5TDRA

Set3 phd finger in complex with histone h3k4me2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MGIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET domain-containing protein 3
publication title Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transcription
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tdrA00
2KREA 4IC2A 2YHNA 1WEVA 2CSYA 4I7BA 3N9OA 2VJEA 5H1VA 2KE1A 4F52B 5B8DA 4FJCA 3DPLR 4O64A 3ZPV1 4B86C 3O70A 2LDRA 2D8SA 5TDRA 2QIZA 3QZVA 3ZVYA 5FERA 2Y1MA 2VJEB 2VNFA 3EB6A 5TABA 5KH3A 2LGVA 2MNYA 2YURA 2H0DB 1VYXA 3M63A 4R8PK 2RI7A 2EA6A 5J3XA 4ZDTA 4GNEA 2YSJA 2YHOA 3U5OA 4V3KC 3ZYQA 2L75A 2HDPA 4X3GA 5I3LA 1WE9A 3N9PA 5KH9A 3LQHA 5H9MA 4YBSA 1G25A 4GNFA 2EODA 4FK5A 4LADB 5FEYA 5C11A 1XWHA 4GNDA 4W4UA 2XEUA 4L58A 1WEWA 2UZGA 2ECIA 2MD8C 2LV9A 5LKZA 4A0CD 2M6MA 5FB0A 4FIPA 2C2LA 3PUQA 2K16A 3MHSA 1X4JA 4P5OB 1ZBDB 3N9LA 5D1MB 2MD7B 2Y43A 1FP0A 3HCSA 1JM7A 4YC9A 4V3LC 1RMDA 2KIZA 1U6GB 4B7YC 5B77A 2VJFA 3KV6A 3EB5A 3ZNIA 2XB1A 2F6JA 4TKPB 4ZUXU 1Z2QA 1WEQA 2LN0A 2F42A 1JM7B 2ECVA 1CHCA 4I7CA 1LDKC 3PURA 4Q6FA 2VJFB 4FO9A 2VPEA 2K4DA 1WEOA 3ASLA 5DKAA 2YQLA 3LRQA 1HYIA 2LRIC 2ECTA 5G04B 4A49A 4UI9B 3RTRB 2LXPC 1DVPA 4WZ2A 3O34A 3KQIA 2KR4A 1WEMA 2H0DA 2BAYA 2OXQC 3M99A 3ZPVE 4UP0A 1Z60A 3O33A 2NAAA 5G05B 1LDJB 2YYRA 4A4CA 4A4BA 2K1JA 3C6WA 3U5MA 1E4UA 3O35A 1X4UA 1JOCA 3GV4A 5B75A 1BORA 5AIUA 2ZETC 2G43A 4IC3A 4MSXA 2MA6A 3U5NA 2KU3A 2IDAA 2E6SA 2ECJA 3O37A 3SOUA 3L1ZB 4YATA 5H1UA 3MHHA 4S3OC 2E6RA 2LGLA 4YBMA 2C2VS 5D1KB 2JRJA 4CCGX 4L7XA 3IHPA 1F62A 4R2YA 4LK9A 2M1RA 4WZ3B 4C9ZA 2YW8A 1FBVA 2QJ0A 5DINA 4YAXA 3L11A 2MIQA 1WFKA 4LLBA 5B78A 4YABA 4PPEA 5TDWA 2PUYA 4WA6A 4AVXA 2ECNA 2KFTA 5FB1A 1WENA 4UP5A 3LQJA 2VPBA 4N4FA 3O7AA 2KWOA 2LGGA 5C13A 4I7DA 3V43A 2QICA 2EGPA 2CKLB 4YADA 2JMIA 2YUCA 2MUMA 4CA1A 5LKXA 2M3HA 2YSMA 4S3OB 2MNZA 2KWJA 2KGGA 2ECWA 4PTBA 2VPGA 4BBQA 4QF3A 1WEUA 2VPDA 3RPGC 4AUQB 1VD4A 3O36A 3KV5A 3M62A 3N9MA 3C5KA 2KWNA 3HCUA 2G6QA 2LQ6A 2YU4A 1Z6UA 1WIMA 5B76A 4LJNA 4ZQLA 3SOXA 1N87A 5TRBA 2VP7A 2M85A 2MA5A 4XI1A 2MT5A 2L43A 1WESA 5JG6A 2YT5A 5G0FA 2CT2A 4YBTA 3SHBA 3U5PA 2Y1NA 2KWKA 1VFYA 3HTKC 5KH7A 4AP4A 1WILA 5AITA 4N3WA 5H1TA 2ECGA 1HYJA 5D1LB 1IYMA 4BHWA 2YQMA 2I50A 1WEPA 3L1XA 2FUUA 2F6NA 2L5UA 2KYUA 2DX8A 5LKTA 4AYCA 2CSZA 4WZ0A 2JMDA 2LGKA 2AN6A 3ZVZB 3RPGB 3KNVA 4R7EA 3T6RA 5TBNA 3GL6A 4GB0A 5B79A 3SOWA 4LKAA 3FL2A 1MM2A 2CKLA 4AYCB 2LXHC 5LKUA 4NN2A 2FSAA 3T7LA 5LCWB 1K2FA 4MVTA 2YREA 3VK6A 3PHDA 2L80A 1WEEA 2RSDA 1MM3A 4QF2A 1V87A 2L0BA 2PNXA 2FUIA 3HCTA 2HYED 3NG2A 3ZTGA 3N9NA 3LQIA 3I2DA 2G45A 1X4IA 3DQVR 4GNGA 5EYAF 2KGIA 1T1HA 3N9QA 2JMJA 1WGMA 2K17A
