4LLBA

Crystal structure of moz double phd finger histone h3k14ac complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
total genus 29
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4llbA00
2VP7A 2C2VS 3SOWA 2LDRA 2VJEB 4WZ0A 2VJFA 1U6GB 4I7DA 3EB5A 3LRQA 3C5KA 2C2LA 2LGGA 4LADB 4A4BA 2LN0A 3ZYQA 3ZNIA 1X4JA 3PUQA 4GB0A 4UI9B 4I7BA 2L75A 1WGMA 5TDWA 5LCWB 2E6SA 2LXPC 4B7YC 4W4UA 4GNFA 2HYED 2KE1A 3ZVYA 1CHCA 2YT5A 4ZQLA 1WENA 2KIZA 1WIMA 2K16A 5D1LB 2KWJA 2LGLA 3HCTA 1WEUA 4F52B 4YADA 3N9OA 2XEUA 2K4DA 3IHPA 4GNDA 3U5PA 1E4UA 2HDPA 1G25A 4YBTA 2M3HA 3L1ZB 2M1RA 3O70A 2LV9A 3ZPVE 2ECTA 3NG2A 3U5MA 2DX8A 3LQIA 4MVTA 2I50A 5FB0A 3RTRB 2MNYA 4LK9A 1X4IA 4QF3A 1WEEA 4YC9A 4WZ3B 2MA6A 4AP4A 1WEPA 2ECVA 2MT5A 2H0DB 2F6NA 5B79A 3L1XA 4S3OC 1XWHA 3ZTGA 1WE9A 2KGIA 3N9MA 1MM2A 1WEWA 1WEVA 5KH3A 2YHOA 1LDKC 4ZUXU 2KU3A 4YBMA 4LLBA 2FUUA 2KWKA 5I3LA 2JMIA 2EODA 3I2DA 5LKXA 4A0CD 3ZVZB 2KREA 4WZ2A 4UP0A 3V43A 5FB1A 4S3OB 1VD4A 3M63A 5B76A 1Z2QA 5LKZA 3U5OA 2LGVA 2D8SA 2ECGA 4AYCA 2VNFA 4R8PK 2RI7A 2L0BA 2LQ6A 3KQIA 2ECWA 2K17A 3LQHA 4V3KC 3SHBA 1FBVA 2G6QA 3O34A 4V3LC 5TABA 5H1UA 3N9NA 4YBSA 4L7XA 2Y43A 4R2YA 1FP0A 2YREA 3SOXA 2MIQA 5B77A 1LDJB 2XB1A 5TBNA 3ASLA 2CSZA 5D1KB 4PTBA 1T1HA 4FO9A 3PURA 2EGPA 2L80A 2MD8C 1WEOA 4C9ZA 5AITA 2MA5A 2VPBA 5EYAF 4CA1A 2CKLA 1DVPA 4WA6A 4P5OB 4R7EA 4NN2A 3C6WA 2QIZA 5G05B 3N9LA 3FL2A 4ZDTA 4A49A 2VJEA 4PPEA 5DINA 4AVXA 4GNEA 2KWOA 2FUIA 4TKPB 1JM7B 2Y1NA 3O35A 1HYIA 2YSJA 1X4UA 5J3XA 2KWNA 3VK6A 2YQLA 1ZBDB 2JMJA 4CCGX 2YU4A 4BHWA 2EA6A 4YABA 4I7CA 1MM3A 3RPGB 4FIPA 1WEQA 1N87A 3O37A 5KH9A 1BORA 2RSDA 4LJNA 2G43A 2KR4A 3HTKC 3RPGC 3HCUA 4IC3A 5LKTA 1V87A 4QF2A 4B86C 2YW8A 2FSAA 2MUMA 2ECJA 1F62A 2K1JA 2YURA 2JRJA 4YAXA 4FJCA 3ZPV1 4YATA 3M99A 4X3GA 3T6RA 2BAYA 2OXQC 2F42A 4MSXA 3L11A 2E6RA 2CSYA 5AIUA 1WFKA 3EB6A 2YUCA 2VPEA 5FEYA 2IDAA 1IYMA 2L43A 3GV4A 2KYUA 2PNXA 5G0FA 1JOCA 2YQMA 2PUYA 1Z6UA 3O7AA 3O36A 2CT2A 2H0DA 3KNVA 4LKAA 4N4FA 5B75A 1VYXA 3HCSA 1WILA 3T7LA 2M85A 2LGKA 5JG6A 4AUQB 3MHHA 1WEMA 4N3WA 5D1MB 2KFTA 5G04B 5FERA 5LKUA 3PHDA 3KV5A 2AN6A 2UZGA 2VPDA 2L5UA 2ZETC 5KH7A 3O33A 4Q6FA 5B78A 2VJFB 2CKLB 3U5NA 5DKAA 2ECIA 2Y1MA 4L58A 3N9QA 5H9MA 5H1VA 3GL6A 5TDRA 3KV6A 2VPGA 2YYRA 3SOUA 3QZVA 2M6MA 2JMDA 4FK5A 2F6JA 3DPLR 4A4CA 4XI1A 5TRBA 3N9PA 1Z60A 2G45A 2ECNA 5C11A 2NAAA 1RMDA 2YSMA 5B8DA 1HYJA 2MNZA 4AYCB 2LRIC 1WESA 4BBQA 3MHSA 2KGGA 1VFYA 5H1TA 1JM7A 3M62A 2YHNA 3DQVR 4O64A 4UP5A 5C13A 2QICA 3LQJA 2QJ0A 4GNGA 4IC2A 2LXHC 2MD7B 1K2FA
