4LLBA

Crystal structure of moz double phd finger histone h3k14ac complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
b'HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4llbA00
2G45A 4R2YA 2EGPA 4WA6A 1XWHA 1WESA 2M6MA 5KH9A 4AP4A 5KH3A 1WEVA 2JMIA 3O33A 5LKUA 4GNDA 1WEOA 4R8PK 5D1KB 4YBSA 3M62A 4XI1A 2LGKA 2VPEA 5H9MA 5LKXA 2KWNA 2F42A 4AUQB 4UP5A 2E6RA 3T6RA 4O64A 1FBVA 3SOUA 2K17A 5EYAF 2PNXA 2F6NA 2LXHC 3HTKC 2EODA 1WGMA 2LGLA 3HCUA 3ZVYA 4A0CD 4N4FA 2L80A 3QZVA 4QF3A 2K1JA 2L75A 2LV9A 3O36A 3L11A 2YREA 5FERA 3KNVA 2RI7A 2YSMA 3N9LA 2H0DB 2JMJA 2VJFB 4YADA 1BORA 2KWKA 2YHOA 4ZQLA 5TDWA 5B75A 4FO9A 5LCWB 2H0DA 2YSJA 2VJFA 3SHBA 3U5NA 2QJ0A 4L58A 3M99A 5DKAA 1LDKC 5D1MB 3RPGB 1K2FA 2EA6A 1WEMA 3KQIA 1G25A 5TDRA 2YT5A 2KGGA 2KYUA 3NG2A 2K4DA 2ECTA 2ECWA 4IC3A 1VD4A 2VPBA 4AVXA 3PHDA 1WEPA 2LQ6A 2IDAA 3N9OA 4GNFA 3L1XA 5G05B 4B86C 1LDJB 3O34A 4X3GA 2KIZA 4YBMA 4S3OB 3U5OA 5JG6A 4BBQA 2FUUA 3GV4A 1WEUA 2KGIA 2MT5A 2NAAA 4GB0A 3ZYQA 2KU3A 5DINA 1N87A 1F62A 2CKLA 5AIUA 2Y43A 3LQIA 5B79A 1JM7A 2VP7A 2I50A 4TKPB 4BHWA 1MM2A 1Z2QA 5AITA 3LQJA 4ZDTA 1VYXA 1WEQA 2M85A 2LGGA 4MSXA 4V3KC 1FP0A 3O70A 4QF2A 4GNEA 2M1RA 4PTBA 2BAYA 3IHPA 2PUYA 2CT2A 2G43A 5J3XA 1WILA 3T7LA 3RTRB 5LKTA 2FSAA 2KWOA 2UZGA 2OXQC 2YURA 1X4JA 1HYJA 3ZPVE 2G6QA 3PUQA 5FEYA 2MNZA 4V3LC 3ZNIA 2QICA 5I3LA 1U6GB 2JMDA 3ZPV1 4A4BA 1WEEA 4I7DA 2ECNA 2E6SA 3MHHA 4FIPA 4YAXA 3U5PA 4YBTA 4A49A 3O35A 3ZTGA 2YQMA 3EB5A 1Z6UA 1T1HA 2L5UA 4IC2A 4P5OB 3EB6A 2YYRA 3N9QA 2KR4A 4F52B 3C5KA 2CSYA 3PURA 3DPLR 3O7AA 1RMDA 1WE9A 5FB1A 3I2DA 2MUMA 2HYED 4WZ2A 2MA5A 4AYCB 4LADB 3N9NA 5FB0A 4FJCA 4ZUXU 3O37A 3ZVZB 2VJEB 4AYCA 1WFKA 2VNFA 4R7EA 1V87A 4LK9A 4Q6FA 3KV6A 4N3WA 4LKAA 2RSDA 3RPGC 2C2VS 3U5MA 5TABA 2VJEA 2XB1A 2LXPC 5B8DA 2LDRA 2Y1NA 4B7YC 2D8SA 4NN2A 4UP0A 4MVTA 5C13A 5H1VA 2Y1MA 4WZ3B 2KWJA 3FL2A 3HCTA 4I7CA 3V43A 2L0BA 1JOCA 3C6WA 4CCGX 4WZ0A 1IYMA 2YUCA 4W4UA 1WIMA 2ECVA 5G04B 5TRBA 3LRQA 1HYIA 4S3OC 2ZETC 2JRJA 4LLBA 1WENA 2L43A 1VFYA 2MD8C 2LGVA 2YHNA 2ECJA 2KFTA 3GL6A 2ECIA 1DVPA 1Z60A 5D1LB 2MIQA 1ZBDB 2VPGA 2YU4A 4YABA 2LRIC 5TBNA 5LKZA 5H1TA 3M63A 3SOXA 1WEWA 5C11A 3KV5A 1E4UA 2MNYA 5B76A 1X4UA 3HCSA 5H1UA 3N9PA 2XEUA 3LQHA 2QIZA 3VK6A 2MA6A 5B78A 2KE1A 1MM3A 4C9ZA 2LN0A 2C2LA 4A4CA 4GNGA 1CHCA 2VPDA 4PPEA 4YATA 2K16A 2F6JA 3N9MA 4UI9B 4YC9A 5G0FA 5KH7A 3L1ZB 2KREA 4I7BA 2AN6A 4CA1A 2ECGA 2YQLA 3ASLA 4L7XA 2CSZA 1X4IA 5B77A 3DQVR 2HDPA 2YW8A 2CKLB 3SOWA 2DX8A 2FUIA 4LJNA 2MD7B 3MHSA 2M3HA 4FK5A 1JM7B