chains in the Genus database with same CATH superfamily
2KREA 4IC2A 2YHNA 1WEVA 2CSYA 2JM3A 4I7BA 3N9OA 2VJEA 4O62A 5H1VA 2P57A 2KE1A 4F52B 5B8DA 4FJCA 3DPLR 4O64A 3ZPV1 2KKXA 3M7KA 4B86C 3O70A 2LDRA 2D8SA 5TDRA 2QIZA 3QZVA 3ZVYA 5FERA 2Y1MA 2FD4A 2VJEB 2VNFA 3EB6A 5TABA 5KH3A 2LGVA 2MNYA 2YURA 2H0DB 3O47A 1VYXA 3M63A 4R8PK 2RI7A 2EA6A 5J3XA 4ZDTA 3FANA 2YSJA 4GNEA 5SVYA 2YHOA 3U5OA 4V3KC 3ZYQA 2L75A 2HDPA 4X3GA 5I3LA 1WE9A 3N9PA 5KH9A 3LQHA 5H9MA 5K3QA 4YBSA 1G25A 4GNFA 2EODA 4FK5A 4LADB 2XOYA 5FEYA 5C11A 1XWHA 4GNDA 4W4UA 2XEUA 4L58A 1WEWA 2UZGA 2ECIA 2MD8C 2LV9A 5LKZA 4A0CD 2M6MA 5FB0A 4FIPA 2C2LA 3PUQA 2K16A 3MHSA 1X4JA 4P5OB 1ZBDB 3N9LA 5D1MB 2MD7B 2Y43A 1FP0A 1MBMA 3HCSA 1JM7A 4YC9A 4V3LC 1RMDA 2KIZA 1U6GB 4B7YC 5B77A 2VJFA 3KV6A 3EB5A 3ZNIA 2XB1A 2KKYA 2F6JA 4TKPB 4ZUXU 1Z2QA 1WEQA 2LN0A 2F42A 1JM7B 2ECVA 1CHCA 4I7CA 1LDKC 2OWAA 3PURA 4Q6FA 2VJFB 4FO9A 4OGEA 2VPEA 2K4DA 1WEOA 3ASLA 5DKAA 2YQLA 3LRQA 1HYIA 2LRIC 2ECTA 5G04B 4A49A 4UI9B 3RTRB 2LXPC 1DVPA 4WZ2A 3O34A 3KQIA 2KR4A 1WEMA 2H0DA 2BAYA 2OXQC 3M99A 3MDBC 3ZPVE 3E2DA 1Z60A 4UP0A 3O33A 2CRRA 2NAAA 5G05B 1LDJB 2YYRA 4A4CA 4A4BA 2K1JA 3C6WA 3U5MA 1E4UA 3O35A 1X4UA 1JOCA 3GV4A 5B75A 1BORA 5AIUA 2ZETC 2G43A 4OGCA 4IC3A 4F1PA 4MSXA 2MA6A 3U5NA 2MKEA 2KU3A 2IDAA 2E6SA 2ECJA 3O37A 3SOUA 3L1ZB 4YATA 5H1UA 3MHHA 4S3OC 2E6RA 2LGLA 4YBMA 2C2VS 5D1KB 2JRJA 5SVIB 3FAOA 3FM8C 2DJAA 2RR4A 4CCGX 4L7XA 3IHPA 1F62A 4R2YA 4LK9A 2M1RA 4WZ3B 4C9ZA 2YW8A 1FBVA 2QJ0A 5DINA 4YAXA 3L11A 2MIQA 1WFKA 3DWDA 4LLBA 5B78A 3Q1DA 4YABA 2CONA 4PPEA 5TDWA 2PUYA 4WA6A 4AVXA 2ECNA 2KFTA 5FB1A 1WENA 5SVXA 2CRWA 4UP5A 3LQJA 2VPBA 4N4FA 3O7AA 2M13A 2KWOA 2LGGA 5C13A 2B0OE 2D8UA 4I7DA 3V43A 2QICA 2EGPA 3LVRE 2CKLB 4YADA 2JMIA 2YUCA 2MUMA 4CA1A 3H7HA 5LKXA 2EXUA 2M3HA 2YSMA 4S3OB 2MNZA 2XP0A 2KWJA 2KGGA 3DDTA 3LDYA 4Z0RA 2ECWA 4PTBA 2FFWA 2VPGA 4BBQA 4QF3A 1WEUA 3LJUX 2VPDA 2DSMA 3RPGC 4AUQB 1VD4A 3O36A 3KV5A 3M62A 3N9MA 3C5KA 2KWNA 3HCUA 2XOZA 2G6QA 2LQ6A 2YU4A 1Z6UA 1WIMA 5B76A 2YVRA 3FJUB 4LJNA 4ZQLA 3SOXA 1N87A 5TRBA 2VP7A 2M85A 2MA5A 4XI1A 2MT5A 2L43A 1WESA 4QQ4A 