5TDRA

Set3 phd finger in complex with histone h3k4me2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MGIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET domain-containing protein 3
publication title Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transcription
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tdrA00
3U5PA 2LGKA 2KU3A 2MUMA 3ZVYA 1HYIA 3ZPV1 5D1KB 1JM7B 2DX8A 2D8SA 4FK5A 4CA1A 2EGPA 3GL6A 5H1VA 2VJFB 4WA6A 1VD4A 5H1UA 5TDWA 2VPGA 3LQHA 2YQLA 4LKAA 3SOUA 2G43A 3L1XA 2YUCA 2YURA 3QZVA 4TKPB 2YHOA 1BORA 2KR4A 2RSDA 2YU4A 4O64A 2L0BA 3ZVZB 2JMJA 2JMDA 4N4FA 4L7XA 5LCWB 1WEEA 5LKTA 3LRQA 2MNZA 1WEVA 5FB1A 4XI1A 2FUIA 2YT5A 3ZYQA 2HYED 2VP7A 2LXPC 1WEUA 3N9NA 2E6RA 2KIZA 3U5OA 2KGIA 5JG6A 5B77A 1Z60A 1WFKA 5KH9A 4AYCB 2K16A 3SOWA 1T1HA 2KYUA 2QICA 4YC9A 1DVPA 4R2YA 1WE9A 4Q6FA 5B76A 3N9PA 1WEWA 1MM2A 2RI7A 2F42A 2Y1NA 3EB5A 2KWJA 2LDRA 4FIPA 5FB0A 4R7EA 2CSYA 3I2DA 3C5KA 3N9LA 3RPGB 3M63A 2BAYA 4GNDA 5G0FA 1WEPA 4YADA 3RTRB 2VPBA 3PHDA 3L11A 3RPGC 5H9MA 3PURA 3KNVA 2ECNA 2YHNA 2XB1A 3NG2A 5H1TA 2QJ0A 5G04B 4YBSA 2ZETC 1WGMA 2C2VS 5J3XA 2MD7B 4IC2A 3N9OA 3O33A 4YBMA 2YREA 4LK9A 2QIZA 2VNFA 2YW8A 3U5NA 4AVXA 1V87A 3MHHA 4AP4A 4UI9B 2LGLA 2VPEA 2YQMA 4GNFA 4GNEA 4WZ2A 2CT2A 1IYMA 4ZDTA 2ECWA 4IC3A 1WESA 1JM7A 4A49A 1G25A 1K2FA 2AN6A 5TBNA 4UP5A 2Y1MA 2VJFA 1HYJA 1WEQA 4I7DA 3ZNIA 1X4JA 2KWOA 1F62A 4A0CD 2F6JA 1WEMA 2VJEB 2K4DA 2VPDA 1RMDA 1LDKC 2LGGA 2EODA 2ECJA 2L5UA 3IHPA 3O37A 1CHCA 5C13A 2MIQA 2MT5A 4F52B 2CSZA 3HCSA 5TABA 5C11A 1FBVA 2OXQC 5DINA 2G45A 3V43A 5KH7A 3HTKC 2L80A 2YYRA 4A4CA 2L75A 4WZ0A 1ZBDB 3SHBA 4FJCA 2G6QA 4AYCA 3GV4A 1VYXA 2EA6A 2F6NA 2M1RA 4YBTA 1Z6UA 1MM3A 4C9ZA 2HDPA 3VK6A 2LN0A 2LV9A 3PUQA 5LKXA 3T6RA 4PTBA 1X4IA 4YABA 1X4UA 4B7YC 2PNXA 5B78A 3MHSA 4ZUXU 4NN2A 4V3KC 3SOXA 4QF3A 2IDAA 2YSMA 3KV5A 4LADB 4ZQLA 3LQJA 5KH3A 2M85A 4N3WA 3U5MA 2NAAA 1N87A 3N9QA 4LLBA 3KV6A 3LQIA 2LXHC 3DPLR 3ASLA 5D1MB 2JMIA 2Y43A 4P5OB 2LQ6A 2ECGA 3L1ZB 2CKLB 4BBQA 4QF2A 5D1LB 4CCGX 2KWKA 2XEUA 3N9MA 2I50A 2UZGA 4BHWA 1LDJB 3O36A 5TDRA 2M3HA 1WIMA 2CKLA 5B8DA 2ECIA 2FSAA 2MD8C 3FL2A 3C6WA 4MVTA 4GNGA 2KWNA 2VJEA 2ECVA 2K17A 4GB0A 4UP0A 4I7BA 3M99A 4MSXA 2E6SA 5AITA 1WEOA 5LKZA 5LKUA 5B75A 2H0DB 2FUUA 2KGGA 1XWHA 3O70A 1Z2QA 4V3LC 5AIUA 4PPEA 1FP0A 3O7AA 5DKAA 4S3OB 5FEYA 2LGVA 2YSJA 3O35A 4X3GA 2M6MA 2H0DA 2K1JA 3DQVR 4S3OC 3EB6A 1VFYA 4R8PK 3ZPVE 5FERA 2L43A 3ZTGA 4LJNA 2MNYA 4AUQB 5EYAF 2MA6A 5TRBA 4A4BA 1WENA 5I3LA 1WILA 2ECTA 2KFTA 4YATA 4WZ3B 4B86C 4YAXA 5B79A 4I7CA 4FO9A 1E4UA 2MA5A 3KQIA 2C2LA 1U6GB 2KREA 4W4UA 3T7LA 5G05B 3HCTA 2PUYA 1JOCA 2LRIC 2JRJA 2KE1A 3O34A 3HCUA 3M62A 4L58A