chains in the Genus database with same CATH superfamily
2XP0A 2G45A 4R2YA 2EGPA 2MKEA 1XWHA 4WA6A 2JUNA 1WESA 2M6MA 5KH9A 4AP4A 5KH3A 1WEVA 2JMIA 3O33A 2OWAA 5LKUA 4GNDA 1WEOA 4R8PK 2L7PA 5D1KB 4YBSA 3M62A 4XI1A 2LGKA 2VPEA 5H9MA 5LKXA 2KWNA 2F42A 4AUQB 4UP5A 2E6RA 3T6RA 4O64A 2FFWA 1FBVA 3SOUA 2CONA 2K17A 5EYAF 2PNXA 2F6NA 2LXHC 3PLWA 3HTKC 2EODA 1WGMA 2LGLA 3HCUA 3ZVYA 4A0CD 4N4FA 3LVQE 2L80A 3QZVA 4QF3A 2K1JA 2L75A 2LV9A 3KDEC 3O36A 3L11A 5SVIB 2YREA 5FERA 1MBMA 3KNVA 2RI7A 2YSMA 3N9LA 5SVIA 2H0DB 3M7KA 2JMJA 2VJFB 4YADA 4QQ4A 1BORA 2KWKA 2YHOA 4ZQLA 5TDWA 5B75A 4FO9A 5LCWB 2H0DA 2YSJA 2VJFA 3SHBA 3U5NA 2QJ0A 4L58A 3M99A 5DKAA 1LDKC 4O62A 5D1MB 3RPGB 1K2FA 2EA6A 1WEMA 4OGEA 3KQIA 1G25A 5TDRA 2YT5A 2KGGA 2KYUA 3NG2A 2K4DA 2ECTA 2ECWA 4IC3A 1VD4A 2VPBA 4AVXA 3PHDA 1WEPA 2LQ6A 2IDAA 3N9OA 4GNFA 3L1XA 5G05B 2D8UA 1LDJB 2DJAA 4B86C 3O34A 4X3GA 2KIZA 4YBMA 4S3OB 3U5OA 5JG6A 4BBQA 2FUUA 3GV4A 1WEUA 2KGIA 4H9DA 2MT5A 2NAAA 4GB0A 3ZYQA 2KU3A 5DINA 1N87A 1F62A 2CKLA 5AIUA 2Y43A 3LQIA 2XOYA 5B79A 1JM7A 2VP7A 2I50A 4TKPB 4BHWA 1MM2A 1Z2QA 5AITA 3LQJA 4ZDTA 1VYXA 1WEQA 2M85A 2LGGA 4MSXA 4V3KC 1FP0A 3O70A 4QF2A 3O47A 4GNEA 2M1RA 4PTBA 2BAYA 3IHPA 2PUYA 2CT2A 2G43A 5J3XA 1WILA 3T7LA 3RTRB 5LKTA 3FANA 2FSAA 2KWOA 3LDYA 2UZGA 2OXQC 2YURA 1X4JA 1HYJA 3ZPVE 2G6QA 3PUQA 5FEYA 2MNZA 4V3LC 3ZNIA 2QICA 5I3LA 1U6GB 2JMDA 3JUEA 3ZPV1 4A4BA 3FM8C 1WEEA 4I7DA 2ECNA 2E6SA 3MHHA 4FIPA 4YAXA 3U5PA 4YBTA 4A49A 3O35A 3ZTGA 2YQMA 3EB5A 1Z6UA 1T1HA 2L5UA 2CSVA 4IC2A 4P5OB 2EXUA 3EB6A 2YYRA 3DDTA 3N9QA 2KR4A 4F52B 3C5KA 5SVYA 2EGMA 2CSYA 1DCQA 3PURA 3DPLR 3O7AA 1RMDA 1WE9A 5FB1A 3I2DA 2IQJA 2MUMA 2HYED 4WZ2A 2MA5A 4AYCB 4LADB 2P57A 2M13A 3N9NA 3FAOA 5FB0A 4FJCA 4ZUXU 3O37A 3E2DA 3ZVZB 2LAUA 2VJEB 4AYCA 1WFKA 2VNFA 2JM3A 4R7EA 4OGCA 1V87A 4LK9A 4Q6FA 3KV6A 4N3WA 4LKAA 2RSDA 3RPGC 2C2VS 3FEHA 3U5MA 5TABA 2VJEA 2XB1A 2LXPC 5B8DA 2LDRA 2Y1NA 4B7YC 2D8SA 4NN2A 4UP0A 4MVTA 5C13A 5H1VA 2Y1MA 4WZ3B 2YVRA 2KWJA 3FL2A 3HCTA 4I7CA 3V43A 2L0BA 1JOCA 3C6WA 4CCGX 4WZ0A 1IYMA 2YUCA 4F1PA 4W4UA 1WIMA 2ECVA 5G04B 5TRBA 3LRQA 1HYIA 4S3OC 2ZETC 2XOZA 4Z0RA 2JRJA 4LLBA 1WENA 2L43A 1VFYA 2MD8C 2LGVA 2YHNA 2ECJA 2KFTA 5SVXA 3GL6A 2ECIA 1DVPA 3DWDA 1Z60A 