5TDRA

Set3 phd finger in complex with histone h3k4me2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MGIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SET domain-containing protein 3
publication title Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tdrA00
2HYED 4W4UA 1X4IA 2YURA 1LDJB 2JMJA 5H1VA 1WEEA 2MT5A 4MSXA 3RPGB 4YAXA 3ZPV1 3L1ZB 1WEOA 2KYUA 4LLBA 2LDRA 2LGGA 4A0CD 1WEWA 5JG6A 4GNEA 2LV9A 2LN0A 2MD8C 2QIZA 5C11A 2JMIA 2K17A 2EODA 3L11A 3LQIA 5KH3A 2EGPA 2K1JA 2ECJA 4Q6FA 3SOUA 2KFTA 3O70A 3M99A 2ZETC 1MM3A 2L75A 2QJ0A 4S3OB 4CCGX 4I7CA 2CT2A 2M6MA 1VD4A 4ZUXU 1HYIA 4WA6A 2NAAA 3O36A 4GNFA 2G6QA 2CSYA 4FIPA 2KIZA 3KQIA 5D1MB 1IYMA 1RMDA 3HTKC 4O64A 2VJEB 2EA6A 2YHNA 3KNVA 2K16A 2YW8A 1LDKC 5B79A 1WEQA 1HYJA 4AYCB 4FJCA 5EYAF 2XB1A 2YREA 3EB5A 2VPEA 3GL6A 2E6SA 4BHWA 2Y43A 1WENA 4LK9A 2C2VS 2KR4A 5TRBA 3PHDA 2LGVA 4QF2A 3SHBA 4B86C 2MNYA 3KV5A 1WEUA 2YU4A 4UP5A 3LRQA 4IC3A 2KGIA 2MIQA 3U5OA 3PUQA 1N87A 5AITA 3O37A 2ECVA 4N3WA 1JOCA 2KE1A 4GNDA 5LKUA 2F6NA 2ECTA 4R7EA 2VJEA 1MM2A 5FEYA 4CA1A 2MA6A 2Y1MA 3QZVA 1V87A 2K4DA 2JMDA 2VJFB 2H0DB 3N9MA 1K2FA 4PPEA 5H1UA 2ECIA 3VK6A 4ZQLA 5H9MA 1WESA 2YQMA 4YBTA 3ASLA 5FB0A 2YT5A 4B7YC 4YABA 3O35A 4BBQA 5TBNA 5B78A 2C2LA 5DKAA 4FK5A 1T1HA 5LCWB 3U5PA 2L43A 2VP7A 2RI7A 3T6RA 4F52B 2MNZA 3N9LA 5LKZA 2YSJA 1ZBDB 4I7BA 4MVTA 2LRIC 3LQHA 2JRJA 2L5UA 2CKLB 2IDAA 4LJNA 2XEUA 3L1XA 3I2DA 5FB1A 2MD7B 2E6RA 5B8DA 4C9ZA 1JM7B 3PURA 4V3KC 2LGLA 4N4FA 2H0DA 3LQJA 2ECWA 3N9QA 4A49A 1VFYA 3C6WA 3O33A 4P5OB 2PUYA 3N9NA 5J3XA 1U6GB 3V43A 4LADB 5DINA 4YBMA 2ECNA 1CHCA 4AVXA 5C13A 3SOWA 2L0BA 3HCUA 4NN2A 2UZGA 2CKLA 2VNFA 3KV6A 2OXQC 2FUUA 2KWNA 2KWOA 3ZYQA 5D1LB 3EB6A 2KWJA 1E4UA 4TKPB 1XWHA 3N9PA 2KGGA 3HCSA 3ZTGA 5KH9A 2M1RA 2HDPA 1JM7A 5I3LA 2QICA 5AIUA 2KU3A 4WZ2A 1Z2QA 4GB0A 1WE9A 3RPGC 4AYCA 3T7LA 3ZVZB 3FL2A 2MUMA 2FSAA 4IC2A 3HCTA 3O7AA 2G45A 3DPLR 3MHHA 1FP0A 2L80A 2RSDA 1X4JA 2YHOA 4YC9A 1DVPA 2CSZA 2D8SA 4X3GA 1F62A 3M63A 2M85A 2I50A 5B76A 5B75A 5TDWA 2YYRA 2YQLA 4L7XA 4UI9B 2DX8A 3ZNIA 3GV4A 5H1TA 4S3OC 4FO9A 5G04B 3SOXA 1G25A 4I7DA 4WZ0A 4QF3A 2YSMA 1VYXA 1WIMA 3MHSA 2F42A 2LXPC 2VJFA 2VPGA 1WEPA 5G0FA 2FUIA 2G43A 5TDRA 2LXHC 1Z60A 2Y1NA 2VPBA 1Z6UA 2LQ6A 1BORA 2M3HA 4AUQB 3U5MA 4XI1A 3ZVYA 4YADA 2KREA 2BAYA 5TABA 5B77A 4A4BA 1WFKA 4V3LC 2F6JA 4WZ3B 1WILA 2PNXA 2AN6A 5D1KB 4PTBA 3ZPVE 5KH7A 4YBSA 3DQVR 3IHPA 1WGMA 2LGKA 2YUCA 3C5KA 4LKAA 1FBVA 2ECGA 3NG2A 4ZDTA 3N9OA 4AP4A 4R8PK 5LKTA 2KWKA 4R2YA 4UP0A 4A4CA 5LKXA 3RTRB 5G05B 1X4UA 3U5NA 1WEMA 4YATA 5FERA 1WEVA 2VPDA 3M62A 4L58A 3O34A 4GNGA 2MA5A