chains in the Genus database with same CATH superfamily
4OGCA 3M7KA 2VP7A 2C2VS 2EXUA 3SOWA 2LDRA 1MBMA 2VJEB 4WZ0A 2VJFA 5SVIB 1U6GB 4I7DA 3EB5A 3LRQA 3C5KA 2C2LA 2LGGA 4LADB 4A4BA 2LN0A 2XP0A 3Q1DA 3ZYQA 3ZNIA 1X4JA 3PUQA 4GB0A 4UI9B 4I7BA 2CSVA 3E2DA 4Z0OA 2L75A 1WGMA 3FAOA 5TDWA 5LCWB 2E6SA 2OWAA 2DJAA 2LXPC 4B7YC 2XOCA 4W4UA 4GNFA 2HYED 3SUBA 2KE1A 3ZVYA 3FANA 1CHCA 2YT5A 4ZQLA 1WENA 2KIZA 1WIMA 2K16A 5D1LB 2KWJA 2LGLA 3HCTA 1WEUA 4F52B 3H7HA 4YADA 3N9OA 2XEUA 5SVYA 2K4DA 3IHPA 4GNDA 3U5PA 1E4UA 2HDPA 1G25A 4YBTA 2M3HA 3L1ZB 2M1RA 3O70A 5SVIA 2LV9A 3ZPVE 2ECTA 3NG2A 3U5MA 2DX8A 3LQIA 4MVTA 2I50A 5FB0A 3LVQE 3RTRB 2MNYA 4LK9A 1X4IA 4QF3A 1WEEA 4YC9A 4WZ3B 2MA6A 2L7PA 4AP4A 1WEPA 2ECVA 2MT5A 2H0DB 2F6NA 2XOZA 5B79A 3L1XA 2YVRA 2LAUA 4S3OC 1XWHA 3ZTGA 1WE9A 2KGIA 3N9MA 1MM2A 1WEWA 4F1PA 1WEVA 5KH3A 2YHOA 1LDKC 4ZUXU 2KU3A 4YBMA 4LLBA 1DCQA 2FUUA 2KWKA 5I3LA 2JMIA 2EODA 4Z0RA 3I2DA 5LKXA 4A0CD 3ZVZB 2KREA 3PLWA 4WZ2A 2JM3A 4O62A 4UP0A 3V43A 5FB1A 4S3OB 1VD4A 3M63A 5B76A 1Z2QA 5LKZA 3U5OA 2LGVA 2D8SA 2ECGA 4AYCA 3JUEA 2VNFA 4R8PK 2RI7A 2L0BA 2LQ6A 3KQIA 2XOYA 2ECWA 2K17A 3LQHA 4V3KC 3SHBA 2E61A 3KDEC 1FBVA 2G6QA 3O34A 4V3LC 5TABA 5H1UA 3N9NA 2RR4A 4YBSA 4L7XA 2Y43A 2FD4A 4R2YA 1FP0A 2YREA 2JUNA 3SOXA 2MIQA 5B77A 1LDJB 3T9KA 2XB1A 5TBNA 3ASLA 2CSZA 5D1KB 4PTBA 1T1HA 4FO9A 2CONA 3PURA 2EGPA 2L80A 2MD8C 1WEOA 4C9ZA 5AITA 2MA5A 2VPBA 5EYAF 4CA1A 2CKLA 4WA6A 1DVPA 2B0OE 4P5OB 4R7EA 4NN2A 3C6WA 2QIZA 5G05B 3N9LA 3FL2A 4ZDTA 4A49A 2VJEA 4PPEA 5DINA 4AVXA 3O47A 4GNEA 2MKEA 2KWOA 2FUIA 2CRWA 4TKPB 1JM7B 3DDTA 2EGMA 2Y1NA 3FJUB 3O35A 1HYIA 2YSJA 1X4UA 3LVRE 5J3XA 2KWNA 3VK6A 2YQLA 1ZBDB 2JMJA 4CCGX 2YU4A 4BHWA 2KKYA 2EA6A 4YABA 4I7CA 1MM3A 3RPGB 4FIPA 1WEQA 1N87A 3O37A 5KH9A 1BORA 2RSDA 4LJNA 2G43A 2KR4A 3HTKC 3RPGC 3HCUA 4IC3A 5LKTA 1V87A 4QF2A 4B86C 2YW8A 3LDYA 2FSAA 2MUMA 2P57A 2IQJA 2ECJA 4H9DA 1F62A 2K1JA 2YURA 2JRJA 4YAXA 4FJCA 3ZPV1 4YATA 3M99A 4QQ4A 4X3GA 3T6RA 2BAYA 2OXQC 2F42A 4MSXA 3L11A 2E6RA 2CSYA 2CRRA 3FM8C 5AIUA 1WFKA 3EB6A 2YUCA 4OGEA 2VPEA 5FEYA 2IDAA 1IYMA 2L43A 2M13A 3GV4A 2KYUA 2D8UA 2PNXA 5G0FA 1JOCA 2YQMA 2PUYA 1Z6UA 3O7AA 3FEHA 3O36A 2CT2A 2H0DA 3KNVA 4LKAA 4N4FA 5B75A 1VYXA 