5D1LB 2MIQA 1ZBDB 2KKXA 2VPGA 2YU4A 3Q1DA 4YABA 2LRIC 5TBNA 5LKZA 5H1TA 3M63A 3SOXA 1WEWA 5C11A 2FD4A 3T9KA 3KV5A 1E4UA 2MNYA 5B76A 1X4UA 2RR4A 3HCSA 5H1UA 2XOCA 2KKYA 3N9PA 2XEUA 3LQHA 2QIZA 3VK6A 2MA6A 5B78A 2KE1A 1MM3A 2CRRA 4C9ZA 2LN0A 2DSMA 2C2LA 4A4CA 4GNGA 3FJUB 1CHCA 2VPDA 2CRWA 4PPEA 4YATA 3LVRE 2K16A 2F6JA 3N9MA 4UI9B 4YC9A 5G0FA 5KH7A 3L1ZB 2KREA 4I7BA 2AN6A 3SUBA 4CA1A 2ECGA 3LJUX 3MDBC 4Z0OA 2YQLA 3ASLA 4L7XA 2CSZA 1X4IA 5B77A 3H7HA 3DQVR 2HDPA 2YW8A 5K3QA 2B0OE 2CKLB 3SOWA 2DX8A 2FUIA 4LJNA 2MD7B 3MHSA 2E61A 2M3HA 4FK5A 1JM7B
chains in the Genus database with same CATH topology
2G45A 4R2YA 2EGPA 4WA6A 1XWHA 1WESA 2M6MA 5KH9A 4AP4A 5KH3A 1WEVA 2JMIA 3O33A 5LKUA 4GNDA 1WEOA 4R8PK 5D1KB 4YBSA 3M62A 4XI1A 2LGKA 2VPEA 5H9MA 5LKXA 2KWNA 2F42A 4AUQB 4UP5A 2E6RA 3T6RA 4O64A 1FBVA 3SOUA 2K17A 5EYAF 2PNXA 2F6NA 2LXHC 3HTKC 2EODA 1WGMA 2LGLA 3HCUA 3ZVYA 4A0CD 4N4FA 2L80A 3QZVA 4QF3A 2K1JA 2L75A 2LV9A 3O36A 3L11A 2YREA 5FERA 3KNVA 2RI7A 2YSMA 3N9LA 2H0DB 2JMJA 2VJFB 4YADA 1BORA 2KWKA 2YHOA 4ZQLA 5TDWA 5B75A 4FO9A 5LCWB 2H0DA 2YSJA 2VJFA 3SHBA 3U5NA 2QJ0A 4L58A 3M99A 5DKAA 1LDKC 5D1MB 3RPGB 1K2FA 2EA6A 1WEMA 3KQIA 1G25A 5TDRA 2YT5A 2KGGA 2KYUA 3NG2A 2K4DA 2ECTA 2ECWA 4IC3A 1VD4A 2VPBA 4AVXA 3PHDA 1WEPA 2LQ6A 2IDAA 3N9OA 4GNFA 3L1XA 5G05B 4B86C 1LDJB 3O34A 4X3GA 2KIZA 4YBMA 4S3OB 3U5OA 5JG6A 4BBQA 2FUUA 3GV4A 1WEUA 2KGIA 2MT5A 2NAAA 4GB0A 3ZYQA 2KU3A 5DINA 1N87A 1F62A 2CKLA 5AIUA 2Y43A 3LQIA 5B79A 1JM7A 2VP7A 2I50A 4TKPB 4BHWA 1MM2A 1Z2QA 5AITA 3LQJA 4ZDTA 1VYXA 1WEQA 2M85A 2LGGA 4MSXA 4V3KC 1FP0A 3O70A 4QF2A 4GNEA 2M1RA 4PTBA 2BAYA 3IHPA 2PUYA 2CT2A 2G43A 5J3XA 1WILA 3T7LA 3RTRB 5LKTA 2FSAA 2KWOA 2UZGA 2OXQC 2YURA 1X4JA 1HYJA 3ZPVE 2G6QA 3PUQA 5FEYA 2MNZA 4V3LC 3ZNIA 2QICA 5I3LA 1U6GB 2JMDA 3ZPV1 4A4BA 1WEEA 4I7DA 2ECNA 2E6SA 3MHHA 4FIPA 4YAXA 3U5PA 4YBTA 4A49A 3O35A 3ZTGA 2YQMA 3EB5A 1Z6UA 1T1HA 2L5UA 4IC2A 4P5OB 3EB6A 2YYRA 3N9QA 2KR4A 4F52B 3C5KA 2CSYA 3PURA 3DPLR 3O7AA 1RMDA 1WE9A 5FB1A 3I2DA 2MUMA 2HYED 4WZ2A 2MA5A 4AYCB 4LADB 3N9NA 5FB0A 4FJCA 4ZUXU 3O37A 3ZVZB 2VJEB 4AYCA 1WFKA 2VNFA 4R7EA 1V87A 4LK9A 4Q6FA 3KV6A 4N3WA 4LKAA 2RSDA 3RPGC 2C2VS 3U5MA 5TABA 2VJEA 2XB1A 2LXPC 5B8DA 2LDRA 2Y1NA 4B7YC 2D8SA 4NN2A 4UP0A 4MVTA 5C13A 5H1VA 2Y1MA 4WZ3B 2KWJA 3FL2A 3HCTA 4I7CA 3V43A 2L0BA 1JOCA 3C6WA 4CCGX 4WZ0A 1IYMA 2YUCA 4W4UA 1WIMA 