5TDRA

Set3 phd finger in complex with histone h3k4me2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MGIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transcription
molecule keywords SET domain-containing protein 3
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tdrA00
3SOWA 1BORA 2UZGA 1T1HA 1VYXA 4WZ2A 2E6RA 4LLBA 5LKUA 2FSAA 4GNEA 4FO9A 2CSZA 2LXHC 2YHNA 3L1ZB 2EA6A 3IHPA 4LKAA 3ZNIA 4GNDA 2AN6A 2C2LA 2FUIA 1X4IA 1WEOA 4WZ3B 4PTBA 4X3GA 2KE1A 2DX8A 2YT5A 1G25A 2XEUA 2D8SA 2KYUA 2M1RA 3SHBA 3VK6A 1X4UA 1V87A 5FB1A 4QF2A 4YBSA 3U5NA 2YYRA 5B79A 1WEMA 4A4CA 4A49A 2ECGA 1XWHA 2YSMA 3EB6A 3SOXA 4V3KC 2VJFB 4NN2A 4YBMA 4R7EA 3T7LA 4R8PK 4B86C 1HYJA 4N4FA 2RSDA 5LKZA 3RPGC 2VJFA 5J3XA 4LJNA 5D1LB 3N9PA 1VD4A 2M85A 2C2VS 2HYED 5D1KB 3HCSA 2KR4A 5TRBA 1RMDA 3KV5A 4C9ZA 3ZYQA 2LV9A 2VPDA 2VP7A 1LDKC 1WEPA 2H0DB 4BBQA 3MHHA 3HTKC 1WEEA 4AUQB 4S3OB 2LGLA 5TBNA 2YUCA 3O7AA 4L7XA 2I50A 2MNYA 2HDPA 4QF3A 1WEUA 2JMIA 5C13A 3O36A 2MUMA 4YBTA 3O35A 2BAYA 1WILA 2KGIA 4Q6FA 2KGGA 3ZPVE 2ZETC 2VNFA 2M3HA 3M62A 2VPEA 2K1JA 3ZPV1 1JM7A 4AVXA 2CKLB 3M63A 2KWKA 4CCGX 2ECVA 3N9LA 4O64A 2H0DA 1N87A 4XI1A 4A0CD 2PUYA 3O70A 3EB5A 5FEYA 2MD8C 2YURA 1JOCA 2CKLA 3QZVA 4TKPB 3FL2A 1VFYA 4YC9A 2Y1NA 4S3OC 4ZDTA 1X4JA 1LDJB 2VJEA 3C5KA 2KIZA 1Z2QA 5DKAA 2G6QA 2MNZA 1FBVA 2L75A 2KWJA 1MM2A 4MSXA 2L0BA 1WESA 5G04B 4F52B 2PNXA 3GV4A 2JMDA 1WE9A 4V3LC 5I3LA 2RI7A 1WEVA 2L43A 4L58A 3M99A 2LQ6A 4LADB 4YATA 2Y1MA 1WENA 2CT2A 2YREA 5D1MB 2VPGA 5DINA 4AYCB 5TABA 3U5MA 1IYMA 3NG2A 2CSYA 1Z60A 2ECTA 1WEWA 3MHSA 2LDRA 2ECJA 4P5OB 4WA6A 3PURA 5KH9A 2LN0A 5B76A 3LQHA 4N3WA 2K17A 5TDWA 3DPLR 5JG6A 5FERA 1WGMA 3O37A 3L1XA 3KV6A 3KQIA 5AIUA 4I7BA 3LRQA 5LCWB 1WEQA 4AP4A 4GNGA 2KFTA 5EYAF 3U5PA 4YADA 5G05B 4FIPA 2JRJA 5FB0A 4UP0A 3ZVYA 2OXQC 1WFKA 3SOUA 2G43A 3ZVZB 1FP0A 1CHCA 5H1TA 5AITA 5B77A 2XB1A 2LXPC 1HYIA 2LGGA 4A4BA 2KWOA 2MT5A 2LGVA 5B75A 3KNVA 5KH7A 2Y43A 3LQJA 3RPGB 1DVPA 2JMJA 5H1VA 2KU3A 3GL6A 2KWNA 2M6MA 1WIMA 4IC2A 2L80A 4IC3A 4YAXA 1Z6UA 2FUUA 1K2FA 1E4UA 3U5OA 2F42A 3HCTA 3I2DA 2LGKA 3O34A 3ZTGA 3N9MA 5G0FA 3N9QA 4PPEA 4FK5A 4I7DA 3L11A 1U6GB 2NAAA 2YHOA 2YSJA 2KREA 5B8DA 2MD7B 4UP5A 5H1UA 3N9OA 5TDRA 3LQIA 4B7YC 2YU4A 5LKXA 2EGPA 4W4UA 4GNFA 2E6SA 2QICA 2ECWA 2F6JA 2MA6A 3PHDA 2YW8A 2K4DA 4AYCA 4I7CA 5KH3A 1JM7B 4YABA 4BHWA 2ECNA 4UI9B 2MIQA 2QIZA 4ZUXU 2YQLA 3T6RA 4WZ0A 2L5UA 2F6NA 2QJ0A 2MA5A 2VPBA 5C11A 5LKTA 3DQVR 2K16A 1MM3A 2IDAA 1F62A 4CA1A 1ZBDB 4GB0A 4ZQLA 3C6WA 3HCUA 4LK9A 4R2YA 3RTRB 5H9MA 4FJCA 5B78A 4MVTA 3PUQA 2YQMA 2ECIA 3ASLA 2LRIC 3V43A 3O33A 2G45A 2EODA 2VJEB 3N9NA