3HCSA 1WILA 3T7LA 2M85A 2LGKA 5JG6A 4AUQB 3MHHA 1WEMA 4N3WA 5D1MB 2KFTA 5G04B 5FERA 5LKUA 3PHDA 3KV5A 2AN6A 2UZGA 2VPDA 2L5UA 2ZETC 3LJUX 5KH7A 3O33A 4Q6FA 5B78A 2VJFB 2CKLB 3U5NA 5DKAA 2ECIA 2Y1MA 4L58A 5SVXA 3N9QA 5H9MA 5H1VA 3GL6A 5TDRA 3MDBC 3KV6A 2VPGA 2YYRA 3SOUA 3QZVA 2M6MA 2JMDA 4FK5A 2F6JA 3DPLR 4A4CA 2DSMA 3DWDA 4XI1A 5TRBA 3N9PA 1Z60A 2G45A 2ECNA 5C11A 2NAAA 1RMDA 2YSMA 5B8DA 1HYJA 2MNZA 4AYCB 2LRIC 1WESA 4BBQA 3MHSA 2KGGA 1VFYA 5H1TA 1JM7A 3M62A 2YHNA 5K3QA 3DQVR 4O64A 4UP5A 2FFWA 5C13A 2KKXA 2QICA 3LQJA 2QJ0A 4GNGA 4IC2A 2LXHC 2MD7B 1K2FA
chains in the Genus database with same CATH topology
2VP7A 2C2VS 3SOWA 2LDRA 2VJEB 4WZ0A 2VJFA 1U6GB 4I7DA 3EB5A 3LRQA 3C5KA 2C2LA 2LGGA 4LADB 4A4BA 2LN0A 3ZYQA 3ZNIA 1X4JA 3PUQA 4GB0A 4UI9B 4I7BA 2L75A 1WGMA 5TDWA 5LCWB 2E6SA 2LXPC 4B7YC 4W4UA 4GNFA 2HYED 2KE1A 3ZVYA 1CHCA 2YT5A 4ZQLA 1WENA 2KIZA 1WIMA 2K16A 5D1LB 2KWJA 2LGLA 3HCTA 1WEUA 4F52B 4YADA 3N9OA 2XEUA 2K4DA 3IHPA 4GNDA 3U5PA 1E4UA 2HDPA 1G25A 4YBTA 2M3HA 3L1ZB 2M1RA 3O70A 2LV9A 3ZPVE 2ECTA 3NG2A 3U5MA 2DX8A 3LQIA 4MVTA 2I50A 5FB0A 3RTRB 2MNYA 4LK9A 1X4IA 4QF3A 1WEEA 4YC9A 4WZ3B 2MA6A 4AP4A 1WEPA 2ECVA 2MT5A 2H0DB 2F6NA 5B79A 3L1XA 4S3OC 1XWHA 3ZTGA 1WE9A 2KGIA 3N9MA 1MM2A 1WEWA 1WEVA 5KH3A 2YHOA 1LDKC 4ZUXU 2KU3A 4YBMA 4LLBA 2FUUA 2KWKA 5I3LA 2JMIA 2EODA 3I2DA 5LKXA 4A0CD 3ZVZB 2KREA 4WZ2A 4UP0A 3V43A 5FB1A 4S3OB 1VD4A 3M63A 5B76A 1Z2QA 5LKZA 3U5OA 2LGVA 2D8SA 2ECGA 4AYCA 2VNFA 4R8PK 2RI7A 2L0BA 2LQ6A 3KQIA 2ECWA 2K17A 3LQHA 4V3KC 3SHBA 1FBVA 2G6QA 3O34A 4V3LC 5TABA 5H1UA 3N9NA 4YBSA 4L7XA 2Y43A 4R2YA 1FP0A 2YREA 3SOXA 2MIQA 5B77A 1LDJB 2XB1A 5TBNA 3ASLA 2CSZA 5D1KB 4PTBA 1T1HA 4FO9A 3PURA 2EGPA 2L80A 2MD8C 1WEOA 4C9ZA 5AITA 2MA5A 2VPBA 5EYAF 4CA1A 2CKLA 1DVPA 4WA6A 4P5OB 4R7EA 4NN2A 3C6WA 2QIZA 5G05B 3N9LA 3FL2A 4ZDTA 4A49A 2VJEA 4PPEA 5DINA 4AVXA 4GNEA 2KWOA 2FUIA 4TKPB 1JM7B 2Y1NA 3O35A 1HYIA 2YSJA 1X4UA 5J3XA 2KWNA 3VK6A 2YQLA 1ZBDB 2JMJA 4CCGX 2YU4A 4BHWA 2EA6A 4YABA 4I7CA 1MM3A 3RPGB 4FIPA 1WEQA 1N87A 3O37A 5KH9A 1BORA 2RSDA 4LJNA 2G43A 2KR4A 3HTKC 3RPGC 3HCUA 4IC3A 5LKTA 1V87A 4QF2A 4B86C 2YW8A 2FSAA 2MUMA 2ECJA 1F62A 2K1JA 2YURA 2JRJA 4YAXA 4FJCA 3ZPV1 4YATA 3M99A 4X3GA 3T6RA 2BAYA 2OXQC 2F42A 4MSXA 3L11A 2E6RA 2CSYA 5AIUA 1WFKA 3EB6A 2YUCA 2VPEA 5FEYA 2IDAA 1IYMA 2L43A 3GV4A 2KYUA 2PNXA 5G0FA 1JOCA 2YQMA 2PUYA 1Z6UA 3O7AA 