2ECVA 5G04B 5TRBA 3LRQA 1HYIA 4S3OC 2ZETC 2JRJA 4LLBA 1WENA 2L43A 1VFYA 2MD8C 2LGVA 2YHNA 2ECJA 2KFTA 3GL6A 2ECIA 1DVPA 1Z60A 5D1LB 2MIQA 1ZBDB 2VPGA 2YU4A 4YABA 2LRIC 5TBNA 5LKZA 5H1TA 3M63A 3SOXA 1WEWA 5C11A 3KV5A 1E4UA 2MNYA 5B76A 1X4UA 3HCSA 5H1UA 3N9PA 2XEUA 3LQHA 2QIZA 3VK6A 2MA6A 5B78A 2KE1A 1MM3A 4C9ZA 2LN0A 2C2LA 4A4CA 4GNGA 1CHCA 2VPDA 4PPEA 4YATA 2K16A 2F6JA 3N9MA 4UI9B 4YC9A 5G0FA 5KH7A 3L1ZB 2KREA 4I7BA 2AN6A 4CA1A 2ECGA 2YQLA 3ASLA 4L7XA 2CSZA 1X4IA 5B77A 3DQVR 2HDPA 2YW8A 2CKLB 3SOWA 2DX8A 2FUIA 4LJNA 2MD7B 3MHSA 2M3HA 4FK5A 1JM7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G45 A;  4R2Y A;  2EGP A;  4WA6 A;  1XWH A;  1WES A;  2M6M A;  5KH9 A;  4AP4 A;  5KH3 A;  1WEV A;  2JMI A;  3O33 A;  5LKU A;  4GND A;  1WEO A;  4R8P K;  5D1K B;  4YBS A;  3M62 A;  4XI1 A;  2LGK A;  2VPE A;  5H9M A;  5LKX A;  2KWN A;  2F42 A;  4AUQ B;  4UP5 A;  2E6R A;  3T6R A;  4O64 A;  1FBV A;  3SOU A;  2K17 A;  5EYA F;  2PNX A;  2F6N A;  2LXH C;  3HTK C;  2EOD A;  1WGM A;  2LGL A;  3HCU A;  3ZVY A;  4A0C D;  4N4F A;  2L80 A;  3QZV A;  4QF3 A;  2K1J A;  2L75 A;  2LV9 A;  3O36 A;  3L11 A;  2YRE A;  5FER A;  3KNV A;  2RI7 A;  2YSM A;  3N9L A;  2H0D B;  2JMJ A;  2VJF B;  4YAD A;  1BOR A;  2KWK A;  2YHO A;  4ZQL A;  5TDW A;  5B75 A;  4FO9 A;  5LCW B;  2H0D A;  2YSJ A;  2VJF A;  3SHB A;  3U5N A;  2QJ0 A;  4L58 A;  3M99 A;  5DKA A;  1LDK C;  5D1M B;  3RPG B;  1K2F A;  2EA6 A;  1WEM A;  3KQI A;  1G25 A;  5TDR A;  2YT5 A;  2KGG A;  2KYU A;  3NG2 A;  2K4D A;  2ECT A;  2ECW A;  4IC3 A;  1VD4 A;  2VPB A;  4AVX A;  3PHD A;  1WEP A;  2LQ6 A;  2IDA A;  3N9O A;  4GNF A;  3L1X A;  5G05 B;  4B86 C;  1LDJ B;  3O34 A;  4X3G A;  2KIZ A;  4YBM A;  4S3O B;  3U5O A;  5JG6 A;  4BBQ A;  2FUU A;  3GV4 A;  1WEU A;  2KGI A;  2MT5 A;  2NAA A;  4GB0 A;  3ZYQ A;  2KU3 A;  5DIN A;  1N87 A;  1F62 A;  2CKL A;  5AIU A;  2Y43 A;  3LQI A;  5B79 A;  1JM7 A;  2VP7 A;  2I50 A;  4TKP B;  4BHW A;  1MM2 A;  1Z2Q A;  5AIT A;  3LQJ A;  4ZDT A;  1VYX A;  1WEQ A;  2M85 A;  2LGG A;  4MSX A;  4V3K C;  1FP0 A;  3O70 A;  4QF2 A;  4GNE A;  2M1R A;  4PTB A;  2BAY A;  3IHP A;  2PUY A;  2CT2 A;  2G43 A;  5J3X A;  1WIL A;  3T7L A;  3RTR B;  5LKT A;  2FSA A;  2KWO A;  2UZG A;  2OXQ C;  2YUR A;  1X4J A;  1HYJ A;  3ZPV E;  2G6Q A;  3PUQ A;  5FEY A;  2MNZ A;  4V3L C;  3ZNI A;  2QIC A;  5I3L A;  1U6G B;  