chains in the Genus database with same CATH superfamily
3U5PA 2LGKA 2KU3A 2MUMA 3ZVYA 1HYIA 3ZPV1 5D1KB 1JM7B 2DX8A 2D8SA 4FK5A 4CA1A 2EGPA 3GL6A 5H1VA 2VJFB 4WA6A 1VD4A 5H1UA 5TDWA 4Z0OA 2VPGA 3LQHA 2YQLA 4LKAA 3SOUA 2G43A 3L1XA 2YUCA 2YURA 3QZVA 4TKPB 2DJAA 2YHOA 1BORA 2KR4A 2RSDA 2DSMA 2YU4A 4O64A 2L0BA 3ZVZB 2JMJA 2JMDA 4N4FA 4L7XA 5LCWB 1WEEA 5LKTA 3LRQA 2MNZA 1WEVA 5FB1A 4XI1A 2RR4A 2FUIA 2YT5A 3ZYQA 2D8UA 2HYED 2VP7A 2LXPC 1WEUA 3N9NA 5K3QA 2E6RA 2KIZA 3U5OA 2LAUA 2KGIA 5JG6A 5B77A 1Z60A 1WFKA 5KH9A 4AYCB 2K16A 3SOWA 1T1HA 2KYUA 2QICA 4YC9A 1DVPA 3Q1DA 4R2YA 1WE9A 4Q6FA 5B76A 3N9PA 1WEWA 1MM2A 2RI7A 2F42A 2JM3A 2Y1NA 3EB5A 2KWJA 2LDRA 4FIPA 5FB0A 4R7EA 2CSYA 3I2DA 3C5KA 3N9LA 3RPGB 1DCQA 3M63A 3FANA 2BAYA 4GNDA 5G0FA 1WEPA 4YADA 3RTRB 2VPBA 3PHDA 3L11A 3RPGC 5H9MA 3PURA 3KNVA 2ECNA 2YHNA 2XB1A 3NG2A 5H1TA 2QJ0A 5G04B 4YBSA 2ZETC 1WGMA 3KDEC 2C2VS 2XOCA 5J3XA 2MD7B 4IC2A 3N9OA 3FJUB 3O33A 4YBMA 2YREA 4LK9A 2QIZA 4OGEA 4H9DA 2VNFA 2YW8A 3U5NA 4AVXA 2MKEA 1V87A 3MHHA 4AP4A 4UI9B 5SVYA 3MDBC 2LGLA 2VPEA 2YQMA 4GNFA 4GNEA 4WZ2A 2CT2A 1IYMA 4ZDTA 2ECWA 3E2DA 4IC3A 1WESA 1JM7A 4A49A 1G25A 1K2FA 2AN6A 5TBNA 4UP5A 2Y1MA 2VJFA 1HYJA 1WEQA 4I7DA 3ZNIA 2CONA 1X4JA 2KWOA 1F62A 2XOZA 4A0CD 2F6JA 1WEMA 2VJEB 2K4DA 2VPDA 1RMDA 1LDKC 2LGGA 2EODA 2ECJA 2L5UA 3IHPA 4QQ4A 2P57A 3O37A 1CHCA 2E61A 5C13A 2MIQA 2MT5A 4F52B 2CSZA 2B0OE 3H7HA 3HCSA 5TABA 5C11A 1FBVA 2OXQC 5DINA 2G45A 3V43A 5KH7A 3HTKC 2L80A 2YYRA 4A4CA 2L75A 4WZ0A 1ZBDB 2EGMA 4FJCA 2G6QA 3SHBA 3LDYA 4F1PA 4AYCA 3GV4A 1VYXA 2EA6A 2F6NA 2M13A 2M1RA 4YBTA 1Z6UA 1MM3A 4C9ZA 2HDPA 3VK6A 2LN0A 2LV9A 3PUQA 5LKXA 3T6RA 3LVRE 4PTBA 1X4IA 4Z0RA 2CRWA 4YABA 1X4UA 4B7YC 2PNXA 5B78A 3MHSA 4ZUXU 4NN2A 3DDTA 4V3KC 2JUNA 3SOXA 3LJUX 4QF3A 2IDAA 2YSMA 3KV5A 4LADB 3FAOA 4ZQLA 5SVIB 3LQJA 5KH3A 2YVRA 2M85A 4N3WA 3U5MA 2NAAA 1N87A 3N9QA 4O62A 4LLBA 3KV6A 3LQIA 2LXHC 3DPLR 3ASLA 5SVIA 5D1MB 2JMIA 3SUBA 2Y43A 4P5OB 2LQ6A 3DWDA 2ECGA 3JUEA 2KKXA 3L1ZB 2CKLB 4BBQA 4QF2A 3O47A 5D1LB 3FEHA 4CCGX 2KWKA 3N9MA 2FD4A 2XEUA 2I50A 3FM8C 2UZGA 4BHWA 1LDJB 3O36A 5TDRA 2M3HA 