chains in the Genus database with same CATH superfamily
3SOWA 1BORA 2UZGA 1T1HA 1VYXA 4WZ2A 2E6RA 4Z0RA 4LLBA 5LKUA 4H9DA 2FSAA 4GNEA 4FO9A 2CSZA 2LXHC 2YHNA 3L1ZB 2XOCA 2EA6A 3IHPA 4LKAA 3ZNIA 4GNDA 2AN6A 4O62A 2C2LA 5SVYA 2FUIA 1X4IA 2DJAA 1WEOA 2LAUA 4WZ3B 4PTBA 4X3GA 2KE1A 2DX8A 2YT5A 1G25A 2XEUA 3SUBA 2D8SA 2DSMA 2KYUA 2M1RA 3SHBA 3VK6A 1X4UA 1V87A 5FB1A 4QF2A 4YBSA 3FJUB 3U5NA 2YYRA 5B79A 1WEMA 2RR4A 4A4CA 2D8UA 4A49A 2ECGA 1XWHA 2YSMA 3EB6A 3SOXA 4V3KC 2VJFB 2YVRA 4NN2A 4YBMA 4R7EA 3T7LA 4R8PK 4B86C 1HYJA 4N4FA 2RSDA 5LKZA 3RPGC 2VJFA 5J3XA 4LJNA 5D1LB 3N9PA 1VD4A 2M85A 2C2VS 2HYED 3LVRE 2JUNA 2KKXA 5D1KB 3HCSA 2KR4A 5TRBA 1RMDA 3KDEC 1MBMA 3KV5A 4C9ZA 3ZYQA 2LV9A 2VPDA 5SVIB 2VP7A 1LDKC 1WEPA 2H0DB 4BBQA 3MHHA 3HTKC 1WEEA 4AUQB 4S3OB 2LGLA 5TBNA 2YUCA 3O7AA 4L7XA 2I50A 2MNYA 2HDPA 4QF3A 1WEUA 2JMIA 5C13A 3O36A 2MUMA 4YBTA 3O35A 2BAYA 1WILA 2KGIA 4Q6FA 2KGGA 3ZPVE 2ZETC 4Z0OA 2VNFA 2M3HA 2FD4A 3M62A 2VPEA 2K1JA 3ZPV1 1JM7A 4AVXA 2CKLB 3M63A 3H7HA 3FAOA 3T9KA 2KWKA 4CCGX 2ECVA 2FFWA 3N9LA 4O64A 2H0DA 1N87A 4XI1A 4A0CD 2PUYA 3O70A 3M7KA 3EB5A 5FEYA 2MD8C 2YURA 1JOCA 2CKLA 3QZVA 4TKPB 3FL2A 1VFYA 4YC9A 2Y1NA 3JUEA 4S3OC 4ZDTA 1X4JA 1LDJB 2VJEA 3C5KA 2KIZA 1Z2QA 5DKAA 2G6QA 2MNZA 1FBVA 5K3QA 3Q1DA 3DWDA 2L75A 2KWJA 1MM2A 4MSXA 2L0BA 1WESA 5G04B 4F52B 2PNXA 3GV4A 2JMDA 1WE9A 4V3LC 5I3LA 2RI7A 1WEVA 2L43A 4L58A 3M99A 2LQ6A 4F1PA 2XOYA 4LADB 4YATA 2Y1MA 1WENA 2CT2A 2YREA 5D1MB 2VPGA 5DINA 4AYCB 5TABA 3U5MA 1IYMA 3NG2A 2CSYA 1Z60A 2ECTA 1WEWA 3MHSA 2CRRA 2LDRA 2ECJA 4P5OB 4WA6A 3PURA 5KH9A 3FEHA 2LN0A 5B76A 3LQHA 2KKYA 4N3WA 2K17A 5TDWA 2B0OE 3DPLR 2M13A 5JG6A 5FERA 1WGMA 3O37A 3L1XA 3KV6A 3KQIA 5AIUA 4I7BA 3LRQA 5LCWB 1WEQA 4GNGA 4AP4A 2KFTA 5EYAF 3U5PA 4YADA 5G05B 4FIPA 2JRJA 5FB0A 4UP0A 3ZVYA 2OXQC 1WFKA 3SOUA 2G43A 3ZVZB 1FP0A 1CHCA 3LJUX 5H1TA 5AITA 3FM8C 5B77A 2XB1A 2LXPC 1HYIA 2LGGA 2CSVA 2L7PA 4A4BA 3FANA 2KWOA 2MT5A 2LGVA 5B75A 3KNVA 5KH7A 2XOZA 2Y43A 4OGEA 3LQJA 3RPGB 1DVPA 2JMJA 2JM3A 5H1VA 2KU3A 3GL6A 2KWNA 2M6MA 1WIMA 4IC2A 2L80A 4IC3A 4YAXA 1Z6UA 3LVQE 2FUUA 1K2FA 1E4UA 3U5OA 2F42A 4QQ4A 3HCTA 3I2DA 2LGKA 3O34A 