3O36A 2CT2A 2H0DA 3KNVA 4LKAA 4N4FA 5B75A 1VYXA 3HCSA 1WILA 3T7LA 2M85A 2LGKA 5JG6A 4AUQB 3MHHA 1WEMA 4N3WA 5D1MB 2KFTA 5G04B 5FERA 5LKUA 3PHDA 3KV5A 2AN6A 2UZGA 2VPDA 2L5UA 2ZETC 5KH7A 3O33A 4Q6FA 5B78A 2VJFB 2CKLB 3U5NA 5DKAA 2ECIA 2Y1MA 4L58A 3N9QA 5H9MA 5H1VA 3GL6A 5TDRA 3KV6A 2VPGA 2YYRA 3SOUA 3QZVA 2M6MA 2JMDA 4FK5A 2F6JA 3DPLR 4A4CA 4XI1A 5TRBA 3N9PA 1Z60A 2G45A 2ECNA 5C11A 2NAAA 1RMDA 2YSMA 5B8DA 1HYJA 2MNZA 4AYCB 2LRIC 1WESA 4BBQA 3MHSA 2KGGA 1VFYA 5H1TA 1JM7A 3M62A 2YHNA 3DQVR 4O64A 4UP5A 5C13A 2QICA 3LQJA 2QJ0A 4GNGA 4IC2A 2LXHC 2MD7B 1K2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VP7 A;  2C2V S;  3SOW A;  2LDR A;  2VJE B;  4WZ0 A;  2VJF A;  1U6G B;  4I7D A;  3EB5 A;  3LRQ A;  3C5K A;  2C2L A;  2LGG A;  4LAD B;  4A4B A;  2LN0 A;  3ZYQ A;  3ZNI A;  1X4J A;  3PUQ A;  4GB0 A;  4UI9 B;  4I7B A;  2L75 A;  1WGM A;  5TDW A;  5LCW B;  2E6S A;  2LXP C;  4B7Y C;  4W4U A;  4GNF A;  2HYE D;  2KE1 A;  3ZVY A;  1CHC A;  2YT5 A;  4ZQL A;  1WEN A;  2KIZ A;  1WIM A;  2K16 A;  5D1L B;  2KWJ A;  2LGL A;  3HCT A;  1WEU A;  4F52 B;  4YAD A;  3N9O A;  2XEU A;  2K4D A;  3IHP A;  4GND A;  3U5P A;  1E4U A;  2HDP A;  1G25 A;  4YBT A;  2M3H A;  3L1Z B;  2M1R A;  3O70 A;  2LV9 A;  3ZPV E;  2ECT A;  3NG2 A;  3U5M A;  2DX8 A;  3LQI A;  4MVT A;  2I50 A;  5FB0 A;  3RTR B;  2MNY A;  4LK9 A;  1X4I A;  4QF3 A;  1WEE A;  4YC9 A;  4WZ3 B;  2MA6 A;  4AP4 A;  1WEP A;  2ECV A;  2MT5 A;  2H0D B;  2F6N A;  5B79 A;  3L1X A;  4S3O C;  1XWH A;  3ZTG A;  1WE9 A;  2KGI A;  3N9M A;  1MM2 A;  1WEW A;  1WEV A;  5KH3 A;  2YHO A;  1LDK C;  4ZUX U;  2KU3 A;  4YBM A;  4LLB A;  2FUU A;  2KWK A;  5I3L A;  2JMI A;  2EOD A;  3I2D A;  5LKX A;  4A0C D;  3ZVZ B;  2KRE A;  4WZ2 A;  4UP0 A;  3V43 A;  5FB1 A;  4S3O B;  1VD4 A;  3M63 A;  5B76 A;  1Z2Q A;  5LKZ A;  3U5O A;  2LGV A;  2D8S A;  2ECG A;  4AYC A;  2VNF A;  4R8P K;  2RI7 A;  2L0B A;  2LQ6 A;  3KQI A;  2ECW A;  2K17 A;  3LQH A;  4V3K C;  3SHB A;  1FBV A;  2G6Q A;  3O34 A;  4V3L C;  5TAB A;  5H1U A;  3N9N A;  4YBS A;  4L7X A;  2Y43 A;  4R2Y A;  1FP0 A;  2YRE A;  3SOX A;  2MIQ A;  5B77 A;  1LDJ B;  2XB1 A;  5TBN A;  3ASL A;  2CSZ A;  5D1K B;  4PTB A;  1T1H A;  4FO9 A;  3PUR A;  2EGP A;  2L80 A;  2MD8 C;  1WEO A;  4C9Z A;  5AIT A;  2MA5 A;  2VPB A;  5EYA F;  4CA1 A;  2CKL A;  1DVP A;  4WA6 A;  4P5O B;  4R7E A;  4NN2 A;  3C6W