1WIMA 2CKLA 5B8DA 2ECIA 2FSAA 2MD8C 3FL2A 3C6WA 4MVTA 4GNGA 2KWNA 2EXUA 2VJEA 2ECVA 2K17A 4GB0A 4UP0A 4I7BA 3M99A 4MSXA 2E6SA 3LVQE 5AITA 2FFWA 2XOYA 1WEOA 5LKZA 5LKUA 1MBMA 5B75A 2H0DB 2FUUA 2KGGA 1XWHA 3O70A 1Z2QA 5SVXA 4V3LC 5AIUA 4PPEA 1FP0A 3O7AA 5DKAA 4S3OB 5FEYA 2LGVA 2KKYA 2YSJA 3O35A 2OWAA 4X3GA 2M6MA 2H0DA 2K1JA 3DQVR 4S3OC 3EB6A 1VFYA 4R8PK 4OGCA 3ZPVE 5FERA 2L43A 3ZTGA 4LJNA 2MNYA 4AUQB 5EYAF 3PLWA 3M7KA 2MA6A 2CSVA 5TRBA 4A4BA 1WENA 5I3LA 1WILA 2ECTA 2KFTA 2L7PA 4YATA 4WZ3B 4B86C 4YAXA 5B79A 4I7CA 3T9KA 4FO9A 1E4UA 2MA5A 3KQIA 2CRRA 2C2LA 1U6GB 2KREA 4W4UA 3T7LA 5G05B 3HCTA 2PUYA 1JOCA 2LRIC 2XP0A 2JRJA 2KE1A 3O34A 3HCUA 3M62A 4L58A 2IQJA
chains in the Genus database with same CATH topology
3U5PA 2LGKA 2KU3A 2MUMA 3ZVYA 1HYIA 3ZPV1 5D1KB 1JM7B 2DX8A 2D8SA 4FK5A 4CA1A 2EGPA 3GL6A 5H1VA 2VJFB 4WA6A 1VD4A 5H1UA 5TDWA 2VPGA 3LQHA 2YQLA 4LKAA 3SOUA 2G43A 3L1XA 2YUCA 2YURA 3QZVA 4TKPB 2YHOA 1BORA 2KR4A 2RSDA 2YU4A 4O64A 2L0BA 3ZVZB 2JMJA 2JMDA 4N4FA 4L7XA 5LCWB 1WEEA 5LKTA 3LRQA 2MNZA 1WEVA 5FB1A 4XI1A 2FUIA 2YT5A 3ZYQA 2HYED 2VP7A 2LXPC 1WEUA 3N9NA 2E6RA 2KIZA 3U5OA 2KGIA 5JG6A 5B77A 1Z60A 1WFKA 5KH9A 4AYCB 2K16A 3SOWA 1T1HA 2KYUA 2QICA 4YC9A 1DVPA 4R2YA 1WE9A 4Q6FA 5B76A 3N9PA 1WEWA 1MM2A 2RI7A 2F42A 2Y1NA 3EB5A 2KWJA 2LDRA 4FIPA 5FB0A 4R7EA 2CSYA 3I2DA 3C5KA 3N9LA 3RPGB 3M63A 2BAYA 4GNDA 5G0FA 1WEPA 4YADA 3RTRB 2VPBA 3PHDA 3L11A 3RPGC 5H9MA 3PURA 3KNVA 2ECNA 2YHNA 2XB1A 3NG2A 5H1TA 2QJ0A 5G04B 4YBSA 2ZETC 1WGMA 2C2VS 5J3XA 2MD7B 4IC2A 3N9OA 3O33A 4YBMA 2YREA 4LK9A 2QIZA 2VNFA 2YW8A 3U5NA 4AVXA 1V87A 3MHHA 4AP4A 4UI9B 2LGLA 2VPEA 2YQMA 4GNFA 4GNEA 4WZ2A 2CT2A 1IYMA 4ZDTA 2ECWA 4IC3A 1WESA 1JM7A 4A49A 1G25A 1K2FA 2AN6A 5TBNA 4UP5A 2Y1MA 2VJFA 1HYJA 1WEQA 4I7DA 3ZNIA 1X4JA 2KWOA 1F62A 4A0CD 2F6JA 1WEMA 2VJEB 2K4DA 2VPDA 1RMDA 1LDKC 2LGGA 2EODA 2ECJA 2L5UA 3IHPA 3O37A 1CHCA 5C13A 2MIQA 2MT5A 4F52B 2CSZA 3HCSA 5TABA 5C11A 1FBVA 2OXQC 5DINA 2G45A 3V43A 5KH7A 3HTKC 2L80A 2YYRA 4A4CA 2L75A 4WZ0A 1ZBDB 3SHBA 4FJCA 2G6QA 4AYCA 3GV4A 1VYXA 2EA6A 2F6NA 2M1RA 4YBTA 1Z6UA 1MM3A 4C9ZA 2HDPA 3VK6A 2LN0A 2LV9A 3PUQA 5LKXA 3T6RA 4PTBA 1X4IA 4YABA 1X4UA 4B7YC 2PNXA 5B78A 3MHSA 4ZUXU 4NN2A 4V3KC 3SOXA 4QF3A 2IDAA 2YSMA 3KV5A 4LADB 4ZQLA 3LQJA 5KH3A 2M85A 4N3WA 3U5MA 2NAAA 1N87A 3N9QA 4LLBA 3KV6A 3LQIA 2LXHC 3DPLR 3ASLA 5D1MB 2JMIA 2Y43A 4P5OB 2LQ6A 2ECGA 3L1ZB 2CKLB 