3JUEA 5JG6A 5SVIA 2YT5A 5G0FA 2CT2A 4YBTA 3SHBA 3U5PA 2Y1NA 2KWKA 1VFYA 3HTKC 3LVQE 5KH7A 4AP4A 1WILA 5AITA 4N3WA 5H1TA 2ECGA 1HYJA 5D1LB 4Z0OA 1IYMA 4BHWA 2YQMA 2I50A 1WEPA 3L1XA 3T9KA 2FUUA 2CSVA 2F6NA 2L5UA 2KYUA 3KDEC 2DX8A 5LKTA 4AYCA 2CSZA 4WZ0A 2JMDA 2LGKA 2AN6A 3ZVZB 3RPGB 3KNVA 4R7EA 2JUNA 2IQJA 3T6RA 5TBNA 1DCQA 3GL6A 2EGMA 4GB0A 4H9DA 5B79A 3SOWA 4LKAA 3FL2A 3PLWA 1MM2A 2LAUA 2CKLA 4AYCB 2LXHC 5LKUA 4NN2A 2E61A 2FSAA 3T7LA 5LCWB 1K2FA 4MVTA 2YREA 2L7PA 3VK6A 3PHDA 2L80A 1WEEA 2RSDA 3FEHA 1MM3A 4QF2A 1V87A 2L0BA 2PNXA 2FUIA 3HCTA 2HYED 2XOCA 3SUBA 3NG2A 3ZTGA 3N9NA 3LQIA 3I2DA 2G45A 1X4IA 3DQVR 4GNGA 5EYAF 2KGIA 1T1HA 3N9QA 2JMJA 1WGMA 2K17A
chains in the Genus database with same CATH topology
2KREA 4IC2A 2YHNA 1WEVA 2CSYA 4I7BA 3N9OA 2VJEA 5H1VA 2KE1A 4F52B 5B8DA 4FJCA 3DPLR 4O64A 3ZPV1 4B86C 3O70A 2LDRA 2D8SA 5TDRA 2QIZA 3QZVA 3ZVYA 5FERA 2Y1MA 2VJEB 2VNFA 3EB6A 5TABA 5KH3A 2LGVA 2MNYA 2YURA 2H0DB 1VYXA 3M63A 4R8PK 2RI7A 2EA6A 5J3XA 4ZDTA 4GNEA 2YSJA 2YHOA 3U5OA 4V3KC 3ZYQA 2L75A 2HDPA 4X3GA 5I3LA 1WE9A 3N9PA 5KH9A 3LQHA 5H9MA 4YBSA 1G25A 4GNFA 2EODA 4FK5A 4LADB 5FEYA 5C11A 1XWHA 4GNDA 4W4UA 2XEUA 4L58A 1WEWA 2UZGA 2ECIA 2MD8C 2LV9A 5LKZA 4A0CD 2M6MA 5FB0A 4FIPA 2C2LA 3PUQA 2K16A 3MHSA 1X4JA 4P5OB 1ZBDB 3N9LA 5D1MB 2MD7B 2Y43A 1FP0A 3HCSA 1JM7A 4YC9A 4V3LC 1RMDA 2KIZA 1U6GB 4B7YC 5B77A 2VJFA 3KV6A 3EB5A 3ZNIA 2XB1A 2F6JA 4TKPB 4ZUXU 1Z2QA 1WEQA 2LN0A 2F42A 1JM7B 2ECVA 1CHCA 4I7CA 1LDKC 3PURA 4Q6FA 2VJFB 4FO9A 2VPEA 2K4DA 1WEOA 3ASLA 5DKAA 2YQLA 3LRQA 1HYIA 2LRIC 2ECTA 5G04B 4A49A 4UI9B 3RTRB 2LXPC 1DVPA 4WZ2A 3O34A 3KQIA 2KR4A 1WEMA 2H0DA 2BAYA 2OXQC 3M99A 3ZPVE 4UP0A 1Z60A 3O33A 2NAAA 5G05B 1LDJB 2YYRA 4A4CA 4A4BA 2K1JA 3C6WA 3U5MA 1E4UA 3O35A 1X4UA 1JOCA 3GV4A 5B75A 1BORA 5AIUA 2ZETC 2G43A 4IC3A 4MSXA 2MA6A 3U5NA 2KU3A 2IDAA 2E6SA 2ECJA 3O37A 3SOUA 3L1ZB 4YATA 5H1UA 3MHHA 4S3OC 2E6RA 2LGLA 4YBMA 2C2VS 5D1KB 2JRJA 4CCGX 4L7XA 3IHPA 1F62A 4R2YA 4LK9A 2M1RA 4WZ3B 4C9ZA 2YW8A 1FBVA 2QJ0A 5DINA 4YAXA 3L11A 2MIQA 1WFKA 4LLBA 5B78A 4YABA 4PPEA 5TDWA 2PUYA 4WA6A 4AVXA 2ECNA 2KFTA 5FB1A 1WENA 4UP5A 3LQJA 2VPBA 4N4FA 3O7AA 2KWOA 2LGGA 5C13A 4I7DA 3V43A 2QICA 2EGPA 2CKLB 4YADA 2JMIA 2YUCA 2MUMA 4CA1A 5LKXA 2M3HA 2YSMA 4S3OB 2MNZA 2KWJA 2KGGA 2ECWA 4PTBA 2VPGA 4BBQA 4QF3A 1WEUA 2VPDA 3RPGC 4AUQB 1VD4A 3O36A 3KV5A 3M62A 3N9MA 3C5KA 2KWNA 3HCUA 2G6QA 2LQ6A 