2JMD A;  3ZPV 1;  4A4B A;  1WEE A;  4I7D A;  2ECN A;  2E6S A;  3MHH A;  4FIP A;  4YAX A;  3U5P A;  4YBT A;  4A49 A;  3O35 A;  3ZTG A;  2YQM A;  3EB5 A;  1Z6U A;  1T1H A;  2L5U A;  4IC2 A;  4P5O B;  3EB6 A;  2YYR A;  3N9Q A;  2KR4 A;  4F52 B;  3C5K A;  2CSY A;  3PUR A;  3DPL R;  3O7A A;  1RMD A;  1WE9 A;  5FB1 A;  3I2D A;  2MUM A;  2HYE D;  4WZ2 A;  2MA5 A;  4AYC B;  4LAD B;  3N9N A;  5FB0 A;  4FJC A;  4ZUX U;  3O37 A;  3ZVZ B;  2VJE B;  4AYC A;  1WFK A;  2VNF A;  4R7E A;  1V87 A;  4LK9 A;  4Q6F A;  3KV6 A;  4N3W A;  4LKA A;  2RSD A;  3RPG C;  2C2V S;  3U5M A;  5TAB A;  2VJE A;  2XB1 A;  2LXP C;  5B8D A;  2LDR A;  2Y1N A;  4B7Y C;  2D8S A;  4NN2 A;  4UP0 A;  4MVT A;  5C13 A;  5H1V A;  2Y1M A;  4WZ3 B;  2KWJ A;  3FL2 A;  3HCT A;  4I7C A;  3V43 A;  2L0B A;  1JOC A;  3C6W A;  4CCG X;  4WZ0 A;  1IYM A;  2YUC A;  4W4U A;  1WIM A;  2ECV A;  5G04 B;  5TRB A;  3LRQ A;  1HYI A;  4S3O C;  2ZET C;  2JRJ A;  4LLB A;  1WEN A;  2L43 A;  1VFY A;  2MD8 C;  2LGV A;  2YHN A;  2ECJ A;  2KFT A;  3GL6 A;  2ECI A;  1DVP A;  1Z60 A;  5D1L B;  2MIQ A;  1ZBD B;  2VPG A;  2YU4 A;  4YAB A;  2LRI C;  5TBN A;  5LKZ A;  5H1T A;  3M63 A;  3SOX A;  1WEW A;  5C11 A;  3KV5 A;  1E4U A;  2MNY A;  5B76 A;  1X4U A;  3HCS A;  5H1U A;  3N9P A;  2XEU A;  3LQH A;  2QIZ A;  3VK6 A;  2MA6 A;  5B78 A;  2KE1 A;  1MM3 A;  4C9Z A;  2LN0 A;  2C2L A;  4A4C A;  4GNG A;  1CHC A;  2VPD A;  4PPE A;  4YAT A;  2K16 A;  2F6J A;  3N9M A;  4UI9 B;  4YC9 A;  5G0F A;  5KH7 A;  3L1Z B;  2KRE A;  4I7B A;  2AN6 A;  4CA1 A;  2ECG A;  2YQL A;  3ASL A;  4L7X A;  2CSZ A;  1X4I A;  5B77 A;  3DQV R;  2HDP A;  2YW8 A;  2CKL B;  3SOW A;  2DX8 A;  2FUI A;  4LJN A;  2MD7 B;  3MHS A;  2M3H A;  4FK5 A;  1JM7 B; 
#chains in the Genus database with same CATH topology
 2XP0 A;  2G45 A;  4R2Y A;  2EGP A;  2MKE A;  1XWH A;  4WA6 A;  2JUN A;  1WES A;  2M6M A;  5KH9 A;  4AP4 A;  5KH3 A;  1WEV A;  2JMI A;  3O33 A;  2OWA A;  5LKU A;  4GND A;  1WEO A;  4R8P K;  2L7P A;  5D1K B;  4YBS A;  3M62 A;  4XI1 A;  2LGK A;  2VPE A;  5H9M A;  5LKX A;  2KWN A;  2F42 A;  4AUQ B;  4UP5 A;  2E6R A;  3T6R A;  4O64 A;  2FFW A;  1FBV A;  3SOU A;  2CON A;  2K17 A;  5EYA F;  2PNX A;  2F6N A;  2LXH C;  3PLW A;  3HTK C;  2EOD A;  1WGM A;  2LGL A;  3HCU A;  3ZVY A;  4A0C D;  4N4F A;  3LVQ E;  2L80 A;  3QZV A;  4QF3 A;  2K1J A;  2L75 A;  2LV9 A;  