chains in the Genus database with same CATH superfamily
2HYED 4W4UA 1X4IA 2YURA 1LDJB 2JMJA 5H1VA 4H9DA 1WEEA 2MT5A 4MSXA 3RPGB 4YAXA 3SUBA 3ZPV1 2KKXA 3L1ZB 1WEOA 3O47A 2KYUA 4LLBA 2LAUA 2LDRA 2LGGA 4A0CD 1WEWA 5JG6A 4GNEA 2LV9A 2LN0A 3LVRE 2MD8C 2QIZA 2XOYA 5C11A 2JMIA 2K17A 2EODA 3L11A 3LQIA 5KH3A 2EGPA 2K1JA 2ECJA 4Q6FA 3SOUA 2KFTA 3LJUX 3O70A 5SVYA 3FM8C 2M13A 3M99A 2ZETC 1MM3A 2L75A 2QJ0A 4S3OB 4CCGX 4I7CA 2CT2A 2M6MA 3T9KA 2CSVA 1VD4A 4ZUXU 1HYIA 4WA6A 2NAAA 4QQ4A 3O36A 4GNFA 2G6QA 4Z0RA 2CSYA 5SVIA 3PLWA 4FIPA 2KIZA 3KQIA 5D1MB 1IYMA 1RMDA 3HTKC 4O64A 2DSMA 2VJEB 2EA6A 2YHNA 3KNVA 2K16A 2YW8A 1LDKC 5B79A 1WEQA 1HYJA 2FFWA 4AYCB 4FJCA 5EYAF 2XB1A 2YREA 3EB5A 2VPEA 3GL6A 2E6SA 4Z0OA 4BHWA 1DCQA 2Y43A 1WENA 4LK9A 4OGCA 2C2VS 2KR4A 5TRBA 3PHDA 2LGVA 4QF2A 3SHBA 4B86C 2MNYA 2KKYA 3KV5A 2JM3A 3H7HA 1WEUA 2YU4A 5K3QA 2CRWA 4UP5A 3LRQA 4IC3A 2KGIA 2YVRA 2MIQA 3U5OA 3PUQA 1N87A 5AITA 3O37A 2ECVA 4F1PA 4N3WA 1JOCA 2KE1A 4GNDA 5LKUA 2F6NA 2ECTA 4R7EA 3FJUB 2VJEA 1MM2A 5FEYA 4CA1A 2MA6A 2Y1MA 3QZVA 1V87A 2K4DA 2JMDA 2VJFB 2H0DB 3N9MA 1K2FA 4PPEA 5H1UA 2ECIA 2P57A 3VK6A 4ZQLA 5H9MA 1WESA 2YQMA 4YBTA 3ASLA 5FB0A 2YT5A 4B7YC 4YABA 3O35A 3LDYA 4BBQA 5TBNA 5B78A 2C2LA 5DKAA 4FK5A 1T1HA 5LCWB 3U5PA 2L43A 2VP7A 2RI7A 3T6RA 4F52B 2MNZA 3N9LA 5LKZA 2XOCA 2YSJA 1ZBDB 4I7BA 4MVTA 2LRIC 3LQHA 2JRJA 2L7PA 2L5UA 2CKLB 2IDAA 4LJNA 2XEUA 3L1XA 3I2DA 5FB1A 2MD7B 2E6RA 5B8DA 2DJAA 4C9ZA 1JM7B 3PURA 4V3KC 2LGLA 4N4FA 2H0DA 3LQJA 2ECWA 3N9QA 4A49A 1VFYA 3C6WA 3O33A 4P5OB 3DDTA 2PUYA 3N9NA 5J3XA 1U6GB 3V43A 4LADB 5DINA 4YBMA 2ECNA 1CHCA 4AVXA 5C13A 2CONA 3SOWA 2L0BA 2MKEA 4NN2A 3HCUA 2UZGA 2CKLA 2VNFA 3KV6A 2OXQC 2XP0A 2FUUA 2KWNA 2IQJA 2KWOA 3ZYQA 5D1LB 3EB6A 2KWJA 1E4UA 4TKPB 1XWHA 3FEHA 3N9PA 2KGGA 3HCSA 3ZTGA 1MBMA 5KH9A 2M1RA 3E2DA 2HDPA 1JM7A 5I3LA 3DWDA 2QICA 5AIUA 2KU3A 4WZ2A 1Z2QA 4GB0A 1WE9A 5SVIB 3RPGC 4AYCA 3T7LA 2EXUA 3ZVZB 3FL2A 2MUMA 2FSAA 4IC2A 3HCTA 4OGEA 3FAOA 3O7AA 2JUNA 2G45A 3DPLR 3MHHA 1FP0A 2L80A 2RSDA 4O62A 1X4JA 2YHOA 4YC9A 1DVPA 2CSZA 2D8SA 3FANA 4X3GA 1F62A 3M63A 2M85A 2I50A 3JUEA 5B76A 5B75A 5TDWA 2YYRA 2YQLA 4L7XA 4UI9B 2DX8A 3ZNIA 