3ZTGA 3MDBC 3N9MA 5G0FA 3N9QA 2P57A 4PPEA 4OGCA 4FK5A 4I7DA 3L11A 3O47A 2MKEA 1U6GB 2NAAA 2EGMA 2YHOA 2EXUA 2IQJA 2YSJA 2XP0A 2E61A 2KREA 5B8DA 2MD7B 4UP5A 5H1UA 3N9OA 5TDRA 3DDTA 3E2DA 3LQIA 4B7YC 2YU4A 5LKXA 2EGPA 5SVIA 4W4UA 4GNFA 2E6SA 2QICA 1DCQA 2ECWA 2F6JA 2MA6A 2YW8A 2K4DA 3PHDA 3LDYA 4AYCA 4I7CA 5KH3A 1JM7B 4YABA 4BHWA 2ECNA 4UI9B 2MIQA 2QIZA 5SVXA 4ZUXU 3PLWA 2YQLA 3T6RA 4WZ0A 2L5UA 2F6NA 2QJ0A 2CRWA 2MA5A 2VPBA 5C11A 5LKTA 3DQVR 2K16A 1MM3A 2IDAA 2CONA 1F62A 4CA1A 1ZBDB 4GB0A 4ZQLA 3C6WA 3HCUA 4LK9A 4R2YA 3RTRB 5H9MA 4FJCA 5B78A 4MVTA 3PUQA 2OWAA 2YQMA 2ECIA 3ASLA 2LRIC 3V43A 3O33A 2G45A 2EODA 2VJEB 3N9NA
chains in the Genus database with same CATH topology
3SOWA 1BORA 2UZGA 1T1HA 1VYXA 4WZ2A 2E6RA 4LLBA 5LKUA 2FSAA 4GNEA 4FO9A 2CSZA 2LXHC 2YHNA 3L1ZB 2EA6A 3IHPA 4LKAA 3ZNIA 4GNDA 2AN6A 2C2LA 2FUIA 1X4IA 1WEOA 4WZ3B 4PTBA 4X3GA 2KE1A 2DX8A 2YT5A 1G25A 2XEUA 2D8SA 2KYUA 2M1RA 3SHBA 3VK6A 1X4UA 1V87A 5FB1A 4QF2A 4YBSA 3U5NA 2YYRA 5B79A 1WEMA 4A4CA 4A49A 2ECGA 1XWHA 2YSMA 3EB6A 3SOXA 4V3KC 2VJFB 4NN2A 4YBMA 4R7EA 3T7LA 4R8PK 4B86C 1HYJA 4N4FA 2RSDA 5LKZA 3RPGC 2VJFA 5J3XA 4LJNA 5D1LB 3N9PA 1VD4A 2M85A 2C2VS 2HYED 5D1KB 3HCSA 2KR4A 5TRBA 1RMDA 3KV5A 4C9ZA 3ZYQA 2LV9A 2VPDA 2VP7A 1LDKC 1WEPA 2H0DB 4BBQA 3MHHA 3HTKC 1WEEA 4AUQB 4S3OB 2LGLA 5TBNA 2YUCA 3O7AA 4L7XA 2I50A 2MNYA 2HDPA 4QF3A 1WEUA 2JMIA 5C13A 3O36A 2MUMA 4YBTA 3O35A 2BAYA 1WILA 2KGIA 4Q6FA 2KGGA 3ZPVE 2ZETC 2VNFA 2M3HA 3M62A 2VPEA 2K1JA 3ZPV1 1JM7A 4AVXA 2CKLB 3M63A 2KWKA 4CCGX 2ECVA 3N9LA 4O64A 2H0DA 1N87A 4XI1A 4A0CD 2PUYA 3O70A 3EB5A 5FEYA 2MD8C 2YURA 1JOCA 2CKLA 3QZVA 4TKPB 3FL2A 1VFYA 4YC9A 2Y1NA 4S3OC 4ZDTA 1X4JA 1LDJB 2VJEA 3C5KA 2KIZA 1Z2QA 5DKAA 2G6QA 2MNZA 1FBVA 2L75A 2KWJA 1MM2A 4MSXA 2L0BA 1WESA 5G04B 4F52B 2PNXA 3GV4A 2JMDA 1WE9A 4V3LC 5I3LA 2RI7A 1WEVA 2L43A 4L58A 3M99A 2LQ6A 4LADB 4YATA 2Y1MA 1WENA 2CT2A 2YREA 5D1MB 2VPGA 5DINA 4AYCB 5TABA 3U5MA 1IYMA 3NG2A 2CSYA 1Z60A 2ECTA 1WEWA 3MHSA 2LDRA 2ECJA 4P5OB 4WA6A 3PURA 5KH9A 2LN0A 5B76A 3LQHA 4N3WA 2K17A 5TDWA 3DPLR 5JG6A 5FERA 1WGMA 3O37A 3L1XA 3KV6A 3KQIA 5AIUA 4I7BA 3LRQA 5LCWB 1WEQA 4AP4A 4GNGA 2KFTA 5EYAF 3U5PA 4YADA 5G05B 4FIPA 2JRJA 5FB0A 4UP0A 3ZVYA 2OXQC 1WFKA 3SOUA 2G43A 3ZVZB 1FP0A 1CHCA 5H1TA 5AITA 5B77A 2XB1A 2LXPC 1HYIA 2LGGA 4A4BA 2KWOA 2MT5A 2LGVA 5B75A 3KNVA 5KH7A 2Y43A 3LQJA 3RPGB 1DVPA 2JMJA 5H1VA 2KU3A 