3KDE C;  3O36 A;  3L11 A;  5SVI B;  2YRE A;  5FER A;  1MBM A;  3KNV A;  2RI7 A;  2YSM A;  3N9L A;  5SVI A;  2H0D B;  3M7K A;  2JMJ A;  2VJF B;  4YAD A;  4QQ4 A;  1BOR A;  2KWK A;  2YHO A;  4ZQL A;  5TDW A;  5B75 A;  4FO9 A;  5LCW B;  2H0D A;  2YSJ A;  2VJF A;  3SHB A;  3U5N A;  2QJ0 A;  4L58 A;  3M99 A;  5DKA A;  1LDK C;  4O62 A;  5D1M B;  3RPG B;  1K2F A;  2EA6 A;  1WEM A;  4OGE A;  3KQI A;  1G25 A;  5TDR A;  2YT5 A;  2KGG A;  2KYU A;  3NG2 A;  2K4D A;  2ECT A;  2ECW A;  4IC3 A;  1VD4 A;  2VPB A;  4AVX A;  3PHD A;  1WEP A;  2LQ6 A;  2IDA A;  3N9O A;  4GNF A;  3L1X A;  5G05 B;  2D8U A;  1LDJ B;  2DJA A;  4B86 C;  3O34 A;  4X3G A;  2KIZ A;  4YBM A;  4S3O B;  3U5O A;  5JG6 A;  4BBQ A;  2FUU A;  3GV4 A;  1WEU A;  2KGI A;  4H9D A;  2MT5 A;  2NAA A;  4GB0 A;  3ZYQ A;  2KU3 A;  5DIN A;  1N87 A;  1F62 A;  2CKL A;  5AIU A;  2Y43 A;  3LQI A;  2XOY A;  5B79 A;  1JM7 A;  2VP7 A;  2I50 A;  4TKP B;  4BHW A;  1MM2 A;  1Z2Q A;  5AIT A;  3LQJ A;  4ZDT A;  1VYX A;  1WEQ A;  2M85 A;  2LGG A;  4MSX A;  4V3K C;  1FP0 A;  3O70 A;  4QF2 A;  3O47 A;  4GNE A;  2M1R A;  4PTB A;  2BAY A;  3IHP A;  2PUY A;  2CT2 A;  2G43 A;  5J3X A;  1WIL A;  3T7L A;  3RTR B;  5LKT A;  3FAN A;  2FSA A;  2KWO A;  3LDY A;  2UZG A;  2OXQ C;  2YUR A;  1X4J A;  1HYJ A;  3ZPV E;  2G6Q A;  3PUQ A;  5FEY A;  2MNZ A;  4V3L C;  3ZNI A;  2QIC A;  5I3L A;  1U6G B;  2JMD A;  3JUE A;  3ZPV 1;  4A4B A;  3FM8 C;  1WEE A;  4I7D A;  2ECN A;  2E6S A;  3MHH A;  4FIP A;  4YAX A;  3U5P A;  4YBT A;  4A49 A;  3O35 A;  3ZTG A;  2YQM A;  3EB5 A;  1Z6U A;  1T1H A;  2L5U A;  2CSV A;  4IC2 A;  4P5O B;  2EXU A;  3EB6 A;  2YYR A;  3DDT A;  3N9Q A;  2KR4 A;  4F52 B;  3C5K A;  5SVY A;  2EGM A;  2CSY A;  1DCQ A;  3PUR A;  3DPL R;  3O7A A;  1RMD A;  1WE9 A;  5FB1 A;  3I2D A;  2IQJ A;  2MUM A;  2HYE D;  4WZ2 A;  2MA5 A;  4AYC B;  4LAD B;  2P57 A;  2M13 A;  3N9N A;  3FAO A;  5FB0 A;  4FJC A;  4ZUX U;  3O37 A;  3E2D A;  3ZVZ B;  2LAU A;  2VJE B;  4AYC A;  1WFK A;  2VNF A;  2JM3 A;  4R7E A;  4OGC A;  1V87 A;  4LK9 A;  4Q6F A;  3KV6 A;  4N3W A;  4LKA A;  2RSD A;  3RPG C;  2C2V S;  3FEH A;  3U5M A;  5TAB A;  2VJE A;  2XB1 A;  2LXP C;  5B8D A;  2LDR A;  2Y1N A;  4B7Y C;  2D8S A;  4NN2 A;  4UP0 A;  4MVT A;  5C13 A;  5H1V A;  2Y1M A;  4WZ3 B;  2YVR A;  2KWJ A;  3FL2 A;  3HCT A;  4I7C A;  3V43 A;  2L0B A;  1JOC A;  3C6W A;  