2XOZA 3GV4A 5H1TA 4S3OC 4FO9A 5G04B 3SOXA 2RR4A 1G25A 4I7DA 4WZ0A 2EGMA 4QF3A 2YSMA 1VYXA 1WIMA 3MHSA 2LXPC 2FD4A 2VJFA 2VPGA 1WEPA 5G0FA 2FUIA 2G43A 5TDRA 2OWAA 3KDEC 2CRRA 2LXHC 1Z60A 2MA5A 2Y1NA 3M7KA 2VPBA 2E61A 1Z6UA 2LQ6A 3MDBC 1BORA 2M3HA 4AUQB 3U5MA 4XI1A 3ZVYA 4YADA 2KREA 2BAYA 5TABA 5B77A 2B0OE 4A4BA 1WFKA 4V3LC 2F6JA 4WZ3B 1WILA 2PNXA 2AN6A 3LVQE 5D1KB 4PTBA 3ZPVE 5KH7A 4YBSA 3DQVR 3IHPA 1WGMA 2LGKA 2YUCA 3C5KA 4LKAA 1FBVA 2ECGA 3NG2A 4ZDTA 3N9OA 4AP4A 5SVXA 3Q1DA 4R8PK 5LKTA 2KWKA 4R2YA 2D8UA 4UP0A 4A4CA 5LKXA 3RTRB 5G05B 1X4UA 3U5NA 1WEMA 4YATA 5FERA 1WEVA 2VPDA 3M62A 4L58A 3O34A 4GNGA 2F42A
chains in the Genus database with same CATH topology
2HYED 4W4UA 1X4IA 2YURA 1LDJB 2JMJA 5H1VA 1WEEA 2MT5A 4MSXA 3RPGB 4YAXA 3ZPV1 3L1ZB 1WEOA 2KYUA 4LLBA 2LDRA 2LGGA 4A0CD 1WEWA 5JG6A 4GNEA 2LV9A 2LN0A 2MD8C 2QIZA 5C11A 2JMIA 2K17A 2EODA 3L11A 3LQIA 5KH3A 2EGPA 2K1JA 2ECJA 4Q6FA 3SOUA 2KFTA 3O70A 3M99A 2ZETC 1MM3A 2L75A 2QJ0A 4S3OB 4CCGX 4I7CA 2CT2A 2M6MA 1VD4A 4ZUXU 1HYIA 4WA6A 2NAAA 3O36A 4GNFA 2G6QA 2CSYA 4FIPA 2KIZA 3KQIA 5D1MB 1IYMA 1RMDA 3HTKC 4O64A 2VJEB 2EA6A 2YHNA 3KNVA 2K16A 2YW8A 1LDKC 5B79A 1WEQA 1HYJA 4AYCB 4FJCA 5EYAF 2XB1A 2YREA 3EB5A 2VPEA 3GL6A 2E6SA 4BHWA 2Y43A 1WENA 4LK9A 2C2VS 2KR4A 5TRBA 3PHDA 2LGVA 4QF2A 3SHBA 4B86C 2MNYA 3KV5A 1WEUA 2YU4A 4UP5A 3LRQA 4IC3A 2KGIA 2MIQA 3U5OA 3PUQA 1N87A 5AITA 3O37A 2ECVA 4N3WA 1JOCA 2KE1A 4GNDA 5LKUA 2F6NA 2ECTA 4R7EA 2VJEA 1MM2A 5FEYA 4CA1A 2MA6A 2Y1MA 3QZVA 1V87A 2K4DA 2JMDA 2VJFB 2H0DB 3N9MA 1K2FA 4PPEA 5H1UA 2ECIA 3VK6A 4ZQLA 5H9MA 1WESA 2YQMA 4YBTA 3ASLA 5FB0A 2YT5A 4B7YC 4YABA 3O35A 4BBQA 5TBNA 5B78A 2C2LA 5DKAA 4FK5A 1T1HA 5LCWB 3U5PA 2L43A 2VP7A 2RI7A 3T6RA 4F52B 2MNZA 3N9LA 5LKZA 2YSJA 1ZBDB 4I7BA 4MVTA 2LRIC 3LQHA 2JRJA 2L5UA 2CKLB 2IDAA 4LJNA 2XEUA 3L1XA 3I2DA 5FB1A 2MD7B 2E6RA 5B8DA 4C9ZA 1JM7B 3PURA 4V3KC 2LGLA 4N4FA 2H0DA 3LQJA 2ECWA 3N9QA 4A49A 1VFYA 3C6WA 3O33A 4P5OB 2PUYA 3N9NA 5J3XA 1U6GB 3V43A 4LADB 5DINA 4YBMA 2ECNA 1CHCA 4AVXA 5C13A 3SOWA 2L0BA 3HCUA 4NN2A 2UZGA 2CKLA 2VNFA 3KV6A 2OXQC 2FUUA 2KWNA 2KWOA 3ZYQA 5D1LB 3EB6A 2KWJA 1E4UA 4TKPB 1XWHA 3N9PA 2KGGA 3HCSA 3ZTGA 5KH9A 2M1RA 2HDPA 1JM7A 5I3LA 2QICA 5AIUA 2KU3A 4WZ2A 1Z2QA 4GB0A 1WE9A 3RPGC 4AYCA 3T7LA 3ZVZB 3FL2A 2MUMA 2FSAA 4IC2A 3HCTA 3O7AA 2G45A 3DPLR 3MHHA 1FP0A 2L80A 2RSDA 1X4JA 2YHOA 4YC9A 1DVPA 2CSZA 2D8SA 4X3GA 