4BBQA 4QF2A 5D1LB 4CCGX 2KWKA 2XEUA 3N9MA 2I50A 2UZGA 4BHWA 1LDJB 3O36A 5TDRA 2M3HA 1WIMA 2CKLA 5B8DA 2ECIA 2FSAA 2MD8C 3FL2A 3C6WA 4MVTA 4GNGA 2KWNA 2VJEA 2ECVA 2K17A 4GB0A 4UP0A 4I7BA 3M99A 4MSXA 2E6SA 5AITA 1WEOA 5LKZA 5LKUA 5B75A 2H0DB 2FUUA 2KGGA 1XWHA 3O70A 1Z2QA 4V3LC 5AIUA 4PPEA 1FP0A 3O7AA 5DKAA 4S3OB 5FEYA 2LGVA 2YSJA 3O35A 4X3GA 2M6MA 2H0DA 2K1JA 3DQVR 4S3OC 3EB6A 1VFYA 4R8PK 3ZPVE 5FERA 2L43A 3ZTGA 4LJNA 2MNYA 4AUQB 5EYAF 2MA6A 5TRBA 4A4BA 1WENA 5I3LA 1WILA 2ECTA 2KFTA 4YATA 4WZ3B 4B86C 4YAXA 5B79A 4I7CA 4FO9A 1E4UA 2MA5A 3KQIA 2C2LA 1U6GB 2KREA 4W4UA 3T7LA 5G05B 3HCTA 2PUYA 1JOCA 2LRIC 2JRJA 2KE1A 3O34A 3HCUA 3M62A 4L58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5P A;  2LGK A;  2KU3 A;  2MUM A;  3ZVY A;  1HYI A;  3ZPV 1;  5D1K B;  1JM7 B;  2DX8 A;  2D8S A;  4FK5 A;  4CA1 A;  2EGP A;  3GL6 A;  5H1V A;  2VJF B;  4WA6 A;  1VD4 A;  5H1U A;  5TDW A;  2VPG A;  3LQH A;  2YQL A;  4LKA A;  3SOU A;  2G43 A;  3L1X A;  2YUC A;  2YUR A;  3QZV A;  4TKP B;  2YHO A;  1BOR A;  2KR4 A;  2RSD A;  2YU4 A;  4O64 A;  2L0B A;  3ZVZ B;  2JMJ A;  2JMD A;  4N4F A;  4L7X A;  5LCW B;  1WEE A;  5LKT A;  3LRQ A;  2MNZ A;  1WEV A;  5FB1 A;  4XI1 A;  2FUI A;  2YT5 A;  3ZYQ A;  2HYE D;  2VP7 A;  2LXP C;  1WEU A;  3N9N A;  2E6R A;  2KIZ A;  3U5O A;  2KGI A;  5JG6 A;  5B77 A;  1Z60 A;  1WFK A;  5KH9 A;  4AYC B;  2K16 A;  3SOW A;  1T1H A;  2KYU A;  2QIC A;  4YC9 A;  1DVP A;  4R2Y A;  1WE9 A;  4Q6F A;  5B76 A;  3N9P A;  1WEW A;  1MM2 A;  2RI7 A;  2F42 A;  2Y1N A;  3EB5 A;  2KWJ A;  2LDR A;  4FIP A;  5FB0 A;  4R7E A;  2CSY A;  3I2D A;  3C5K A;  3N9L A;  3RPG B;  3M63 A;  2BAY A;  4GND A;  5G0F A;  1WEP A;  4YAD A;  3RTR B;  2VPB A;  3PHD A;  3L11 A;  3RPG C;  5H9M A;  3PUR A;  3KNV A;  2ECN A;  2YHN A;  2XB1 A;  3NG2 A;  5H1T A;  2QJ0 A;  5G04 B;  4YBS A;  2ZET C;  1WGM A;  2C2V S;  5J3X A;  2MD7 B;  4IC2 A;  3N9O A;  3O33 A;  4YBM A;  2YRE A;  4LK9 A;  2QIZ A;  2VNF A;  2YW8 A;  3U5N A;  4AVX A;  1V87 A;  3MHH A;  4AP4 A;  4UI9 B;  2LGL A;  2VPE A;  2YQM A;  4GNF A;  4GNE A;  4WZ2 A;  2CT2 A;  1IYM A;  4ZDT A;  2ECW A;  4IC3 A;  1WES A;  1JM7 A;  4A49 A;  1G25 A;  1K2F A;  2AN6 A;  5TBN A;  4UP5 A;  2Y1M A;  2VJF A;  1HYJ A;  1WEQ A;  4I7D A;  3ZNI A;  1X4J A;  2KWO A;  1F62 A;  4A0C D;  2F6J A;  1WEM A;  2VJE B;  2K4D A;  2VPD A;  1RMD A;  1LDK C;  2LGG A;  2EOD A;  