4CCG X;  4WZ0 A;  1IYM A;  2YUC A;  4F1P A;  4W4U A;  1WIM A;  2ECV A;  5G04 B;  5TRB A;  3LRQ A;  1HYI A;  4S3O C;  2ZET C;  2XOZ A;  4Z0R A;  2JRJ A;  4LLB A;  1WEN A;  2L43 A;  1VFY A;  2MD8 C;  2LGV A;  2YHN A;  2ECJ A;  2KFT A;  5SVX A;  3GL6 A;  2ECI A;  1DVP A;  3DWD A;  1Z60 A;  5D1L B;  2MIQ A;  1ZBD B;  2KKX A;  2VPG A;  2YU4 A;  3Q1D A;  4YAB A;  2LRI C;  5TBN A;  5LKZ A;  5H1T A;  3M63 A;  3SOX A;  1WEW A;  5C11 A;  2FD4 A;  3T9K A;  3KV5 A;  1E4U A;  2MNY A;  5B76 A;  1X4U A;  2RR4 A;  3HCS A;  5H1U A;  2XOC A;  2KKY A;  3N9P A;  2XEU A;  3LQH A;  2QIZ A;  3VK6 A;  2MA6 A;  5B78 A;  2KE1 A;  1MM3 A;  2CRR A;  4C9Z A;  2LN0 A;  2DSM A;  2C2L A;  4A4C A;  4GNG A;  3FJU B;  1CHC A;  2VPD A;  2CRW A;  4PPE A;  4YAT A;  3LVR E;  2K16 A;  2F6J A;  3N9M A;  4UI9 B;  4YC9 A;  5G0F A;  5KH7 A;  3L1Z B;  2KRE A;  4I7B A;  2AN6 A;  3SUB A;  4CA1 A;  2ECG A;  3LJU X;  3MDB C;  4Z0O A;  2YQL A;  3ASL A;  4L7X A;  2CSZ A;  1X4I A;  5B77 A;  3H7H A;  3DQV R;  2HDP A;  2YW8 A;  5K3Q A;  2B0O E;  2CKL B;  3SOW A;  2DX8 A;  2FUI A;  4LJN A;  2MD7 B;  3MHS A;  2E61 A;  2M3H A;  4FK5 A;  1JM7 B; 
#chains in the Genus database with same CATH homology
 2G45 A;  4R2Y A;  2EGP A;  4WA6 A;  1XWH A;  1WES A;  2M6M A;  5KH9 A;  4AP4 A;  5KH3 A;  1WEV A;  2JMI A;  3O33 A;  5LKU A;  4GND A;  1WEO A;  4R8P K;  5D1K B;  4YBS A;  3M62 A;  4XI1 A;  2LGK A;  2VPE A;  5H9M A;  5LKX A;  2KWN A;  2F42 A;  4AUQ B;  4UP5 A;  2E6R A;  3T6R A;  4O64 A;  1FBV A;  3SOU A;  2K17 A;  5EYA F;  2PNX A;  2F6N A;  2LXH C;  3HTK C;  2EOD A;  1WGM A;  2LGL A;  3HCU A;  3ZVY A;  4A0C D;  4N4F A;  2L80 A;  3QZV A;  4QF3 A;  2K1J A;  2L75 A;  2LV9 A;  3O36 A;  3L11 A;  2YRE A;  5FER A;  3KNV A;  2RI7 A;  2YSM A;  3N9L A;  2H0D B;  2JMJ A;  2VJF B;  4YAD A;  1BOR A;  2KWK A;  2YHO A;  4ZQL A;  5TDW A;  5B75 A;  4FO9 A;  5LCW B;  2H0D A;  2YSJ A;  2VJF A;  3SHB A;  3U5N A;  2QJ0 A;  4L58 A;  3M99 A;  5DKA A;  1LDK C;  5D1M B;  3RPG B;  1K2F A;  2EA6 A;  1WEM A;  3KQI A;  1G25 A;  5TDR A;  2YT5 A;  2KGG A;  2KYU A;  3NG2 A;  2K4D A;  2ECT A;  2ECW A;  4IC3 A;  1VD4 A;  2VPB A;  4AVX A;  3PHD A;  1WEP A;  2LQ6 A;  2IDA A;  3N9O A;  4GNF A;  3L1X A;  5G05 B;  4B86 C;  1LDJ B;  3O34 A;  4X3G A;  2KIZ A;  4YBM A;  4S3O B;  3U5O A;  5JG6 A;  4BBQ A;  2FUU A;  3GV4 A;  1WEU A;  2KGI