3GL6A 2KWNA 2M6MA 1WIMA 4IC2A 2L80A 4IC3A 4YAXA 1Z6UA 2FUUA 1K2FA 1E4UA 3U5OA 2F42A 3HCTA 3I2DA 2LGKA 3O34A 3ZTGA 3N9MA 5G0FA 3N9QA 4PPEA 4FK5A 4I7DA 3L11A 1U6GB 2NAAA 2YHOA 2YSJA 2KREA 5B8DA 2MD7B 4UP5A 5H1UA 3N9OA 5TDRA 3LQIA 4B7YC 2YU4A 5LKXA 2EGPA 4W4UA 4GNFA 2E6SA 2QICA 2ECWA 2F6JA 2MA6A 3PHDA 2YW8A 2K4DA 4AYCA 4I7CA 5KH3A 1JM7B 4YABA 4BHWA 2ECNA 4UI9B 2MIQA 2QIZA 4ZUXU 2YQLA 3T6RA 4WZ0A 2L5UA 2F6NA 2QJ0A 2MA5A 2VPBA 5C11A 5LKTA 3DQVR 2K16A 1MM3A 2IDAA 1F62A 4CA1A 1ZBDB 4GB0A 4ZQLA 3C6WA 3HCUA 4LK9A 4R2YA 3RTRB 5H9MA 4FJCA 5B78A 4MVTA 3PUQA 2YQMA 2ECIA 3ASLA 2LRIC 3V43A 3O33A 2G45A 2EODA 2VJEB 3N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOW A;  1BOR A;  2UZG A;  1T1H A;  1VYX A;  4WZ2 A;  2E6R A;  4LLB A;  5LKU A;  2FSA A;  4GNE A;  4FO9 A;  2CSZ A;  2LXH C;  2YHN A;  3L1Z B;  2EA6 A;  3IHP A;  4LKA A;  3ZNI A;  4GND A;  2AN6 A;  2C2L A;  2FUI A;  1X4I A;  1WEO A;  4WZ3 B;  4PTB A;  4X3G A;  2KE1 A;  2DX8 A;  2YT5 A;  1G25 A;  2XEU A;  2D8S A;  2KYU A;  2M1R A;  3SHB A;  3VK6 A;  1X4U A;  1V87 A;  5FB1 A;  4QF2 A;  4YBS A;  3U5N A;  2YYR A;  5B79 A;  1WEM A;  4A4C A;  4A49 A;  2ECG A;  1XWH A;  2YSM A;  3EB6 A;  3SOX A;  4V3K C;  2VJF B;  4NN2 A;  4YBM A;  4R7E A;  3T7L A;  4R8P K;  4B86 C;  1HYJ A;  4N4F A;  2RSD A;  5LKZ A;  3RPG C;  2VJF A;  5J3X A;  4LJN A;  5D1L B;  3N9P A;  1VD4 A;  2M85 A;  2C2V S;  2HYE D;  5D1K B;  3HCS A;  2KR4 A;  5TRB A;  1RMD A;  3KV5 A;  4C9Z A;  3ZYQ A;  2LV9 A;  2VPD A;  2VP7 A;  1LDK C;  1WEP A;  2H0D B;  4BBQ A;  3MHH A;  3HTK C;  1WEE A;  4AUQ B;  4S3O B;  2LGL A;  5TBN A;  2YUC A;  3O7A A;  4L7X A;  2I50 A;  2MNY A;  2HDP A;  4QF3 A;  1WEU A;  2JMI A;  5C13 A;  3O36 A;  2MUM A;  4YBT A;  3O35 A;  2BAY A;  1WIL A;  2KGI A;  4Q6F A;  2KGG A;  3ZPV E;  2ZET C;  2VNF A;  2M3H A;  3M62 A;  2VPE A;  2K1J A;  3ZPV 1;  1JM7 A;  4AVX A;  2CKL B;  3M63 A;  2KWK A;  4CCG X;  2ECV A;  3N9L A;  4O64 A;  2H0D A;  1N87 A;  4XI1 A;  4A0C D;  2PUY A;  3O70 A;  3EB5 A;  5FEY A;  2MD8 C;  2YUR A;  1JOC A;  2CKL A;  3QZV A;  4TKP B;  3FL2 A;  1VFY A;  4YC9 A;  2Y1N A;  4S3O C;  4ZDT A;  1X4J A;  1LDJ B;  2VJE A;  3C5K A;  2KIZ A;  1Z2Q A;  5DKA A;  2G6Q A;  2MNZ A;  1FBV A;  2L75 A;  2KWJ A;  1MM2 A;  4MSX A;  2L0B A;  1WES A;  5G04 B;  4F52 B;  2PNX A;  3GV4 A;  2JMD A;  1WE9 A;  4V3L C;  5I3L A;  2RI7 A;  1WEV A;  