1F62A 3M63A 2M85A 2I50A 5B76A 5B75A 5TDWA 2YYRA 2YQLA 4L7XA 4UI9B 2DX8A 3ZNIA 3GV4A 5H1TA 4S3OC 4FO9A 5G04B 3SOXA 1G25A 4I7DA 4WZ0A 4QF3A 2YSMA 1VYXA 1WIMA 3MHSA 2F42A 2LXPC 2VJFA 2VPGA 1WEPA 5G0FA 2FUIA 2G43A 5TDRA 2LXHC 1Z60A 2Y1NA 2VPBA 1Z6UA 2LQ6A 1BORA 2M3HA 4AUQB 3U5MA 4XI1A 3ZVYA 4YADA 2KREA 2BAYA 5TABA 5B77A 4A4BA 1WFKA 4V3LC 2F6JA 4WZ3B 1WILA 2PNXA 2AN6A 5D1KB 4PTBA 3ZPVE 5KH7A 4YBSA 3DQVR 3IHPA 1WGMA 2LGKA 2YUCA 3C5KA 4LKAA 1FBVA 2ECGA 3NG2A 4ZDTA 3N9OA 4AP4A 4R8PK 5LKTA 2KWKA 4R2YA 4UP0A 4A4CA 5LKXA 3RTRB 5G05B 1X4UA 3U5NA 1WEMA 4YATA 5FERA 1WEVA 2VPDA 3M62A 4L58A 3O34A 4GNGA 2MA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYE D;  4W4U A;  1X4I A;  2YUR A;  1LDJ B;  2JMJ A;  5H1V A;  1WEE A;  2MT5 A;  4MSX A;  3RPG B;  4YAX A;  3ZPV 1;  3L1Z B;  1WEO A;  2KYU A;  4LLB A;  2LDR A;  2LGG A;  4A0C D;  1WEW A;  5JG6 A;  4GNE A;  2LV9 A;  2LN0 A;  2MD8 C;  2QIZ A;  5C11 A;  2JMI A;  2K17 A;  2EOD A;  3L11 A;  3LQI A;  5KH3 A;  2EGP A;  2K1J A;  2ECJ A;  4Q6F A;  3SOU A;  2KFT A;  3O70 A;  3M99 A;  2ZET C;  1MM3 A;  2L75 A;  2QJ0 A;  4S3O B;  4CCG X;  4I7C A;  2CT2 A;  2M6M A;  1VD4 A;  4ZUX U;  1HYI A;  4WA6 A;  2NAA A;  3O36 A;  4GNF A;  2G6Q A;  2CSY A;  4FIP A;  2KIZ A;  3KQI A;  5D1M B;  1IYM A;  1RMD A;  3HTK C;  4O64 A;  2VJE B;  2EA6 A;  2YHN A;  3KNV A;  2K16 A;  2YW8 A;  1LDK C;  5B79 A;  1WEQ A;  1HYJ A;  4AYC B;  4FJC A;  5EYA F;  2XB1 A;  2YRE A;  3EB5 A;  2VPE A;  3GL6 A;  2E6S A;  4BHW A;  2Y43 A;  1WEN A;  4LK9 A;  2C2V S;  2KR4 A;  5TRB A;  3PHD A;  2LGV A;  4QF2 A;  3SHB A;  4B86 C;  2MNY A;  3KV5 A;  1WEU A;  2YU4 A;  4UP5 A;  3LRQ A;  4IC3 A;  2KGI A;  2MIQ A;  3U5O A;  3PUQ A;  1N87 A;  5AIT A;  3O37 A;  2ECV A;  4N3W A;  1JOC A;  2KE1 A;  4GND A;  5LKU A;  2F6N A;  2ECT A;  4R7E A;  2VJE A;  1MM2 A;  5FEY A;  4CA1 A;  2MA6 A;  2Y1M A;  3QZV A;  1V87 A;  2K4D A;  2JMD A;  2VJF B;  2H0D B;  3N9M A;  1K2F A;  4PPE A;  5H1U A;  2ECI A;  3VK6 A;  4ZQL A;  5H9M A;  1WES A;  2YQM A;  4YBT A;  3ASL A;  5FB0 A;  2YT5 A;  4B7Y C;  4YAB A;  3O35 A;  4BBQ A;  5TBN A;  5B78 A;  2C2L A;  5DKA A;  4FK5 A;  1T1H A;  5LCW B;  3U5P A;  2L43 A;  2VP7 A;  2RI7 A;  3T6R A;  4F52 B;  2MNZ A;  3N9L A;  5LKZ A;  2YSJ A;  1ZBD B;  4I7B A;  4MVT A;  2LRI C;  3LQH A;  2JRJ A;  2L5U A;  2CKL B;  2IDA A;  4LJN A;  2XEU A;  3L1X A;  3I2D