2YU4A 1Z6UA 1WIMA 5B76A 4LJNA 4ZQLA 3SOXA 1N87A 5TRBA 2VP7A 2M85A 2MA5A 4XI1A 2MT5A 2L43A 1WESA 5JG6A 2YT5A 5G0FA 2CT2A 4YBTA 3SHBA 3U5PA 2Y1NA 2KWKA 1VFYA 3HTKC 5KH7A 4AP4A 1WILA 5AITA 4N3WA 5H1TA 2ECGA 1HYJA 5D1LB 1IYMA 4BHWA 2YQMA 2I50A 1WEPA 3L1XA 2FUUA 2F6NA 2L5UA 2KYUA 2DX8A 5LKTA 4AYCA 2CSZA 4WZ0A 2JMDA 2LGKA 2AN6A 3ZVZB 3RPGB 3KNVA 4R7EA 3T6RA 5TBNA 3GL6A 4GB0A 5B79A 3SOWA 4LKAA 3FL2A 1MM2A 2CKLA 4AYCB 2LXHC 5LKUA 4NN2A 2FSAA 3T7LA 5LCWB 1K2FA 4MVTA 2YREA 3VK6A 3PHDA 2L80A 1WEEA 2RSDA 1MM3A 4QF2A 1V87A 2L0BA 2PNXA 2FUIA 3HCTA 2HYED 3NG2A 3ZTGA 3N9NA 3LQIA 3I2DA 2G45A 1X4IA 3DQVR 4GNGA 5EYAF 2KGIA 1T1HA 3N9QA 2JMJA 1WGMA 2K17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRE A;  4IC2 A;  2YHN A;  1WEV A;  2CSY A;  4I7B A;  3N9O A;  2VJE A;  5H1V A;  2KE1 A;  4F52 B;  5B8D A;  4FJC A;  3DPL R;  4O64 A;  3ZPV 1;  4B86 C;  3O70 A;  2LDR A;  2D8S A;  5TDR A;  2QIZ A;  3QZV A;  3ZVY A;  5FER A;  2Y1M A;  2VJE B;  2VNF A;  3EB6 A;  5TAB A;  5KH3 A;  2LGV A;  2MNY A;  2YUR A;  2H0D B;  1VYX A;  3M63 A;  4R8P K;  2RI7 A;  2EA6 A;  5J3X A;  4ZDT A;  4GNE A;  2YSJ A;  2YHO A;  3U5O A;  4V3K C;  3ZYQ A;  2L75 A;  2HDP A;  4X3G A;  5I3L A;  1WE9 A;  3N9P A;  5KH9 A;  3LQH A;  5H9M A;  4YBS A;  1G25 A;  4GNF A;  2EOD A;  4FK5 A;  4LAD B;  5FEY A;  5C11 A;  1XWH A;  4GND A;  4W4U A;  2XEU A;  4L58 A;  1WEW A;  2UZG A;  2ECI A;  2MD8 C;  2LV9 A;  5LKZ A;  4A0C D;  2M6M A;  5FB0 A;  4FIP A;  2C2L A;  3PUQ A;  2K16 A;  3MHS A;  1X4J A;  4P5O B;  1ZBD B;  3N9L A;  5D1M B;  2MD7 B;  2Y43 A;  1FP0 A;  3HCS A;  1JM7 A;  4YC9 A;  4V3L C;  1RMD A;  2KIZ A;  1U6G B;  4B7Y C;  5B77 A;  2VJF A;  3KV6 A;  3EB5 A;  3ZNI A;  2XB1 A;  2F6J A;  4TKP B;  4ZUX U;  1Z2Q A;  1WEQ A;  2LN0 A;  2F42 A;  1JM7 B;  2ECV A;  1CHC A;  4I7C A;  1LDK C;  3PUR A;  4Q6F A;  2VJF B;  4FO9 A;  2VPE A;  2K4D A;  1WEO A;  3ASL A;  5DKA A;  2YQL A;  3LRQ A;  1HYI A;  2LRI C;  2ECT A;  5G04 B;  4A49 A;  4UI9 B;  3RTR B;  2LXP C;  1DVP A;  4WZ2 A;  3O34 A;  3KQI A;  2KR4 A;  1WEM A;  2H0D A;  2BAY A;  2OXQ C;  3M99 A;  3ZPV E;  4UP0 A;  1Z60 A;  3O33 A;  2NAA A;  5G05 B;  1LDJ B;  2YYR A;  4A4C A;  4A4B A;  2K1J A;  3C6W A;  3U5M A;  1E4U A;  3O35 A;  1X4U A;  1JOC A;  3GV4 A;  5B75 A;  1BOR A;  5AIU A;  2ZET C;  2G43 A;  4IC3 A;  4MSX A;  2MA6 A;  3U5N A;  2KU3 A;  2IDA A;  2E6S A;  2ECJ A;  