2L43 A;  4L58 A;  3M99 A;  2LQ6 A;  4LAD B;  4YAT A;  2Y1M A;  1WEN A;  2CT2 A;  2YRE A;  5D1M B;  2VPG A;  5DIN A;  4AYC B;  5TAB A;  3U5M A;  1IYM A;  3NG2 A;  2CSY A;  1Z60 A;  2ECT A;  1WEW A;  3MHS A;  2LDR A;  2ECJ A;  4P5O B;  4WA6 A;  3PUR A;  5KH9 A;  2LN0 A;  5B76 A;  3LQH A;  4N3W A;  2K17 A;  5TDW A;  3DPL R;  5JG6 A;  5FER A;  1WGM A;  3O37 A;  3L1X A;  3KV6 A;  3KQI A;  5AIU A;  4I7B A;  3LRQ A;  5LCW B;  1WEQ A;  4AP4 A;  4GNG A;  2KFT A;  5EYA F;  3U5P A;  4YAD A;  5G05 B;  4FIP A;  2JRJ A;  5FB0 A;  4UP0 A;  3ZVY A;  2OXQ C;  1WFK A;  3SOU A;  2G43 A;  3ZVZ B;  1FP0 A;  1CHC A;  5H1T A;  5AIT A;  5B77 A;  2XB1 A;  2LXP C;  1HYI A;  2LGG A;  4A4B A;  2KWO A;  2MT5 A;  2LGV A;  5B75 A;  3KNV A;  5KH7 A;  2Y43 A;  3LQJ A;  3RPG B;  1DVP A;  2JMJ A;  5H1V A;  2KU3 A;  3GL6 A;  2KWN A;  2M6M A;  1WIM A;  4IC2 A;  2L80 A;  4IC3 A;  4YAX A;  1Z6U A;  2FUU A;  1K2F A;  1E4U A;  3U5O A;  2F42 A;  3HCT A;  3I2D A;  2LGK A;  3O34 A;  3ZTG A;  3N9M A;  5G0F A;  3N9Q A;  4PPE A;  4FK5 A;  4I7D A;  3L11 A;  1U6G B;  2NAA A;  2YHO A;  2YSJ A;  2KRE A;  5B8D A;  2MD7 B;  4UP5 A;  5H1U A;  3N9O A;  5TDR A;  3LQI A;  4B7Y C;  2YU4 A;  5LKX A;  2EGP A;  4W4U A;  4GNF A;  2E6S A;  2QIC A;  2ECW A;  2F6J A;  2MA6 A;  3PHD A;  2YW8 A;  2K4D A;  4AYC A;  4I7C A;  5KH3 A;  1JM7 B;  4YAB A;  4BHW A;  2ECN A;  4UI9 B;  2MIQ A;  2QIZ A;  4ZUX U;  2YQL A;  3T6R A;  4WZ0 A;  2L5U A;  2F6N A;  2QJ0 A;  2MA5 A;  2VPB A;  5C11 A;  5LKT A;  3DQV R;  2K16 A;  1MM3 A;  2IDA A;  1F62 A;  4CA1 A;  1ZBD B;  4GB0 A;  4ZQL A;  3C6W A;  3HCU A;  4LK9 A;  4R2Y A;  3RTR B;  5H9M A;  4FJC A;  5B78 A;  4MVT A;  3PUQ A;  2YQM A;  2ECI A;  3ASL A;  2LRI C;  3V43 A;  3O33 A;  2G45 A;  2EOD A;  2VJE B;  3N9N A; 
#chains in the Genus database with same CATH topology
 3SOW A;  1BOR A;  2UZG A;  1T1H A;  1VYX A;  4WZ2 A;  2E6R A;  4Z0R A;  4LLB A;  5LKU A;  4H9D A;  2FSA A;  4GNE A;  4FO9 A;  2CSZ A;  2LXH C;  2YHN A;  3L1Z B;  2XOC A;  2EA6 A;  3IHP A;  4LKA A;  3ZNI A;  4GND A;  2AN6 A;  4O62 A;  2C2L A;  5SVY A;  2FUI A;  1X4I A;  2DJA A;  1WEO A;  2LAU A;  4WZ3 B;  4PTB A;  4X3G A;  2KE1 A;  2DX8 A;  2YT5 A;  1G25 A;  2XEU A;  3SUB A;  2D8S A;  2DSM A;  2KYU A;  2M1R A;  3SHB A;  3VK6 A;  1X4U A;  1V87 A;  5FB1 A;  4QF2 A;  4YBS A;  3FJU B;  3U5N A;  2YYR A;  5B79 A;  1WEM A;  