A;  5FB1 A;  2MD7 B;  2E6R A;  5B8D A;  4C9Z A;  1JM7 B;  3PUR A;  4V3K C;  2LGL A;  4N4F A;  2H0D A;  3LQJ A;  2ECW A;  3N9Q A;  4A49 A;  1VFY A;  3C6W A;  3O33 A;  4P5O B;  2PUY A;  3N9N A;  5J3X A;  1U6G B;  3V43 A;  4LAD B;  5DIN A;  4YBM A;  2ECN A;  1CHC A;  4AVX A;  5C13 A;  3SOW A;  2L0B A;  3HCU A;  4NN2 A;  2UZG A;  2CKL A;  2VNF A;  3KV6 A;  2OXQ C;  2FUU A;  2KWN A;  2KWO A;  3ZYQ A;  5D1L B;  3EB6 A;  2KWJ A;  1E4U A;  4TKP B;  1XWH A;  3N9P A;  2KGG A;  3HCS A;  3ZTG A;  5KH9 A;  2M1R A;  2HDP A;  1JM7 A;  5I3L A;  2QIC A;  5AIU A;  2KU3 A;  4WZ2 A;  1Z2Q A;  4GB0 A;  1WE9 A;  3RPG C;  4AYC A;  3T7L A;  3ZVZ B;  3FL2 A;  2MUM A;  2FSA A;  4IC2 A;  3HCT A;  3O7A A;  2G45 A;  3DPL R;  3MHH A;  1FP0 A;  2L80 A;  2RSD A;  1X4J A;  2YHO A;  4YC9 A;  1DVP A;  2CSZ A;  2D8S A;  4X3G A;  1F62 A;  3M63 A;  2M85 A;  2I50 A;  5B76 A;  5B75 A;  5TDW A;  2YYR A;  2YQL A;  4L7X A;  4UI9 B;  2DX8 A;  3ZNI A;  3GV4 A;  5H1T A;  4S3O C;  4FO9 A;  5G04 B;  3SOX A;  1G25 A;  4I7D A;  4WZ0 A;  4QF3 A;  2YSM A;  1VYX A;  1WIM A;  3MHS A;  2F42 A;  2LXP C;  2VJF A;  2VPG A;  1WEP A;  5G0F A;  2FUI A;  2G43 A;  5TDR A;  2LXH C;  1Z60 A;  2Y1N A;  2VPB A;  1Z6U A;  2LQ6 A;  1BOR A;  2M3H A;  4AUQ B;  3U5M A;  4XI1 A;  3ZVY A;  4YAD A;  2KRE A;  2BAY A;  5TAB A;  5B77 A;  4A4B A;  1WFK A;  4V3L C;  2F6J A;  4WZ3 B;  1WIL A;  2PNX A;  2AN6 A;  5D1K B;  4PTB A;  3ZPV E;  5KH7 A;  4YBS A;  3DQV R;  3IHP A;  1WGM A;  2LGK A;  2YUC A;  3C5K A;  4LKA A;  1FBV A;  2ECG A;  3NG2 A;  4ZDT A;  3N9O A;  4AP4 A;  4R8P K;  5LKT A;  2KWK A;  4R2Y A;  4UP0 A;  4A4C A;  5LKX A;  3RTR B;  5G05 B;  1X4U A;  3U5N A;  1WEM A;  4YAT A;  5FER A;  1WEV A;  2VPD A;  3M62 A;  4L58 A;  3O34 A;  4GNG A;  2MA5 A; 
#chains in the Genus database with same CATH topology
 2HYE D;  4W4U A;  1X4I A;  2YUR A;  1LDJ B;  2JMJ A;  5H1V A;  4H9D A;  1WEE A;  2MT5 A;  4MSX A;  3RPG B;  4YAX A;  3SUB A;  3ZPV 1;  2KKX A;  3L1Z B;  1WEO A;  3O47 A;  2KYU A;  4LLB A;  2LAU A;  2LDR A;  2LGG A;  4A0C D;  1WEW A;  5JG6 A;  4GNE A;  2LV9 A;  2LN0 A;  3LVR E;  2MD8 C;  2QIZ A;  2XOY A;  5C11 A;  2JMI A;  2K17 A;  2EOD A;  3L11 A;  3LQI A;  5KH3 A;  2EGP A;  2K1J A;  2ECJ A;  4Q6F A;  3SOU A;  2KFT A;  3LJU X;  3O70 A;  5SVY A;  3FM8 C;  2M13 A;  3M99 A;  2ZET C;  1MM3 A;  2L75 A;  2QJ0 A;  4S3O B;  4CCG