A;  2QIZ A;  5G05 B;  3N9L A;  3FL2 A;  4ZDT A;  4A49 A;  2VJE A;  4PPE A;  5DIN A;  4AVX A;  4GNE A;  2KWO A;  2FUI A;  4TKP B;  1JM7 B;  2Y1N A;  3O35 A;  1HYI A;  2YSJ A;  1X4U A;  5J3X A;  2KWN A;  3VK6 A;  2YQL A;  1ZBD B;  2JMJ A;  4CCG X;  2YU4 A;  4BHW A;  2EA6 A;  4YAB A;  4I7C A;  1MM3 A;  3RPG B;  4FIP A;  1WEQ A;  1N87 A;  3O37 A;  5KH9 A;  1BOR A;  2RSD A;  4LJN A;  2G43 A;  2KR4 A;  3HTK C;  3RPG C;  3HCU A;  4IC3 A;  5LKT A;  1V87 A;  4QF2 A;  4B86 C;  2YW8 A;  2FSA A;  2MUM A;  2ECJ A;  1F62 A;  2K1J A;  2YUR A;  2JRJ A;  4YAX A;  4FJC A;  3ZPV 1;  4YAT A;  3M99 A;  4X3G A;  3T6R A;  2BAY A;  2OXQ C;  2F42 A;  4MSX A;  3L11 A;  2E6R A;  2CSY A;  5AIU A;  1WFK A;  3EB6 A;  2YUC A;  2VPE A;  5FEY A;  2IDA A;  1IYM A;  2L43 A;  3GV4 A;  2KYU A;  2PNX A;  5G0F A;  1JOC A;  2YQM A;  2PUY A;  1Z6U A;  3O7A A;  3O36 A;  2CT2 A;  2H0D A;  3KNV A;  4LKA A;  4N4F A;  5B75 A;  1VYX A;  3HCS A;  1WIL A;  3T7L A;  2M85 A;  2LGK A;  5JG6 A;  4AUQ B;  3MHH A;  1WEM A;  4N3W A;  5D1M B;  2KFT A;  5G04 B;  5FER A;  5LKU A;  3PHD A;  3KV5 A;  2AN6 A;  2UZG A;  2VPD A;  2L5U A;  2ZET C;  5KH7 A;  3O33 A;  4Q6F A;  5B78 A;  2VJF B;  2CKL B;  3U5N A;  5DKA A;  2ECI A;  2Y1M A;  4L58 A;  3N9Q A;  5H9M A;  5H1V A;  3GL6 A;  5TDR A;  3KV6 A;  2VPG A;  2YYR A;  3SOU A;  3QZV A;  2M6M A;  2JMD A;  4FK5 A;  2F6J A;  3DPL R;  4A4C A;  4XI1 A;  5TRB A;  3N9P A;  1Z60 A;  2G45 A;  2ECN A;  5C11 A;  2NAA A;  1RMD A;  2YSM A;  5B8D A;  1HYJ A;  2MNZ A;  4AYC B;  2LRI C;  1WES A;  4BBQ A;  3MHS A;  2KGG A;  1VFY A;  5H1T A;  1JM7 A;  3M62 A;  2YHN A;  3DQV R;  4O64 A;  4UP5 A;  5C13 A;  2QIC A;  3LQJ A;  2QJ0 A;  4GNG A;  4IC2 A;  2LXH C;  2MD7 B;  1K2F A; 
#chains in the Genus database with same CATH topology
 4OGC A;  3M7K A;  2VP7 A;  2C2V S;  2EXU A;  3SOW A;  2LDR A;  1MBM A;  2VJE B;  4WZ0 A;  2VJF A;  5SVI B;  1U6G B;  4I7D A;  3EB5 A;  3LRQ A;  3C5K A;  2C2L A;  2LGG A;  4LAD B;  4A4B A;  2LN0 A;  2XP0 A;  3Q1D A;  3ZYQ A;  3ZNI A;  1X4J A;  3PUQ A;  4GB0 A;  4UI9 B;  4I7B A;  2CSV A;  3E2D A;  4Z0O A;  2L75 A;  1WGM A;  3FAO A;  5TDW A;  5LCW B;  2E6S A;  2OWA A;  2DJA A;  2LXP C;  4B7Y C;  2XOC A;  4W4U A;  4GNF A;  2HYE D;  3SUB A;  2KE1 A;  3ZVY A;  3FAN A;  1CHC A;  2YT5 A;  4ZQL A;  1WEN A;  2KIZ A;  1WIM A;  2K16 A;  5D1L B;  2KWJ A;  2LGL