3O37 A;  3SOU A;  3L1Z B;  4YAT A;  5H1U A;  3MHH A;  4S3O C;  2E6R A;  2LGL A;  4YBM A;  2C2V S;  5D1K B;  2JRJ A;  4CCG X;  4L7X A;  3IHP A;  1F62 A;  4R2Y A;  4LK9 A;  2M1R A;  4WZ3 B;  4C9Z A;  2YW8 A;  1FBV A;  2QJ0 A;  5DIN A;  4YAX A;  3L11 A;  2MIQ A;  1WFK A;  4LLB A;  5B78 A;  4YAB A;  4PPE A;  5TDW A;  2PUY A;  4WA6 A;  4AVX A;  2ECN A;  2KFT A;  5FB1 A;  1WEN A;  4UP5 A;  3LQJ A;  2VPB A;  4N4F A;  3O7A A;  2KWO A;  2LGG A;  5C13 A;  4I7D A;  3V43 A;  2QIC A;  2EGP A;  2CKL B;  4YAD A;  2JMI A;  2YUC A;  2MUM A;  4CA1 A;  5LKX A;  2M3H A;  2YSM A;  4S3O B;  2MNZ A;  2KWJ A;  2KGG A;  2ECW A;  4PTB A;  2VPG A;  4BBQ A;  4QF3 A;  1WEU A;  2VPD A;  3RPG C;  4AUQ B;  1VD4 A;  3O36 A;  3KV5 A;  3M62 A;  3N9M A;  3C5K A;  2KWN A;  3HCU A;  2G6Q A;  2LQ6 A;  2YU4 A;  1Z6U A;  1WIM A;  5B76 A;  4LJN A;  4ZQL A;  3SOX A;  1N87 A;  5TRB A;  2VP7 A;  2M85 A;  2MA5 A;  4XI1 A;  2MT5 A;  2L43 A;  1WES A;  5JG6 A;  2YT5 A;  5G0F A;  2CT2 A;  4YBT A;  3SHB A;  3U5P A;  2Y1N A;  2KWK A;  1VFY A;  3HTK C;  5KH7 A;  4AP4 A;  1WIL A;  5AIT A;  4N3W A;  5H1T A;  2ECG A;  1HYJ A;  5D1L B;  1IYM A;  4BHW A;  2YQM A;  2I50 A;  1WEP A;  3L1X A;  2FUU A;  2F6N A;  2L5U A;  2KYU A;  2DX8 A;  5LKT A;  4AYC A;  2CSZ A;  4WZ0 A;  2JMD A;  2LGK A;  2AN6 A;  3ZVZ B;  3RPG B;  3KNV A;  4R7E A;  3T6R A;  5TBN A;  3GL6 A;  4GB0 A;  5B79 A;  3SOW A;  4LKA A;  3FL2 A;  1MM2 A;  2CKL A;  4AYC B;  2LXH C;  5LKU A;  4NN2 A;  2FSA A;  3T7L A;  5LCW B;  1K2F A;  4MVT A;  2YRE A;  3VK6 A;  3PHD A;  2L80 A;  1WEE A;  2RSD A;  1MM3 A;  4QF2 A;  1V87 A;  2L0B A;  2PNX A;  2FUI A;  3HCT A;  2HYE D;  3NG2 A;  3ZTG A;  3N9N A;  3LQI A;  3I2D A;  2G45 A;  1X4I A;  3DQV R;  4GNG A;  5EYA F;  2KGI A;  1T1H A;  3N9Q A;  2JMJ A;  1WGM A;  2K17 A; 
#chains in the Genus database with same CATH topology
 2KRE A;  4IC2 A;  2YHN A;  1WEV A;  2CSY A;  2JM3 A;  4I7B A;  3N9O A;  2VJE A;  4O62 A;  5H1V A;  2P57 A;  2KE1 A;  4F52 B;  5B8D A;  4FJC A;  3DPL R;  4O64 A;  3ZPV 1;  2KKX A;  3M7K A;  4B86 C;  3O70 A;  2LDR A;  2D8S A;  5TDR A;  2QIZ A;  3QZV A;  3ZVY A;  5FER A;  2Y1M A;  2FD4 A;  2VJE B;  2VNF A;  3EB6 A;  5TAB A;  5KH3 A;  2LGV A;  2MNY A;  2YUR A;  2H0D B;  3O47 A;  1VYX A;  3M63 A;  4R8P K;  2RI7 A;  2EA6 A;  5J3X A;  4ZDT A;  3FAN A;  2YSJ A;  4GNE A;  5SVY A;  2YHO A;  3U5O A;  4V3K C;  