X;  4I7C A;  2CT2 A;  2M6M A;  3T9K A;  2CSV A;  1VD4 A;  4ZUX U;  1HYI A;  4WA6 A;  2NAA A;  4QQ4 A;  3O36 A;  4GNF A;  2G6Q A;  4Z0R A;  2CSY A;  5SVI A;  3PLW A;  4FIP A;  2KIZ A;  3KQI A;  5D1M B;  1IYM A;  1RMD A;  3HTK C;  4O64 A;  2DSM A;  2VJE B;  2EA6 A;  2YHN A;  3KNV A;  2K16 A;  2YW8 A;  1LDK C;  5B79 A;  1WEQ A;  1HYJ A;  2FFW A;  4AYC B;  4FJC A;  5EYA F;  2XB1 A;  2YRE A;  3EB5 A;  2VPE A;  3GL6 A;  2E6S A;  4Z0O A;  4BHW A;  1DCQ A;  2Y43 A;  1WEN A;  4LK9 A;  4OGC A;  2C2V S;  2KR4 A;  5TRB A;  3PHD A;  2LGV A;  4QF2 A;  3SHB A;  4B86 C;  2MNY A;  2KKY A;  3KV5 A;  2JM3 A;  3H7H A;  1WEU A;  2YU4 A;  5K3Q A;  2CRW A;  4UP5 A;  3LRQ A;  4IC3 A;  2KGI A;  2YVR A;  2MIQ A;  3U5O A;  3PUQ A;  1N87 A;  5AIT A;  3O37 A;  2ECV A;  4F1P A;  4N3W A;  1JOC A;  2KE1 A;  4GND A;  5LKU A;  2F6N A;  2ECT A;  4R7E A;  3FJU B;  2VJE A;  1MM2 A;  5FEY A;  4CA1 A;  2MA6 A;  2Y1M A;  3QZV A;  1V87 A;  2K4D A;  2JMD A;  2VJF B;  2H0D B;  3N9M A;  1K2F A;  4PPE A;  5H1U A;  2ECI A;  2P57 A;  3VK6 A;  4ZQL A;  5H9M A;  1WES A;  2YQM A;  4YBT A;  3ASL A;  5FB0 A;  2YT5 A;  4B7Y C;  4YAB A;  3O35 A;  3LDY A;  4BBQ A;  5TBN A;  5B78 A;  2C2L A;  5DKA A;  4FK5 A;  1T1H A;  5LCW B;  3U5P A;  2L43 A;  2VP7 A;  2RI7 A;  3T6R A;  4F52 B;  2MNZ A;  3N9L A;  5LKZ A;  2XOC A;  2YSJ A;  1ZBD B;  4I7B A;  4MVT A;  2LRI C;  3LQH A;  2JRJ A;  2L7P A;  2L5U A;  2CKL B;  2IDA A;  4LJN A;  2XEU A;  3L1X A;  3I2D A;  5FB1 A;  2MD7 B;  2E6R A;  5B8D A;  2DJA A;  4C9Z A;  1JM7 B;  3PUR A;  4V3K C;  2LGL A;  4N4F A;  2H0D A;  3LQJ A;  2ECW A;  3N9Q A;  4A49 A;  1VFY A;  3C6W A;  3O33 A;  4P5O B;  3DDT A;  2PUY A;  3N9N A;  5J3X A;  1U6G B;  3V43 A;  4LAD B;  5DIN A;  4YBM A;  2ECN A;  1CHC A;  4AVX A;  5C13 A;  2CON A;  3SOW A;  2L0B A;  2MKE A;  4NN2 A;  3HCU A;  2UZG A;  2CKL A;  2VNF A;  3KV6 A;  2OXQ C;  2XP0 A;  2FUU A;  2KWN A;  2IQJ A;  2KWO A;  3ZYQ A;  5D1L B;  3EB6 A;  2KWJ A;  1E4U A;  4TKP B;  1XWH A;  3FEH A;  3N9P A;  2KGG A;  3HCS A;  3ZTG A;  1MBM A;  5KH9 A;  2M1R A;  3E2D A;  2HDP A;  1JM7 A;  5I3L A;  3DWD A;  2QIC A;  5AIU A;  2KU3 A;  4WZ2 A;  1Z2Q A;  4GB0 A;  1WE9 A;  5SVI B;  3RPG C;  4AYC A;  3T7L A;  2EXU A;  3ZVZ B;  3FL2 A;  2MUM A;  2FSA A;  4IC2 A;  3HCT A;  4OGE A;  3FAO A;  3O7A A;  2JUN A;  2G45 A;  3DPL R;  3MHH A;  1FP0 A;  2L80 A;  2RSD