2RR4 A;  4A4C A;  2D8U A;  4A49 A;  2ECG A;  1XWH A;  2YSM A;  3EB6 A;  3SOX A;  4V3K C;  2VJF B;  2YVR A;  4NN2 A;  4YBM A;  4R7E A;  3T7L A;  4R8P K;  4B86 C;  1HYJ A;  4N4F A;  2RSD A;  5LKZ A;  3RPG C;  2VJF A;  5J3X A;  4LJN A;  5D1L B;  3N9P A;  1VD4 A;  2M85 A;  2C2V S;  2HYE D;  3LVR E;  2JUN A;  2KKX A;  5D1K B;  3HCS A;  2KR4 A;  5TRB A;  1RMD A;  3KDE C;  1MBM A;  3KV5 A;  4C9Z A;  3ZYQ A;  2LV9 A;  2VPD A;  5SVI B;  2VP7 A;  1LDK C;  1WEP A;  2H0D B;  4BBQ A;  3MHH A;  3HTK C;  1WEE A;  4AUQ B;  4S3O B;  2LGL A;  5TBN A;  2YUC A;  3O7A A;  4L7X A;  2I50 A;  2MNY A;  2HDP A;  4QF3 A;  1WEU A;  2JMI A;  5C13 A;  3O36 A;  2MUM A;  4YBT A;  3O35 A;  2BAY A;  1WIL A;  2KGI A;  4Q6F A;  2KGG A;  3ZPV E;  2ZET C;  4Z0O A;  2VNF A;  2M3H A;  2FD4 A;  3M62 A;  2VPE A;  2K1J A;  3ZPV 1;  1JM7 A;  4AVX A;  2CKL B;  3M63 A;  3H7H A;  3FAO A;  3T9K A;  2KWK A;  4CCG X;  2ECV A;  2FFW A;  3N9L A;  4O64 A;  2H0D A;  1N87 A;  4XI1 A;  4A0C D;  2PUY A;  3O70 A;  3M7K A;  3EB5 A;  5FEY A;  2MD8 C;  2YUR A;  1JOC A;  2CKL A;  3QZV A;  4TKP B;  3FL2 A;  1VFY A;  4YC9 A;  2Y1N A;  3JUE A;  4S3O C;  4ZDT A;  1X4J A;  1LDJ B;  2VJE A;  3C5K A;  2KIZ A;  1Z2Q A;  5DKA A;  2G6Q A;  2MNZ A;  1FBV A;  5K3Q A;  3Q1D A;  3DWD A;  2L75 A;  2KWJ A;  1MM2 A;  4MSX A;  2L0B A;  1WES A;  5G04 B;  4F52 B;  2PNX A;  3GV4 A;  2JMD A;  1WE9 A;  4V3L C;  5I3L A;  2RI7 A;  1WEV A;  2L43 A;  4L58 A;  3M99 A;  2LQ6 A;  4F1P A;  2XOY A;  4LAD B;  4YAT A;  2Y1M A;  1WEN A;  2CT2 A;  2YRE A;  5D1M B;  2VPG A;  5DIN A;  4AYC B;  5TAB A;  3U5M A;  1IYM A;  3NG2 A;  2CSY A;  1Z60 A;  2ECT A;  1WEW A;  3MHS A;  2CRR A;  2LDR A;  2ECJ A;  4P5O B;  4WA6 A;  3PUR A;  5KH9 A;  3FEH A;  2LN0 A;  5B76 A;  3LQH A;  2KKY A;  4N3W A;  2K17 A;  5TDW A;  2B0O E;  3DPL R;  2M13 A;  5JG6 A;  5FER A;  1WGM A;  3O37 A;  3L1X A;  3KV6 A;  3KQI A;  5AIU A;  4I7B A;  3LRQ A;  5LCW B;  1WEQ A;  4GNG A;  4AP4 A;  2KFT A;  5EYA F;  3U5P A;  4YAD A;  5G05 B;  4FIP A;  2JRJ A;  5FB0 A;  4UP0 A;  3ZVY A;  2OXQ C;  1WFK A;  3SOU A;  2G43 A;  3ZVZ B;  1FP0 A;  1CHC A;  3LJU X;  5H1T A;  5AIT A;  3FM8 C;  5B77 A;  2XB1 A;  2LXP C;  1HYI A;  2LGG A;  2CSV A;  2L7P A;  4A4B A;  3FAN A;  2KWO A;  2MT5 A;  2LGV A;  5B75 A;  3KNV A;  5KH7 A;  2XOZ A;  2Y43 A;  4OGE A;  3LQJ A;  3RPG B;  1DVP A;  2JMJ A;  2JM3 A;  