3ZYQ A;  2L75 A;  2HDP A;  4X3G A;  5I3L A;  1WE9 A;  3N9P A;  5KH9 A;  3LQH A;  5H9M A;  5K3Q A;  4YBS A;  1G25 A;  4GNF A;  2EOD A;  4FK5 A;  4LAD B;  2XOY A;  5FEY A;  5C11 A;  1XWH A;  4GND A;  4W4U A;  2XEU A;  4L58 A;  1WEW A;  2UZG A;  2ECI A;  2MD8 C;  2LV9 A;  5LKZ A;  4A0C D;  2M6M A;  5FB0 A;  4FIP A;  2C2L A;  3PUQ A;  2K16 A;  3MHS A;  1X4J A;  4P5O B;  1ZBD B;  3N9L A;  5D1M B;  2MD7 B;  2Y43 A;  1FP0 A;  1MBM A;  3HCS A;  1JM7 A;  4YC9 A;  4V3L C;  1RMD A;  2KIZ A;  1U6G B;  4B7Y C;  5B77 A;  2VJF A;  3KV6 A;  3EB5 A;  3ZNI A;  2XB1 A;  2KKY A;  2F6J A;  4TKP B;  4ZUX U;  1Z2Q A;  1WEQ A;  2LN0 A;  2F42 A;  1JM7 B;  2ECV A;  1CHC A;  4I7C A;  1LDK C;  2OWA A;  3PUR A;  4Q6F A;  2VJF B;  4FO9 A;  4OGE A;  2VPE A;  2K4D A;  1WEO A;  3ASL A;  5DKA A;  2YQL A;  3LRQ A;  1HYI A;  2LRI C;  2ECT A;  5G04 B;  4A49 A;  4UI9 B;  3RTR B;  2LXP C;  1DVP A;  4WZ2 A;  3O34 A;  3KQI A;  2KR4 A;  1WEM A;  2H0D A;  2BAY A;  2OXQ C;  3M99 A;  3MDB C;  3ZPV E;  3E2D A;  1Z60 A;  4UP0 A;  3O33 A;  2CRR A;  2NAA A;  5G05 B;  1LDJ B;  2YYR A;  4A4C A;  4A4B A;  2K1J A;  3C6W A;  3U5M A;  1E4U A;  3O35 A;  1X4U A;  1JOC A;  3GV4 A;  5B75 A;  1BOR A;  5AIU A;  2ZET C;  2G43 A;  4OGC A;  4IC3 A;  4F1P A;  4MSX A;  2MA6 A;  3U5N A;  2MKE A;  2KU3 A;  2IDA A;  2E6S A;  2ECJ A;  3O37 A;  3SOU A;  3L1Z B;  4YAT A;  5H1U A;  3MHH A;  4S3O C;  2E6R A;  2LGL A;  4YBM A;  2C2V S;  5D1K B;  2JRJ A;  5SVI B;  3FAO A;  3FM8 C;  2DJA A;  2RR4 A;  4CCG X;  4L7X A;  3IHP A;  1F62 A;  4R2Y A;  4LK9 A;  2M1R A;  4WZ3 B;  4C9Z A;  2YW8 A;  1FBV A;  2QJ0 A;  5DIN A;  4YAX A;  3L11 A;  2MIQ A;  1WFK A;  3DWD A;  4LLB A;  5B78 A;  3Q1D A;  4YAB A;  2CON A;  4PPE A;  5TDW A;  2PUY A;  4WA6 A;  4AVX A;  2ECN A;  2KFT A;  5FB1 A;  1WEN A;  5SVX A;  2CRW A;  4UP5 A;  3LQJ A;  2VPB A;  4N4F A;  3O7A A;  2M13 A;  2KWO A;  2LGG A;  5C13 A;  2B0O E;  2D8U A;  4I7D A;  3V43 A;  2QIC A;  2EGP A;  3LVR E;  2CKL B;  4YAD A;  2JMI A;  2YUC A;  2MUM A;  4CA1 A;  3H7H A;  5LKX A;  2EXU A;  2M3H A;  2YSM A;  4S3O B;  2MNZ A;  2XP0 A;  2KWJ A;  2KGG A;  3DDT A;  3LDY A;  4Z0R A;  2ECW A;  4PTB A;  2FFW A;  2VPG A;  4BBQ A;  4QF3 A;  1WEU A;  3LJU X;  2VPD A;  2DSM A;  3RPG C;  4AUQ B;  1VD4 A;  3O36 A;  3KV5 A;  3M62 A;  3N9M A;  3C5K A;  2KWN A;  3HCU A;  2XOZ A;  2G6Q A;  2LQ6 A;  2YU4 A;  1Z6U A;  