A;  4O62 A;  1X4J A;  2YHO A;  4YC9 A;  1DVP A;  2CSZ A;  2D8S A;  3FAN A;  4X3G A;  1F62 A;  3M63 A;  2M85 A;  2I50 A;  3JUE A;  5B76 A;  5B75 A;  5TDW A;  2YYR A;  2YQL A;  4L7X A;  4UI9 B;  2DX8 A;  3ZNI A;  2XOZ A;  3GV4 A;  5H1T A;  4S3O C;  4FO9 A;  5G04 B;  3SOX A;  2RR4 A;  1G25 A;  4I7D A;  4WZ0 A;  2EGM A;  4QF3 A;  2YSM A;  1VYX A;  1WIM A;  3MHS A;  2LXP C;  2FD4 A;  2VJF A;  2VPG A;  1WEP A;  5G0F A;  2FUI A;  2G43 A;  5TDR A;  2OWA A;  3KDE C;  2CRR A;  2LXH C;  1Z60 A;  2MA5 A;  2Y1N A;  3M7K A;  2VPB A;  2E61 A;  1Z6U A;  2LQ6 A;  3MDB C;  1BOR A;  2M3H A;  4AUQ B;  3U5M A;  4XI1 A;  3ZVY A;  4YAD A;  2KRE A;  2BAY A;  5TAB A;  5B77 A;  2B0O E;  4A4B A;  1WFK A;  4V3L C;  2F6J A;  4WZ3 B;  1WIL A;  2PNX A;  2AN6 A;  3LVQ E;  5D1K B;  4PTB A;  3ZPV E;  5KH7 A;  4YBS A;  3DQV R;  3IHP A;  1WGM A;  2LGK A;  2YUC A;  3C5K A;  4LKA A;  1FBV A;  2ECG A;  3NG2 A;  4ZDT A;  3N9O A;  4AP4 A;  5SVX A;  3Q1D A;  4R8P K;  5LKT A;  2KWK A;  4R2Y A;  2D8U A;  4UP0 A;  4A4C A;  5LKX A;  3RTR B;  5G05 B;  1X4U A;  3U5N A;  1WEM A;  4YAT A;  5FER A;  1WEV A;  2VPD A;  3M62 A;  4L58 A;  3O34 A;  4GNG A;  2F42 A; 
#chains in the Genus database with same CATH homology
 2HYE D;  4W4U A;  1X4I A;  2YUR A;  1LDJ B;  2JMJ A;  5H1V A;  1WEE A;  2MT5 A;  4MSX A;  3RPG B;  4YAX A;  3ZPV 1;  3L1Z B;  1WEO A;  2KYU A;  4LLB A;  2LDR A;  2LGG A;  4A0C D;  1WEW A;  5JG6 A;  4GNE A;  2LV9 A;  2LN0 A;  2MD8 C;  2QIZ A;  5C11 A;  2JMI A;  2K17 A;  2EOD A;  3L11 A;  3LQI A;  5KH3 A;  2EGP A;  2K1J A;  2ECJ A;  4Q6F A;  3SOU A;  2KFT A;  3O70 A;  3M99 A;  2ZET C;  1MM3 A;  2L75 A;  2QJ0 A;  4S3O B;  4CCG X;  4I7C A;  2CT2 A;  2M6M A;  1VD4 A;  4ZUX U;  1HYI A;  4WA6 A;  2NAA A;  3O36 A;  4GNF A;  2G6Q A;  2CSY A;  4FIP A;  2KIZ A;  3KQI A;  5D1M B;  1IYM A;  1RMD A;  3HTK C;  4O64 A;  2VJE B;  2EA6 A;  2YHN A;  3KNV A;  2K16 A;  2YW8 A;  1LDK C;  5B79 A;  1WEQ A;  1HYJ A;  4AYC B;  4FJC A;  5EYA F;  2XB1 A;  2YRE A;  3EB5 A;  2VPE A;  3GL6 A;  2E6S A;  4BHW A;  2Y43 A;  1WEN A;  4LK9 A;  2C2V S;  2KR4 A;  5TRB A;  3PHD A;  2LGV A;  4QF2 A;  3SHB A;  4B86 C;  2MNY A;  3KV5 A;  1WEU A;  2YU4 A;  4UP5 A;  3LRQ A;  4IC3 A;  2KGI A;  2MIQ A;  3U5O A;  3PUQ A;  1N87 A;  5AIT A;  3O37 A;  2ECV A;  4N3W A;  1JOC A;  2KE1 A;  4GND A;  5LKU A;  2F6N A;  2ECT A;  4R7E A;  2VJE