A;  3HCT A;  1WEU A;  4F52 B;  3H7H A;  4YAD A;  3N9O A;  2XEU A;  5SVY A;  2K4D A;  3IHP A;  4GND A;  3U5P A;  1E4U A;  2HDP A;  1G25 A;  4YBT A;  2M3H A;  3L1Z B;  2M1R A;  3O70 A;  5SVI A;  2LV9 A;  3ZPV E;  2ECT A;  3NG2 A;  3U5M A;  2DX8 A;  3LQI A;  4MVT A;  2I50 A;  5FB0 A;  3LVQ E;  3RTR B;  2MNY A;  4LK9 A;  1X4I A;  4QF3 A;  1WEE A;  4YC9 A;  4WZ3 B;  2MA6 A;  2L7P A;  4AP4 A;  1WEP A;  2ECV A;  2MT5 A;  2H0D B;  2F6N A;  2XOZ A;  5B79 A;  3L1X A;  2YVR A;  2LAU A;  4S3O C;  1XWH A;  3ZTG A;  1WE9 A;  2KGI A;  3N9M A;  1MM2 A;  1WEW A;  4F1P A;  1WEV A;  5KH3 A;  2YHO A;  1LDK C;  4ZUX U;  2KU3 A;  4YBM A;  4LLB A;  1DCQ A;  2FUU A;  2KWK A;  5I3L A;  2JMI A;  2EOD A;  4Z0R A;  3I2D A;  5LKX A;  4A0C D;  3ZVZ B;  2KRE A;  3PLW A;  4WZ2 A;  2JM3 A;  4O62 A;  4UP0 A;  3V43 A;  5FB1 A;  4S3O B;  1VD4 A;  3M63 A;  5B76 A;  1Z2Q A;  5LKZ A;  3U5O A;  2LGV A;  2D8S A;  2ECG A;  4AYC A;  3JUE A;  2VNF A;  4R8P K;  2RI7 A;  2L0B A;  2LQ6 A;  3KQI A;  2XOY A;  2ECW A;  2K17 A;  3LQH A;  4V3K C;  3SHB A;  2E61 A;  3KDE C;  1FBV A;  2G6Q A;  3O34 A;  4V3L C;  5TAB A;  5H1U A;  3N9N A;  2RR4 A;  4YBS A;  4L7X A;  2Y43 A;  2FD4 A;  4R2Y A;  1FP0 A;  2YRE A;  2JUN A;  3SOX A;  2MIQ A;  5B77 A;  1LDJ B;  3T9K A;  2XB1 A;  5TBN A;  3ASL A;  2CSZ A;  5D1K B;  4PTB A;  1T1H A;  4FO9 A;  2CON A;  3PUR A;  2EGP A;  2L80 A;  2MD8 C;  1WEO A;  4C9Z A;  5AIT A;  2MA5 A;  2VPB A;  5EYA F;  4CA1 A;  2CKL A;  4WA6 A;  1DVP A;  2B0O E;  4P5O B;  4R7E A;  4NN2 A;  3C6W A;  2QIZ A;  5G05 B;  3N9L A;  3FL2 A;  4ZDT A;  4A49 A;  2VJE A;  4PPE A;  5DIN A;  4AVX A;  3O47 A;  4GNE A;  2MKE A;  2KWO A;  2FUI A;  2CRW A;  4TKP B;  1JM7 B;  3DDT A;  2EGM A;  2Y1N A;  3FJU B;  3O35 A;  1HYI A;  2YSJ A;  1X4U A;  3LVR E;  5J3X A;  2KWN A;  3VK6 A;  2YQL A;  1ZBD B;  2JMJ A;  4CCG X;  2YU4 A;  4BHW A;  2KKY A;  2EA6 A;  4YAB A;  4I7C A;  1MM3 A;  3RPG B;  4FIP A;  1WEQ A;  1N87 A;  3O37 A;  5KH9 A;  1BOR A;  2RSD A;  4LJN A;  2G43 A;  2KR4 A;  3HTK C;  3RPG C;  3HCU A;  4IC3 A;  5LKT A;  1V87 A;  4QF2 A;  4B86 C;  2YW8 A;  3LDY A;  2FSA A;  2MUM A;  2P57 A;  2IQJ A;  2ECJ A;  4H9D A;  1F62 A;  2K1J A;  2YUR A;  2JRJ A;  4YAX A;  4FJC A;  3ZPV 1;  4YAT A;  3M99 A;  4QQ4 A;  4X3G A;  3T6R A;  2BAY A;  2OXQ C;  2F42 A;  4MSX A;  3L11 A;  2E6R A;  2CSY A;  2CRR A;  3FM8 