1WIM A;  5B76 A;  2YVR A;  3FJU B;  4LJN A;  4ZQL A;  3SOX A;  1N87 A;  5TRB A;  2VP7 A;  2M85 A;  2MA5 A;  4XI1 A;  2MT5 A;  2L43 A;  1WES A;  4QQ4 A;  3JUE A;  5JG6 A;  5SVI A;  2YT5 A;  5G0F A;  2CT2 A;  4YBT A;  3SHB A;  3U5P A;  2Y1N A;  2KWK A;  1VFY A;  3HTK C;  3LVQ E;  5KH7 A;  4AP4 A;  1WIL A;  5AIT A;  4N3W A;  5H1T A;  2ECG A;  1HYJ A;  5D1L B;  4Z0O A;  1IYM A;  4BHW A;  2YQM A;  2I50 A;  1WEP A;  3L1X A;  3T9K A;  2FUU A;  2CSV A;  2F6N A;  2L5U A;  2KYU A;  3KDE C;  2DX8 A;  5LKT A;  4AYC A;  2CSZ A;  4WZ0 A;  2JMD A;  2LGK A;  2AN6 A;  3ZVZ B;  3RPG B;  3KNV A;  4R7E A;  2JUN A;  2IQJ A;  3T6R A;  5TBN A;  1DCQ A;  3GL6 A;  2EGM A;  4GB0 A;  4H9D A;  5B79 A;  3SOW A;  4LKA A;  3FL2 A;  3PLW A;  1MM2 A;  2LAU A;  2CKL A;  4AYC B;  2LXH C;  5LKU A;  4NN2 A;  2E61 A;  2FSA A;  3T7L A;  5LCW B;  1K2F A;  4MVT A;  2YRE A;  2L7P A;  3VK6 A;  3PHD A;  2L80 A;  1WEE A;  2RSD A;  3FEH A;  1MM3 A;  4QF2 A;  1V87 A;  2L0B A;  2PNX A;  2FUI A;  3HCT A;  2HYE D;  2XOC A;  3SUB A;  3NG2 A;  3ZTG A;  3N9N A;  3LQI A;  3I2D A;  2G45 A;  1X4I A;  3DQV R;  4GNG A;  5EYA F;  2KGI A;  1T1H A;  3N9Q A;  2JMJ A;  1WGM A;  2K17 A; 
#chains in the Genus database with same CATH homology
 2KRE A;  4IC2 A;  2YHN A;  1WEV A;  2CSY A;  4I7B A;  3N9O A;  2VJE A;  5H1V A;  2KE1 A;  4F52 B;  5B8D A;  4FJC A;  3DPL R;  4O64 A;  3ZPV 1;  4B86 C;  3O70 A;  2LDR A;  2D8S A;  5TDR A;  2QIZ A;  3QZV A;  3ZVY A;  5FER A;  2Y1M A;  2VJE B;  2VNF A;  3EB6 A;  5TAB A;  5KH3 A;  2LGV A;  2MNY A;  2YUR A;  2H0D B;  1VYX A;  3M63 A;  4R8P K;  2RI7 A;  2EA6 A;  5J3X A;  4ZDT A;  4GNE A;  2YSJ A;  2YHO A;  3U5O A;  4V3K C;  3ZYQ A;  2L75 A;  2HDP A;  4X3G A;  5I3L A;  1WE9 A;  3N9P A;  5KH9 A;  3LQH A;  5H9M A;  4YBS A;  1G25 A;  4GNF A;  2EOD A;  4FK5 A;  4LAD B;  5FEY A;  5C11 A;  1XWH A;  4GND A;  4W4U A;  2XEU A;  4L58 A;  1WEW A;  2UZG A;  2ECI A;  2MD8 C;  2LV9 A;  5LKZ A;  4A0C D;  2M6M A;  5FB0 A;  4FIP A;  2C2L A;  3PUQ A;  2K16 A;  3MHS A;  1X4J A;  4P5O B;  1ZBD B;  3N9L A;  5D1M B;  2MD7 B;  2Y43 A;  1FP0 A;  3HCS A;  1JM7 A;  4YC9 A;  4V3L C;  1RMD A;  2KIZ A;  1U6G B;  4B7Y C;  5B77 A;  2VJF A;  3KV6 A;  3EB5 A;  3ZNI A;  2XB1 A;  2F6J A;  4TKP B;  4ZUX U;  1Z2Q A;  1WEQ A;  2LN0 A;  2F42 A;  1JM7 B;  2ECV A;  1CHC A;  4I7C A;  1LDK C;  3PUR A;  4Q6F A;  2VJF B;  4FO9 