A;  1MM2 A;  5FEY A;  4CA1 A;  2MA6 A;  2Y1M A;  3QZV A;  1V87 A;  2K4D A;  2JMD A;  2VJF B;  2H0D B;  3N9M A;  1K2F A;  4PPE A;  5H1U A;  2ECI A;  3VK6 A;  4ZQL A;  5H9M A;  1WES A;  2YQM A;  4YBT A;  3ASL A;  5FB0 A;  2YT5 A;  4B7Y C;  4YAB A;  3O35 A;  4BBQ A;  5TBN A;  5B78 A;  2C2L A;  5DKA A;  4FK5 A;  1T1H A;  5LCW B;  3U5P A;  2L43 A;  2VP7 A;  2RI7 A;  3T6R A;  4F52 B;  2MNZ A;  3N9L A;  5LKZ A;  2YSJ A;  1ZBD B;  4I7B A;  4MVT A;  2LRI C;  3LQH A;  2JRJ A;  2L5U A;  2CKL B;  2IDA A;  4LJN A;  2XEU A;  3L1X A;  3I2D A;  5FB1 A;  2MD7 B;  2E6R A;  5B8D A;  4C9Z A;  1JM7 B;  3PUR A;  4V3K C;  2LGL A;  4N4F A;  2H0D A;  3LQJ A;  2ECW A;  3N9Q A;  4A49 A;  1VFY A;  3C6W A;  3O33 A;  4P5O B;  2PUY A;  3N9N A;  5J3X A;  1U6G B;  3V43 A;  4LAD B;  5DIN A;  4YBM A;  2ECN A;  1CHC A;  4AVX A;  5C13 A;  3SOW A;  2L0B A;  3HCU A;  4NN2 A;  2UZG A;  2CKL A;  2VNF A;  3KV6 A;  2OXQ C;  2FUU A;  2KWN A;  2KWO A;  3ZYQ A;  5D1L B;  3EB6 A;  2KWJ A;  1E4U A;  4TKP B;  1XWH A;  3N9P A;  2KGG A;  3HCS A;  3ZTG A;  5KH9 A;  2M1R A;  2HDP A;  1JM7 A;  5I3L A;  2QIC A;  5AIU A;  2KU3 A;  4WZ2 A;  1Z2Q A;  4GB0 A;  1WE9 A;  3RPG C;  4AYC A;  3T7L A;  3ZVZ B;  3FL2 A;  2MUM A;  2FSA A;  4IC2 A;  3HCT A;  3O7A A;  2G45 A;  3DPL R;  3MHH A;  1FP0 A;  2L80 A;  2RSD A;  1X4J A;  2YHO A;  4YC9 A;  1DVP A;  2CSZ A;  2D8S A;  4X3G A;  1F62 A;  3M63 A;  2M85 A;  2I50 A;  5B76 A;  5B75 A;  5TDW A;  2YYR A;  2YQL A;  4L7X A;  4UI9 B;  2DX8 A;  3ZNI A;  3GV4 A;  5H1T A;  4S3O C;  4FO9 A;  5G04 B;  3SOX A;  1G25 A;  4I7D A;  4WZ0 A;  4QF3 A;  2YSM A;  1VYX A;  1WIM A;  3MHS A;  2F42 A;  2LXP C;  2VJF A;  2VPG A;  1WEP A;  5G0F A;  2FUI A;  2G43 A;  5TDR A;  2LXH C;  1Z60 A;  2Y1N A;  2VPB A;  1Z6U A;  2LQ6 A;  1BOR A;  2M3H A;  4AUQ B;  3U5M A;  4XI1 A;  3ZVY A;  4YAD A;  2KRE A;  2BAY A;  5TAB A;  5B77 A;  4A4B A;  1WFK A;  4V3L C;  2F6J A;  4WZ3 B;  1WIL A;  2PNX A;  2AN6 A;  5D1K B;  4PTB A;  3ZPV E;  5KH7 A;  4YBS A;  3DQV R;  3IHP A;  1WGM A;  2LGK A;  2YUC A;  3C5K A;  4LKA A;  1FBV A;  2ECG A;  3NG2 A;  4ZDT A;  3N9O A;  4AP4 A;  4R8P K;  5LKT A;  2KWK A;  4R2Y A;  4UP0 A;  4A4C A;  5LKX A;  3RTR B;  5G05 B;  1X4U A;  3U5N A;  1WEM A;  4YAT A;  5FER A;  1WEV A;  2VPD A;  3M62 A;  4L58 A;  3O34 A;  4GNG A;  2MA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...