2ECJ A;  2L5U A;  3IHP A;  3O37 A;  1CHC A;  5C13 A;  2MIQ A;  2MT5 A;  4F52 B;  2CSZ A;  3HCS A;  5TAB A;  5C11 A;  1FBV A;  2OXQ C;  5DIN A;  2G45 A;  3V43 A;  5KH7 A;  3HTK C;  2L80 A;  2YYR A;  4A4C A;  2L75 A;  4WZ0 A;  1ZBD B;  3SHB A;  4FJC A;  2G6Q A;  4AYC A;  3GV4 A;  1VYX A;  2EA6 A;  2F6N A;  2M1R A;  4YBT A;  1Z6U A;  1MM3 A;  4C9Z A;  2HDP A;  3VK6 A;  2LN0 A;  2LV9 A;  3PUQ A;  5LKX A;  3T6R A;  4PTB A;  1X4I A;  4YAB A;  1X4U A;  4B7Y C;  2PNX A;  5B78 A;  3MHS A;  4ZUX U;  4NN2 A;  4V3K C;  3SOX A;  4QF3 A;  2IDA A;  2YSM A;  3KV5 A;  4LAD B;  4ZQL A;  3LQJ A;  5KH3 A;  2M85 A;  4N3W A;  3U5M A;  2NAA A;  1N87 A;  3N9Q A;  4LLB A;  3KV6 A;  3LQI A;  2LXH C;  3DPL R;  3ASL A;  5D1M B;  2JMI A;  2Y43 A;  4P5O B;  2LQ6 A;  2ECG A;  3L1Z B;  2CKL B;  4BBQ A;  4QF2 A;  5D1L B;  4CCG X;  2KWK A;  2XEU A;  3N9M A;  2I50 A;  2UZG A;  4BHW A;  1LDJ B;  3O36 A;  5TDR A;  2M3H A;  1WIM A;  2CKL A;  5B8D A;  2ECI A;  2FSA A;  2MD8 C;  3FL2 A;  3C6W A;  4MVT A;  4GNG A;  2KWN A;  2VJE A;  2ECV A;  2K17 A;  4GB0 A;  4UP0 A;  4I7B A;  3M99 A;  4MSX A;  2E6S A;  5AIT A;  1WEO A;  5LKZ A;  5LKU A;  5B75 A;  2H0D B;  2FUU A;  2KGG A;  1XWH A;  3O70 A;  1Z2Q A;  4V3L C;  5AIU A;  4PPE A;  1FP0 A;  3O7A A;  5DKA A;  4S3O B;  5FEY A;  2LGV A;  2YSJ A;  3O35 A;  4X3G A;  2M6M A;  2H0D A;  2K1J A;  3DQV R;  4S3O C;  3EB6 A;  1VFY A;  4R8P K;  3ZPV E;  5FER A;  2L43 A;  3ZTG A;  4LJN A;  2MNY A;  4AUQ B;  5EYA F;  2MA6 A;  5TRB A;  4A4B A;  1WEN A;  5I3L A;  1WIL A;  2ECT A;  2KFT A;  4YAT A;  4WZ3 B;  4B86 C;  4YAX A;  5B79 A;  4I7C A;  4FO9 A;  1E4U A;  2MA5 A;  3KQI A;  2C2L A;  1U6G B;  2KRE A;  4W4U A;  3T7L A;  5G05 B;  3HCT A;  2PUY A;  1JOC A;  2LRI C;  2JRJ A;  2KE1 A;  3O34 A;  3HCU A;  3M62 A;  4L58 A; 
#chains in the Genus database with same CATH topology
 3U5P A;  2LGK A;  2KU3 A;  2MUM A;  3ZVY A;  1HYI A;  3ZPV 1;  5D1K B;  1JM7 B;  2DX8 A;  2D8S A;  4FK5 A;  4CA1 A;  2EGP A;  3GL6 A;  5H1V A;  2VJF B;  4WA6 A;  1VD4 A;  5H1U A;  5TDW A;  4Z0O A;  2VPG A;  3LQH A;  2YQL A;  4LKA A;  3SOU A;  2G43 A;  3L1X A;  2YUC A;  2YUR A;  3QZV A;  4TKP B;  2DJA A;  2YHO A;  1BOR A;  2KR4 A;  2RSD A;  2DSM A;  2YU4 A;  4O64 A;  2L0B A;  3ZVZ B;  2JMJ A;  2JMD A;  4N4F A;  4L7X A;  5LCW B;  1WEE A;  5LKT A;  3LRQ A;  2MNZ A;  1WEV A;  5FB1 A;  4XI1 A;  2RR4 A;  