5H1V A;  2KU3 A;  3GL6 A;  2KWN A;  2M6M A;  1WIM A;  4IC2 A;  2L80 A;  4IC3 A;  4YAX A;  1Z6U A;  3LVQ E;  2FUU A;  1K2F A;  1E4U A;  3U5O A;  2F42 A;  4QQ4 A;  3HCT A;  3I2D A;  2LGK A;  3O34 A;  3ZTG A;  3MDB C;  3N9M A;  5G0F A;  3N9Q A;  2P57 A;  4PPE A;  4OGC A;  4FK5 A;  4I7D A;  3L11 A;  3O47 A;  2MKE A;  1U6G B;  2NAA A;  2EGM A;  2YHO A;  2EXU A;  2IQJ A;  2YSJ A;  2XP0 A;  2E61 A;  2KRE A;  5B8D A;  2MD7 B;  4UP5 A;  5H1U A;  3N9O A;  5TDR A;  3DDT A;  3E2D A;  3LQI A;  4B7Y C;  2YU4 A;  5LKX A;  2EGP A;  5SVI A;  4W4U A;  4GNF A;  2E6S A;  2QIC A;  1DCQ A;  2ECW A;  2F6J A;  2MA6 A;  2YW8 A;  2K4D A;  3PHD A;  3LDY A;  4AYC A;  4I7C A;  5KH3 A;  1JM7 B;  4YAB A;  4BHW A;  2ECN A;  4UI9 B;  2MIQ A;  2QIZ A;  5SVX A;  4ZUX U;  3PLW A;  2YQL A;  3T6R A;  4WZ0 A;  2L5U A;  2F6N A;  2QJ0 A;  2CRW A;  2MA5 A;  2VPB A;  5C11 A;  5LKT A;  3DQV R;  2K16 A;  1MM3 A;  2IDA A;  2CON A;  1F62 A;  4CA1 A;  1ZBD B;  4GB0 A;  4ZQL A;  3C6W A;  3HCU A;  4LK9 A;  4R2Y A;  3RTR B;  5H9M A;  4FJC A;  5B78 A;  4MVT A;  3PUQ A;  2OWA A;  2YQM A;  2ECI A;  3ASL A;  2LRI C;  3V43 A;  3O33 A;  2G45 A;  2EOD A;  2VJE B;  3N9N A; 
#chains in the Genus database with same CATH homology
 3SOW A;  1BOR A;  2UZG A;  1T1H A;  1VYX A;  4WZ2 A;  2E6R A;  4LLB A;  5LKU A;  2FSA A;  4GNE A;  4FO9 A;  2CSZ A;  2LXH C;  2YHN A;  3L1Z B;  2EA6 A;  3IHP A;  4LKA A;  3ZNI A;  4GND A;  2AN6 A;  2C2L A;  2FUI A;  1X4I A;  1WEO A;  4WZ3 B;  4PTB A;  4X3G A;  2KE1 A;  2DX8 A;  2YT5 A;  1G25 A;  2XEU A;  2D8S A;  2KYU A;  2M1R A;  3SHB A;  3VK6 A;  1X4U A;  1V87 A;  5FB1 A;  4QF2 A;  4YBS A;  3U5N A;  2YYR A;  5B79 A;  1WEM A;  4A4C A;  4A49 A;  2ECG A;  1XWH A;  2YSM A;  3EB6 A;  3SOX A;  4V3K C;  2VJF B;  4NN2 A;  4YBM A;  4R7E A;  3T7L A;  4R8P K;  4B86 C;  1HYJ A;  4N4F A;  2RSD A;  5LKZ A;  3RPG C;  2VJF A;  5J3X A;  4LJN A;  5D1L B;  3N9P A;  1VD4 A;  2M85 A;  2C2V S;  2HYE D;  5D1K B;  3HCS A;  2KR4 A;  5TRB A;  1RMD A;  3KV5 A;  4C9Z A;  3ZYQ A;  2LV9 A;  2VPD A;  2VP7 A;  1LDK C;  1WEP A;  2H0D B;  4BBQ A;  3MHH A;  3HTK C;  1WEE A;  4AUQ B;  4S3O B;  2LGL A;  5TBN A;  2YUC A;  3O7A A;  4L7X A;  2I50 A;  2MNY A;  2HDP A;  4QF3 A;  1WEU A;  2JMI A;  5C13 A;  3O36 A;  2MUM A;  4YBT A;  3O35 A;  2BAY A;  1WIL A;  2KGI A;  4Q6F A;  2KGG A;  3ZPV E;  2ZET C;  2VNF A;  2M3H A;  