C;  5AIU A;  1WFK A;  3EB6 A;  2YUC A;  4OGE A;  2VPE A;  5FEY A;  2IDA A;  1IYM A;  2L43 A;  2M13 A;  3GV4 A;  2KYU A;  2D8U A;  2PNX A;  5G0F A;  1JOC A;  2YQM A;  2PUY A;  1Z6U A;  3O7A A;  3FEH A;  3O36 A;  2CT2 A;  2H0D A;  3KNV A;  4LKA A;  4N4F A;  5B75 A;  1VYX A;  3HCS A;  1WIL A;  3T7L A;  2M85 A;  2LGK A;  5JG6 A;  4AUQ B;  3MHH A;  1WEM A;  4N3W A;  5D1M B;  2KFT A;  5G04 B;  5FER A;  5LKU A;  3PHD A;  3KV5 A;  2AN6 A;  2UZG A;  2VPD A;  2L5U A;  2ZET C;  3LJU X;  5KH7 A;  3O33 A;  4Q6F A;  5B78 A;  2VJF B;  2CKL B;  3U5N A;  5DKA A;  2ECI A;  2Y1M A;  4L58 A;  5SVX A;  3N9Q A;  5H9M A;  5H1V A;  3GL6 A;  5TDR A;  3MDB C;  3KV6 A;  2VPG A;  2YYR A;  3SOU A;  3QZV A;  2M6M A;  2JMD A;  4FK5 A;  2F6J A;  3DPL R;  4A4C A;  2DSM A;  3DWD A;  4XI1 A;  5TRB A;  3N9P A;  1Z60 A;  2G45 A;  2ECN A;  5C11 A;  2NAA A;  1RMD A;  2YSM A;  5B8D A;  1HYJ A;  2MNZ A;  4AYC B;  2LRI C;  1WES A;  4BBQ A;  3MHS A;  2KGG A;  1VFY A;  5H1T A;  1JM7 A;  3M62 A;  2YHN A;  5K3Q A;  3DQV R;  4O64 A;  4UP5 A;  2FFW A;  5C13 A;  2KKX A;  2QIC A;  3LQJ A;  2QJ0 A;  4GNG A;  4IC2 A;  2LXH C;  2MD7 B;  1K2F A; 
#chains in the Genus database with same CATH homology
 2VP7 A;  2C2V S;  3SOW A;  2LDR A;  2VJE B;  4WZ0 A;  2VJF A;  1U6G B;  4I7D A;  3EB5 A;  3LRQ A;  3C5K A;  2C2L A;  2LGG A;  4LAD B;  4A4B A;  2LN0 A;  3ZYQ A;  3ZNI A;  1X4J A;  3PUQ A;  4GB0 A;  4UI9 B;  4I7B A;  2L75 A;  1WGM A;  5TDW A;  5LCW B;  2E6S A;  2LXP C;  4B7Y C;  4W4U A;  4GNF A;  2HYE D;  2KE1 A;  3ZVY A;  1CHC A;  2YT5 A;  4ZQL A;  1WEN A;  2KIZ A;  1WIM A;  2K16 A;  5D1L B;  2KWJ A;  2LGL A;  3HCT A;  1WEU A;  4F52 B;  4YAD A;  3N9O A;  2XEU A;  2K4D A;  3IHP A;  4GND A;  3U5P A;  1E4U A;  2HDP A;  1G25 A;  4YBT A;  2M3H A;  3L1Z B;  2M1R A;  3O70 A;  2LV9 A;  3ZPV E;  2ECT A;  3NG2 A;  3U5M A;  2DX8 A;  3LQI A;  4MVT A;  2I50 A;  5FB0 A;  3RTR B;  2MNY A;  4LK9 A;  1X4I A;  4QF3 A;  1WEE A;  4YC9 A;  4WZ3 B;  2MA6 A;  4AP4 A;  1WEP A;  2ECV A;  2MT5 A;  2H0D B;  2F6N A;  5B79 A;  3L1X A;  4S3O C;  1XWH A;  3ZTG A;  1WE9 A;  2KGI A;  3N9M A;  1MM2 A;  1WEW A;  1WEV A;  5KH3 A;  2YHO A;  1LDK C;  4ZUX U;  2KU3 A;  4YBM A;  4LLB A;  2FUU A;  2KWK A;  5I3L A;  2JMI A;  2EOD A;  3I2D A;  5LKX A;  4A0C D;  3ZVZ B;  2KRE A;  4WZ2 A;  4UP0 A;  3V43 A;  5FB1 A;  4S3O B;  1VD4 A;  3M63 