2FUI A;  2YT5 A;  3ZYQ A;  2D8U A;  2HYE D;  2VP7 A;  2LXP C;  1WEU A;  3N9N A;  5K3Q A;  2E6R A;  2KIZ A;  3U5O A;  2LAU A;  2KGI A;  5JG6 A;  5B77 A;  1Z60 A;  1WFK A;  5KH9 A;  4AYC B;  2K16 A;  3SOW A;  1T1H A;  2KYU A;  2QIC A;  4YC9 A;  1DVP A;  3Q1D A;  4R2Y A;  1WE9 A;  4Q6F A;  5B76 A;  3N9P A;  1WEW A;  1MM2 A;  2RI7 A;  2F42 A;  2JM3 A;  2Y1N A;  3EB5 A;  2KWJ A;  2LDR A;  4FIP A;  5FB0 A;  4R7E A;  2CSY A;  3I2D A;  3C5K A;  3N9L A;  3RPG B;  1DCQ A;  3M63 A;  3FAN A;  2BAY A;  4GND A;  5G0F A;  1WEP A;  4YAD A;  3RTR B;  2VPB A;  3PHD A;  3L11 A;  3RPG C;  5H9M A;  3PUR A;  3KNV A;  2ECN A;  2YHN A;  2XB1 A;  3NG2 A;  5H1T A;  2QJ0 A;  5G04 B;  4YBS A;  2ZET C;  1WGM A;  3KDE C;  2C2V S;  2XOC A;  5J3X A;  2MD7 B;  4IC2 A;  3N9O A;  3FJU B;  3O33 A;  4YBM A;  2YRE A;  4LK9 A;  2QIZ A;  4OGE A;  4H9D A;  2VNF A;  2YW8 A;  3U5N A;  4AVX A;  2MKE A;  1V87 A;  3MHH A;  4AP4 A;  4UI9 B;  5SVY A;  3MDB C;  2LGL A;  2VPE A;  2YQM A;  4GNF A;  4GNE A;  4WZ2 A;  2CT2 A;  1IYM A;  4ZDT A;  2ECW A;  3E2D A;  4IC3 A;  1WES A;  1JM7 A;  4A49 A;  1G25 A;  1K2F A;  2AN6 A;  5TBN A;  4UP5 A;  2Y1M A;  2VJF A;  1HYJ A;  1WEQ A;  4I7D A;  3ZNI A;  2CON A;  1X4J A;  2KWO A;  1F62 A;  2XOZ A;  4A0C D;  2F6J A;  1WEM A;  2VJE B;  2K4D A;  2VPD A;  1RMD A;  1LDK C;  2LGG A;  2EOD A;  2ECJ A;  2L5U A;  3IHP A;  4QQ4 A;  2P57 A;  3O37 A;  1CHC A;  2E61 A;  5C13 A;  2MIQ A;  2MT5 A;  4F52 B;  2CSZ A;  2B0O E;  3H7H A;  3HCS A;  5TAB A;  5C11 A;  1FBV A;  2OXQ C;  5DIN A;  2G45 A;  3V43 A;  5KH7 A;  3HTK C;  2L80 A;  2YYR A;  4A4C A;  2L75 A;  4WZ0 A;  1ZBD B;  2EGM A;  4FJC A;  2G6Q A;  3SHB A;  3LDY A;  4F1P A;  4AYC A;  3GV4 A;  1VYX A;  2EA6 A;  2F6N A;  2M13 A;  2M1R A;  4YBT A;  1Z6U A;  1MM3 A;  4C9Z A;  2HDP A;  3VK6 A;  2LN0 A;  2LV9 A;  3PUQ A;  5LKX A;  3T6R A;  3LVR E;  4PTB A;  1X4I A;  4Z0R A;  2CRW A;  4YAB A;  1X4U A;  4B7Y C;  2PNX A;  5B78 A;  3MHS A;  4ZUX U;  4NN2 A;  3DDT A;  4V3K C;  2JUN A;  3SOX A;  3LJU X;  4QF3 A;  2IDA A;  2YSM A;  3KV5 A;  4LAD B;  3FAO A;  4ZQL A;  5SVI B;  3LQJ A;  5KH3 A;  2YVR A;  2M85 A;  4N3W A;  3U5M A;  2NAA A;  1N87 A;  3N9Q A;  4O62 A;  4LLB A;  3KV6 A;  3LQI A;  2LXH C;  3DPL R;  3ASL A;  5SVI A;  5D1M B;  2JMI A;  3SUB A;  2Y43 A;  4P5O B;  2LQ6 A;  3DWD A;  2ECG A;  3JUE A;  2KKX A;  3L1Z B;  2CKL B;  4BBQ A;  