCS A;  2FUI A;  2RSD A;  2ECJ A;  2IDA A;  4GND A;  4WZ0 A;  3FL2 A;  2QJ0 A;  2QIZ A;  3ASL A;  4UI9 B;  5FB0 A;  1WFK A;  2NAA A;  5LKT A;  4MSX A;  1VD4 A;  1WEO A;  1Z6U A;  3T6R A;  3T7L A;  4ZDT A;  2YRE A;  4BHW A;  3PHD A;  2HDP A;  2MD8 C;  3U5O A;  5D1M B;  3O33 A;  2ECG A;  4R2Y A;  2YHN A;  2YYR A;  3PUR A;  5D1L B;  2MA5 A;  2M3H A;  4YBT A;  4YBM A;  5FER A;  4Q6F A;  4YAT A;  2JMD A;  4WZ3 B;  4YAB A;  2E6S A;  3C5K A;  5LKZ A;  5D1K B;  4IC3 A;  1F62 A;  4L58 A;  5KH9 A;  2LXP C;  5B8D A;  2K4D A;  2VPB A;  2ECV A;  2YHO A;  3MHS A;  2Y1N A;  5I3L A;  3LQH A;  1X4J A;  4PTB A;  3V43 A;  5C11 A;  4PPE A;  3M63 A;  1WIL A;  1U6G B;  3SOX A;  1VFY A;  4UP0 A;  2CT2 A;  1WIM A;  2VJE A;  1DVP A;  3EB6 A;  3RPG C;  3EB5 A;  3LQJ A;  1LDK C;  1HYJ A;  1G25 A;  4IC2 A;  3U5M A;  2CKL A;  3HCU A;  2YUR A;  2XB1 A;  3O36 A;  2ECW A;  5FEY A;  5H1U A;  5LKX A;  2YQL A;  5FB1 A;  2D8S A;  2KYU A;  3U5P A;  2C2V S;  3PUQ A;  3HTK C;  2VPG A;  1FBV A;  3IHP A;  2JMJ A;  4AP4 A;  1HYI A;  5H9M A;  2G6Q A;  4B7Y C;  2MA6 A;  3L1Z B;  2KR4 A;  3O34 A;  5EYA F;  2MUM A;  2L75 A;  2VJF B;  2MT5 A;  4V3L C;  2CKL B;  2LDR A;  4P5O B;  3I2D A;  4LAD B;  5B75 A;  3O35 A;  1FP0 A;  4W4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...