A;  5B76 A;  1Z2Q A;  5LKZ A;  3U5O A;  2LGV A;  2D8S A;  2ECG A;  4AYC A;  2VNF A;  4R8P K;  2RI7 A;  2L0B A;  2LQ6 A;  3KQI A;  2ECW A;  2K17 A;  3LQH A;  4V3K C;  3SHB A;  1FBV A;  2G6Q A;  3O34 A;  4V3L C;  5TAB A;  5H1U A;  3N9N A;  4YBS A;  4L7X A;  2Y43 A;  4R2Y A;  1FP0 A;  2YRE A;  3SOX A;  2MIQ A;  5B77 A;  1LDJ B;  2XB1 A;  5TBN A;  3ASL A;  2CSZ A;  5D1K B;  4PTB A;  1T1H A;  4FO9 A;  3PUR A;  2EGP A;  2L80 A;  2MD8 C;  1WEO A;  4C9Z A;  5AIT A;  2MA5 A;  2VPB A;  5EYA F;  4CA1 A;  2CKL A;  1DVP A;  4WA6 A;  4P5O B;  4R7E A;  4NN2 A;  3C6W A;  2QIZ A;  5G05 B;  3N9L A;  3FL2 A;  4ZDT A;  4A49 A;  2VJE A;  4PPE A;  5DIN A;  4AVX A;  4GNE A;  2KWO A;  2FUI A;  4TKP B;  1JM7 B;  2Y1N A;  3O35 A;  1HYI A;  2YSJ A;  1X4U A;  5J3X A;  2KWN A;  3VK6 A;  2YQL A;  1ZBD B;  2JMJ A;  4CCG X;  2YU4 A;  4BHW A;  2EA6 A;  4YAB A;  4I7C A;  1MM3 A;  3RPG B;  4FIP A;  1WEQ A;  1N87 A;  3O37 A;  5KH9 A;  1BOR A;  2RSD A;  4LJN A;  2G43 A;  2KR4 A;  3HTK C;  3RPG C;  3HCU A;  4IC3 A;  5LKT A;  1V87 A;  4QF2 A;  4B86 C;  2YW8 A;  2FSA A;  2MUM A;  2ECJ A;  1F62 A;  2K1J A;  2YUR A;  2JRJ A;  4YAX A;  4FJC A;  3ZPV 1;  4YAT A;  3M99 A;  4X3G A;  3T6R A;  2BAY A;  2OXQ C;  2F42 A;  4MSX A;  3L11 A;  2E6R A;  2CSY A;  5AIU A;  1WFK A;  3EB6 A;  2YUC A;  2VPE A;  5FEY A;  2IDA A;  1IYM A;  2L43 A;  3GV4 A;  2KYU A;  2PNX A;  5G0F A;  1JOC A;  2YQM A;  2PUY A;  1Z6U A;  3O7A A;  3O36 A;  2CT2 A;  2H0D A;  3KNV A;  4LKA A;  4N4F A;  5B75 A;  1VYX A;  3HCS A;  1WIL A;  3T7L A;  2M85 A;  2LGK A;  5JG6 A;  4AUQ B;  3MHH A;  1WEM A;  4N3W A;  5D1M B;  2KFT A;  5G04 B;  5FER A;  5LKU A;  3PHD A;  3KV5 A;  2AN6 A;  2UZG A;  2VPD A;  2L5U A;  2ZET C;  5KH7 A;  3O33 A;  4Q6F A;  5B78 A;  2VJF B;  2CKL B;  3U5N A;  5DKA A;  2ECI A;  2Y1M A;  4L58 A;  3N9Q A;  5H9M A;  5H1V A;  3GL6 A;  5TDR A;  3KV6 A;  2VPG A;  2YYR A;  3SOU A;  3QZV A;  2M6M A;  2JMD A;  4FK5 A;  2F6J A;  3DPL R;  4A4C A;  4XI1 A;  5TRB A;  3N9P A;  1Z60 A;  2G45 A;  2ECN A;  5C11 A;  2NAA A;  1RMD A;  2YSM A;  5B8D A;  1HYJ A;  2MNZ A;  4AYC B;  2LRI C;  1WES A;  4BBQ A;  3MHS A;  2KGG A;  1VFY A;  5H1T A;  1JM7 A;  3M62 A;  2YHN A;  3DQV R;  4O64 A;  4UP5 A;  5C13 A;  2QIC A;  3LQJ A;  2QJ0 A;  4GNG A;  4IC2 A;  2LXH C;  2MD7 B;  1K2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...