4QF2 A;  3O47 A;  5D1L B;  3FEH A;  4CCG X;  2KWK A;  3N9M A;  2FD4 A;  2XEU A;  2I50 A;  3FM8 C;  2UZG A;  4BHW A;  1LDJ B;  3O36 A;  5TDR A;  2M3H A;  1WIM A;  2CKL A;  5B8D A;  2ECI A;  2FSA A;  2MD8 C;  3FL2 A;  3C6W A;  4MVT A;  4GNG A;  2KWN A;  2EXU A;  2VJE A;  2ECV A;  2K17 A;  4GB0 A;  4UP0 A;  4I7B A;  3M99 A;  4MSX A;  2E6S A;  3LVQ E;  5AIT A;  2FFW A;  2XOY A;  1WEO A;  5LKZ A;  5LKU A;  1MBM A;  5B75 A;  2H0D B;  2FUU A;  2KGG A;  1XWH A;  3O70 A;  1Z2Q A;  5SVX A;  4V3L C;  5AIU A;  4PPE A;  1FP0 A;  3O7A A;  5DKA A;  4S3O B;  5FEY A;  2LGV A;  2KKY A;  2YSJ A;  3O35 A;  2OWA A;  4X3G A;  2M6M A;  2H0D A;  2K1J A;  3DQV R;  4S3O C;  3EB6 A;  1VFY A;  4R8P K;  4OGC A;  3ZPV E;  5FER A;  2L43 A;  3ZTG A;  4LJN A;  2MNY A;  4AUQ B;  5EYA F;  3PLW A;  3M7K A;  2MA6 A;  2CSV A;  5TRB A;  4A4B A;  1WEN A;  5I3L A;  1WIL A;  2ECT A;  2KFT A;  2L7P A;  4YAT A;  4WZ3 B;  4B86 C;  4YAX A;  5B79 A;  4I7C A;  3T9K A;  4FO9 A;  1E4U A;  2MA5 A;  3KQI A;  2CRR A;  2C2L A;  1U6G B;  2KRE A;  4W4U A;  3T7L A;  5G05 B;  3HCT A;  2PUY A;  1JOC A;  2LRI C;  2XP0 A;  2JRJ A;  2KE1 A;  3O34 A;  3HCU A;  3M62 A;  4L58 A;  2IQJ A; 
#chains in the Genus database with same CATH homology
 3U5P A;  2LGK A;  2KU3 A;  2MUM A;  3ZVY A;  1HYI A;  3ZPV 1;  5D1K B;  1JM7 B;  2DX8 A;  2D8S A;  4FK5 A;  4CA1 A;  2EGP A;  3GL6 A;  5H1V A;  2VJF B;  4WA6 A;  1VD4 A;  5H1U A;  5TDW A;  2VPG A;  3LQH A;  2YQL A;  4LKA A;  3SOU A;  2G43 A;  3L1X A;  2YUC A;  2YUR A;  3QZV A;  4TKP B;  2YHO A;  1BOR A;  2KR4 A;  2RSD A;  2YU4 A;  4O64 A;  2L0B A;  3ZVZ B;  2JMJ A;  2JMD A;  4N4F A;  4L7X A;  5LCW B;  1WEE A;  5LKT A;  3LRQ A;  2MNZ A;  1WEV A;  5FB1 A;  4XI1 A;  2FUI A;  2YT5 A;  3ZYQ A;  2HYE D;  2VP7 A;  2LXP C;  1WEU A;  3N9N A;  2E6R A;  2KIZ A;  3U5O A;  2KGI A;  5JG6 A;  5B77 A;  1Z60 A;  1WFK A;  5KH9 A;  4AYC B;  2K16 A;  3SOW A;  1T1H A;  2KYU A;  2QIC A;  4YC9 A;  1DVP A;  4R2Y A;  1WE9 A;  4Q6F A;  5B76 A;  3N9P A;  1WEW A;  1MM2 A;  2RI7 A;  2F42 A;  2Y1N A;  3EB5 A;  2KWJ A;  2LDR A;  4FIP A;  5FB0 A;  4R7E A;  2CSY A;  3I2D A;  3C5K A;  3N9L A;  3RPG B;  3M63 A;  2BAY A;  4GND A;  5G0F A;  1WEP A;  4YAD A;  3RTR B;  2VPB A;  3PHD A;  3L11 A;  3RPG C;  5H9M A;  3PUR A;  3KNV A;  2ECN A;  2YHN A;  2XB1 A;  3NG2 A;  5H1T A;  2QJ0 A;  5G04 B;  4YBS A;  2ZET C;  1WGM