A;  2VPE A;  2K4D A;  1WEO A;  3ASL A;  5DKA A;  2YQL A;  3LRQ A;  1HYI A;  2LRI C;  2ECT A;  5G04 B;  4A49 A;  4UI9 B;  3RTR B;  2LXP C;  1DVP A;  4WZ2 A;  3O34 A;  3KQI A;  2KR4 A;  1WEM A;  2H0D A;  2BAY A;  2OXQ C;  3M99 A;  3ZPV E;  4UP0 A;  1Z60 A;  3O33 A;  2NAA A;  5G05 B;  1LDJ B;  2YYR A;  4A4C A;  4A4B A;  2K1J A;  3C6W A;  3U5M A;  1E4U A;  3O35 A;  1X4U A;  1JOC A;  3GV4 A;  5B75 A;  1BOR A;  5AIU A;  2ZET C;  2G43 A;  4IC3 A;  4MSX A;  2MA6 A;  3U5N A;  2KU3 A;  2IDA A;  2E6S A;  2ECJ A;  3O37 A;  3SOU A;  3L1Z B;  4YAT A;  5H1U A;  3MHH A;  4S3O C;  2E6R A;  2LGL A;  4YBM A;  2C2V S;  5D1K B;  2JRJ A;  4CCG X;  4L7X A;  3IHP A;  1F62 A;  4R2Y A;  4LK9 A;  2M1R A;  4WZ3 B;  4C9Z A;  2YW8 A;  1FBV A;  2QJ0 A;  5DIN A;  4YAX A;  3L11 A;  2MIQ A;  1WFK A;  4LLB A;  5B78 A;  4YAB A;  4PPE A;  5TDW A;  2PUY A;  4WA6 A;  4AVX A;  2ECN A;  2KFT A;  5FB1 A;  1WEN A;  4UP5 A;  3LQJ A;  2VPB A;  4N4F A;  3O7A A;  2KWO A;  2LGG A;  5C13 A;  4I7D A;  3V43 A;  2QIC A;  2EGP A;  2CKL B;  4YAD A;  2JMI A;  2YUC A;  2MUM A;  4CA1 A;  5LKX A;  2M3H A;  2YSM A;  4S3O B;  2MNZ A;  2KWJ A;  2KGG A;  2ECW A;  4PTB A;  2VPG A;  4BBQ A;  4QF3 A;  1WEU A;  2VPD A;  3RPG C;  4AUQ B;  1VD4 A;  3O36 A;  3KV5 A;  3M62 A;  3N9M A;  3C5K A;  2KWN A;  3HCU A;  2G6Q A;  2LQ6 A;  2YU4 A;  1Z6U A;  1WIM A;  5B76 A;  4LJN A;  4ZQL A;  3SOX A;  1N87 A;  5TRB A;  2VP7 A;  2M85 A;  2MA5 A;  4XI1 A;  2MT5 A;  2L43 A;  1WES A;  5JG6 A;  2YT5 A;  5G0F A;  2CT2 A;  4YBT A;  3SHB A;  3U5P A;  2Y1N A;  2KWK A;  1VFY A;  3HTK C;  5KH7 A;  4AP4 A;  1WIL A;  5AIT A;  4N3W A;  5H1T A;  2ECG A;  1HYJ A;  5D1L B;  1IYM A;  4BHW A;  2YQM A;  2I50 A;  1WEP A;  3L1X A;  2FUU A;  2F6N A;  2L5U A;  2KYU A;  2DX8 A;  5LKT A;  4AYC A;  2CSZ A;  4WZ0 A;  2JMD A;  2LGK A;  2AN6 A;  3ZVZ B;  3RPG B;  3KNV A;  4R7E A;  3T6R A;  5TBN A;  3GL6 A;  4GB0 A;  5B79 A;  3SOW A;  4LKA A;  3FL2 A;  1MM2 A;  2CKL A;  4AYC B;  2LXH C;  5LKU A;  4NN2 A;  2FSA A;  3T7L A;  5LCW B;  1K2F A;  4MVT A;  2YRE A;  3VK6 A;  3PHD A;  2L80 A;  1WEE A;  2RSD A;  1MM3 A;  4QF2 A;  1V87 A;  2L0B A;  2PNX A;  2FUI A;  3HCT A;  2HYE D;  3NG2 A;  3ZTG A;  3N9N A;  3LQI A;  3I2D A;  2G45 A;  1X4I A;  3DQV R;  4GNG A;  5EYA F;  2KGI A;  1T1H A;  3N9Q A;  2JMJ A;  1WGM A;  2K17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...