A;  2MT5 A;  2NAA A;  4GB0 A;  3ZYQ A;  2KU3 A;  5DIN A;  1N87 A;  1F62 A;  2CKL A;  5AIU A;  2Y43 A;  3LQI A;  5B79 A;  1JM7 A;  2VP7 A;  2I50 A;  4TKP B;  4BHW A;  1MM2 A;  1Z2Q A;  5AIT A;  3LQJ A;  4ZDT A;  1VYX A;  1WEQ A;  2M85 A;  2LGG A;  4MSX A;  4V3K C;  1FP0 A;  3O70 A;  4QF2 A;  4GNE A;  2M1R A;  4PTB A;  2BAY A;  3IHP A;  2PUY A;  2CT2 A;  2G43 A;  5J3X A;  1WIL A;  3T7L A;  3RTR B;  5LKT A;  2FSA A;  2KWO A;  2UZG A;  2OXQ C;  2YUR A;  1X4J A;  1HYJ A;  3ZPV E;  2G6Q A;  3PUQ A;  5FEY A;  2MNZ A;  4V3L C;  3ZNI A;  2QIC A;  5I3L A;  1U6G B;  2JMD A;  3ZPV 1;  4A4B A;  1WEE A;  4I7D A;  2ECN A;  2E6S A;  3MHH A;  4FIP A;  4YAX A;  3U5P A;  4YBT A;  4A49 A;  3O35 A;  3ZTG A;  2YQM A;  3EB5 A;  1Z6U A;  1T1H A;  2L5U A;  4IC2 A;  4P5O B;  3EB6 A;  2YYR A;  3N9Q A;  2KR4 A;  4F52 B;  3C5K A;  2CSY A;  3PUR A;  3DPL R;  3O7A A;  1RMD A;  1WE9 A;  5FB1 A;  3I2D A;  2MUM A;  2HYE D;  4WZ2 A;  2MA5 A;  4AYC B;  4LAD B;  3N9N A;  5FB0 A;  4FJC A;  4ZUX U;  3O37 A;  3ZVZ B;  2VJE B;  4AYC A;  1WFK A;  2VNF A;  4R7E A;  1V87 A;  4LK9 A;  4Q6F A;  3KV6 A;  4N3W A;  4LKA A;  2RSD A;  3RPG C;  2C2V S;  3U5M A;  5TAB A;  2VJE A;  2XB1 A;  2LXP C;  5B8D A;  2LDR A;  2Y1N A;  4B7Y C;  2D8S A;  4NN2 A;  4UP0 A;  4MVT A;  5C13 A;  5H1V A;  2Y1M A;  4WZ3 B;  2KWJ A;  3FL2 A;  3HCT A;  4I7C A;  3V43 A;  2L0B A;  1JOC A;  3C6W A;  4CCG X;  4WZ0 A;  1IYM A;  2YUC A;  4W4U A;  1WIM A;  2ECV A;  5G04 B;  5TRB A;  3LRQ A;  1HYI A;  4S3O C;  2ZET C;  2JRJ A;  4LLB A;  1WEN A;  2L43 A;  1VFY A;  2MD8 C;  2LGV A;  2YHN A;  2ECJ A;  2KFT A;  3GL6 A;  2ECI A;  1DVP A;  1Z60 A;  5D1L B;  2MIQ A;  1ZBD B;  2VPG A;  2YU4 A;  4YAB A;  2LRI C;  5TBN A;  5LKZ A;  5H1T A;  3M63 A;  3SOX A;  1WEW A;  5C11 A;  3KV5 A;  1E4U A;  2MNY A;  5B76 A;  1X4U A;  3HCS A;  5H1U A;  3N9P A;  2XEU A;  3LQH A;  2QIZ A;  3VK6 A;  2MA6 A;  5B78 A;  2KE1 A;  1MM3 A;  4C9Z A;  2LN0 A;  2C2L A;  4A4C A;  4GNG A;  1CHC A;  2VPD A;  4PPE A;  4YAT A;  2K16 A;  2F6J A;  3N9M A;  4UI9 B;  4YC9 A;  5G0F A;  5KH7 A;  3L1Z B;  2KRE A;  4I7B A;  2AN6 A;  4CA1 A;  2ECG A;  2YQL A;  3ASL A;  4L7X A;  2CSZ A;  1X4I A;  5B77 A;  3DQV R;  2HDP A;  2YW8 A;  2CKL B;  3SOW A;  2DX8 A;  2FUI A;  4LJN A;  2MD7 B;  3MHS A;  2M3H A;  4FK5 A;  1JM7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...