3M62 A;  2VPE A;  2K1J A;  3ZPV 1;  1JM7 A;  4AVX A;  2CKL B;  3M63 A;  2KWK A;  4CCG X;  2ECV A;  3N9L A;  4O64 A;  2H0D A;  1N87 A;  4XI1 A;  4A0C D;  2PUY A;  3O70 A;  3EB5 A;  5FEY A;  2MD8 C;  2YUR A;  1JOC A;  2CKL A;  3QZV A;  4TKP B;  3FL2 A;  1VFY A;  4YC9 A;  2Y1N A;  4S3O C;  4ZDT A;  1X4J A;  1LDJ B;  2VJE A;  3C5K A;  2KIZ A;  1Z2Q A;  5DKA A;  2G6Q A;  2MNZ A;  1FBV A;  2L75 A;  2KWJ A;  1MM2 A;  4MSX A;  2L0B A;  1WES A;  5G04 B;  4F52 B;  2PNX A;  3GV4 A;  2JMD A;  1WE9 A;  4V3L C;  5I3L A;  2RI7 A;  1WEV A;  2L43 A;  4L58 A;  3M99 A;  2LQ6 A;  4LAD B;  4YAT A;  2Y1M A;  1WEN A;  2CT2 A;  2YRE A;  5D1M B;  2VPG A;  5DIN A;  4AYC B;  5TAB A;  3U5M A;  1IYM A;  3NG2 A;  2CSY A;  1Z60 A;  2ECT A;  1WEW A;  3MHS A;  2LDR A;  2ECJ A;  4P5O B;  4WA6 A;  3PUR A;  5KH9 A;  2LN0 A;  5B76 A;  3LQH A;  4N3W A;  2K17 A;  5TDW A;  3DPL R;  5JG6 A;  5FER A;  1WGM A;  3O37 A;  3L1X A;  3KV6 A;  3KQI A;  5AIU A;  4I7B A;  3LRQ A;  5LCW B;  1WEQ A;  4AP4 A;  4GNG A;  2KFT A;  5EYA F;  3U5P A;  4YAD A;  5G05 B;  4FIP A;  2JRJ A;  5FB0 A;  4UP0 A;  3ZVY A;  2OXQ C;  1WFK A;  3SOU A;  2G43 A;  3ZVZ B;  1FP0 A;  1CHC A;  5H1T A;  5AIT A;  5B77 A;  2XB1 A;  2LXP C;  1HYI A;  2LGG A;  4A4B A;  2KWO A;  2MT5 A;  2LGV A;  5B75 A;  3KNV A;  5KH7 A;  2Y43 A;  3LQJ A;  3RPG B;  1DVP A;  2JMJ A;  5H1V A;  2KU3 A;  3GL6 A;  2KWN A;  2M6M A;  1WIM A;  4IC2 A;  2L80 A;  4IC3 A;  4YAX A;  1Z6U A;  2FUU A;  1K2F A;  1E4U A;  3U5O A;  2F42 A;  3HCT A;  3I2D A;  2LGK A;  3O34 A;  3ZTG A;  3N9M A;  5G0F A;  3N9Q A;  4PPE A;  4FK5 A;  4I7D A;  3L11 A;  1U6G B;  2NAA A;  2YHO A;  2YSJ A;  2KRE A;  5B8D A;  2MD7 B;  4UP5 A;  5H1U A;  3N9O A;  5TDR A;  3LQI A;  4B7Y C;  2YU4 A;  5LKX A;  2EGP A;  4W4U A;  4GNF A;  2E6S A;  2QIC A;  2ECW A;  2F6J A;  2MA6 A;  3PHD A;  2YW8 A;  2K4D A;  4AYC A;  4I7C A;  5KH3 A;  1JM7 B;  4YAB A;  4BHW A;  2ECN A;  4UI9 B;  2MIQ A;  2QIZ A;  4ZUX U;  2YQL A;  3T6R A;  4WZ0 A;  2L5U A;  2F6N A;  2QJ0 A;  2MA5 A;  2VPB A;  5C11 A;  5LKT A;  3DQV R;  2K16 A;  1MM3 A;  2IDA A;  1F62 A;  4CA1 A;  1ZBD B;  4GB0 A;  4ZQL A;  3C6W A;  3HCU A;  4LK9 A;  4R2Y A;  3RTR B;  5H9M A;  4FJC A;  5B78 A;  4MVT A;  3PUQ A;  2YQM A;  2ECI A;  3ASL A;  2LRI C;  3V43 A;  3O33 A;  2G45 A;  2EOD A;  2VJE B;  3N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...