A;  2C2V S;  5J3X A;  2MD7 B;  4IC2 A;  3N9O A;  3O33 A;  4YBM A;  2YRE A;  4LK9 A;  2QIZ A;  2VNF A;  2YW8 A;  3U5N A;  4AVX A;  1V87 A;  3MHH A;  4AP4 A;  4UI9 B;  2LGL A;  2VPE A;  2YQM A;  4GNF A;  4GNE A;  4WZ2 A;  2CT2 A;  1IYM A;  4ZDT A;  2ECW A;  4IC3 A;  1WES A;  1JM7 A;  4A49 A;  1G25 A;  1K2F A;  2AN6 A;  5TBN A;  4UP5 A;  2Y1M A;  2VJF A;  1HYJ A;  1WEQ A;  4I7D A;  3ZNI A;  1X4J A;  2KWO A;  1F62 A;  4A0C D;  2F6J A;  1WEM A;  2VJE B;  2K4D A;  2VPD A;  1RMD A;  1LDK C;  2LGG A;  2EOD A;  2ECJ A;  2L5U A;  3IHP A;  3O37 A;  1CHC A;  5C13 A;  2MIQ A;  2MT5 A;  4F52 B;  2CSZ A;  3HCS A;  5TAB A;  5C11 A;  1FBV A;  2OXQ C;  5DIN A;  2G45 A;  3V43 A;  5KH7 A;  3HTK C;  2L80 A;  2YYR A;  4A4C A;  2L75 A;  4WZ0 A;  1ZBD B;  3SHB A;  4FJC A;  2G6Q A;  4AYC A;  3GV4 A;  1VYX A;  2EA6 A;  2F6N A;  2M1R A;  4YBT A;  1Z6U A;  1MM3 A;  4C9Z A;  2HDP A;  3VK6 A;  2LN0 A;  2LV9 A;  3PUQ A;  5LKX A;  3T6R A;  4PTB A;  1X4I A;  4YAB A;  1X4U A;  4B7Y C;  2PNX A;  5B78 A;  3MHS A;  4ZUX U;  4NN2 A;  4V3K C;  3SOX A;  4QF3 A;  2IDA A;  2YSM A;  3KV5 A;  4LAD B;  4ZQL A;  3LQJ A;  5KH3 A;  2M85 A;  4N3W A;  3U5M A;  2NAA A;  1N87 A;  3N9Q A;  4LLB A;  3KV6 A;  3LQI A;  2LXH C;  3DPL R;  3ASL A;  5D1M B;  2JMI A;  2Y43 A;  4P5O B;  2LQ6 A;  2ECG A;  3L1Z B;  2CKL B;  4BBQ A;  4QF2 A;  5D1L B;  4CCG X;  2KWK A;  2XEU A;  3N9M A;  2I50 A;  2UZG A;  4BHW A;  1LDJ B;  3O36 A;  5TDR A;  2M3H A;  1WIM A;  2CKL A;  5B8D A;  2ECI A;  2FSA A;  2MD8 C;  3FL2 A;  3C6W A;  4MVT A;  4GNG A;  2KWN A;  2VJE A;  2ECV A;  2K17 A;  4GB0 A;  4UP0 A;  4I7B A;  3M99 A;  4MSX A;  2E6S A;  5AIT A;  1WEO A;  5LKZ A;  5LKU A;  5B75 A;  2H0D B;  2FUU A;  2KGG A;  1XWH A;  3O70 A;  1Z2Q A;  4V3L C;  5AIU A;  4PPE A;  1FP0 A;  3O7A A;  5DKA A;  4S3O B;  5FEY A;  2LGV A;  2YSJ A;  3O35 A;  4X3G A;  2M6M A;  2H0D A;  2K1J A;  3DQV R;  4S3O C;  3EB6 A;  1VFY A;  4R8P K;  3ZPV E;  5FER A;  2L43 A;  3ZTG A;  4LJN A;  2MNY A;  4AUQ B;  5EYA F;  2MA6 A;  5TRB A;  4A4B A;  1WEN A;  5I3L A;  1WIL A;  2ECT A;  2KFT A;  4YAT A;  4WZ3 B;  4B86 C;  4YAX A;  5B79 A;  4I7C A;  4FO9 A;  1E4U A;  2MA5 A;  3KQI A;  2C2L A;  1U6G B;  2KRE A;  4W4U A;  3T7L A;  5G05 B;  3HCT A;  2PUY A;  1JOC A;  2LRI C;  2JRJ A;  2KE1 A;  3O34 A;  3HCU A;  3M62 A;  4L58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...