4LLBA

Crystal structure of moz double phd finger histone h3k14ac complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
publication title The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4llbA00
3KV6A 2ZETC 4R2YA 2MUMA 2KWKA 4FK5A 4YC9A 1HYJA 5AIUA 4ZDTA 1VYXA 2VPBA 3ASLA 3M62A 3L1ZB 1WIMA 2VPEA 3LQIA 4N3WA 1LDJB 1K2FA 5LCWB 4YBMA 2M3HA 1WEUA 1WFKA 2MT5A 4QF3A 1BORA 4FJCA 2H0DA 3T6RA 1T1HA 2Y1NA 4WZ3B 3N9MA 2OXQC 4B86C 2YHOA 3LQJA 2CSZA 2KREA 2ECVA 4AYCA 3RPGB 2YYRA 3HCSA 3C6WA 2ECWA 4I7BA 1Z6UA 2YW8A 3N9NA 5DKAA 4CA1A 1RMDA 1IYMA 2M1RA 4QF2A 2MNYA 5D1LB 5G05B 4PPEA 2K17A 3ZVYA 2FSAA 5KH7A 2CT2A 2KU3A 4IC2A 4R8PK 2VPDA 3SOWA 2LRIC 4L7XA 1WEEA 3HTKC 1X4UA 1WEMA 4S3OB 3KNVA 2DX8A 3V43A 5B78A 2H0DB 2C2VS 3IHPA 3N9OA 2HDPA 2CSYA 4F52B 5B76A 2KWNA 4V3KC 3ZVZB 4A4CA 5TBNA 4AYCB 2L43A 1CHCA 2EODA 1FP0A 5KH3A 2LN0A 2KE1A 5EYAF 2YQLA 3U5MA 4YBSA 2JMIA 4AP4A 1WE9A 1ZBDB 3ZPV1 4YAXA 2G45A 3O7AA 3ZYQA 2PNXA 5LKUA 3DPLR 3SOUA 4LK9A 3M99A 4Q6FA 1E4UA 4GNFA 2UZGA 1U6GB 3LQHA 4FO9A 3NG2A 1WEOA 4BBQA 2KFTA 5B75A 3M63A 2CKLA 4BHWA 4W4UA 4GNDA 4GNEA 2LGKA 2KGIA 3MHSA 1WENA 5TABA 2MA6A 3EB6A 5H1UA 3C5KA 5G04B 2KR4A 5D1MB 5C13A 5JG6A 2KIZA 4NN2A 2NAAA 2QIZA 5FB0A 4ZQLA 3N9QA 4WA6A 4LKAA 1Z2QA 2YSJA 4IC3A 1WILA 3U5PA 2ECJA 2YSMA 2LGVA 2IDAA 2YT5A 3L11A 2K1JA 2FUUA 2QICA 3O36A 4WZ2A 3N9LA 2E6SA 4FIPA 4O64A 3U5NA 5FERA 4YATA 2D8SA 2FUIA 2CKLB 1X4IA 2MIQA 1WEQA 4UP0A 3SHBA 2VP7A 4YADA 4UI9B 5B8DA 4X3GA 4ZUXU 2L0BA 3KQIA 1MM2A 1JM7A 3RPGC 2KYUA 2YREA 4MVTA 5B79A 1G25A 3ZTGA 4A49A 2F42A 2JMDA 3GV4A 4LJNA 5DINA 3O70A 1LDKC 5B77A 2MA5A 1Z60A 2G43A 2L80A 4A4BA 2PUYA 3I2DA 3L1XA 5H1TA 1WEWA 2I50A 4MSXA 3QZVA 4S3OC 2L75A 4C9ZA 3LRQA 2JMJA 2AN6A 3EB5A 2VPGA 5G0FA 4UP5A 3T7LA 2C2LA 3PURA 4R7EA 5FB1A 2M6MA 5I3LA 1JM7B 1N87A 5AITA 2LXHC 2EGPA 2EA6A 2KWOA 1V87A 3O37A 5TDRA 3PHDA 5LKXA 1X4JA 1VD4A 2ECNA 2L5UA 2LGLA 3HCTA 5H9MA 2LGGA 1F62A 2ECGA 2ECIA 2LQ6A 2YQMA 3O34A 2YHNA 3RTRB 2YU4A 2VJEA 2LDRA 4AUQB 2YUCA 4I7CA 4GNGA 4B7YC 2F6NA 5KH9A 1FBVA 2LV9A 3PUQA 4N4FA 2RSDA 3ZNIA 5D1KB 2KGGA 5J3XA 4XI1A 2G6QA 3HCUA 2VJFB 2XEUA 2Y1MA 3N9PA 4PTBA 4LADB 1WESA 4LLBA 3SOXA 5LKZA 4AVXA 3ZPVE 2MD7B 3O35A 1DVPA 2K4DA 2M85A 2MD8C 4V3LC 3KV5A 4CCGX 5FEYA 2LXPC 2MNZA 1VFYA 1WEVA 3MHHA 2JRJA 4I7DA 2F6JA 3O33A 2Y43A 3GL6A 1WGMA 1HYIA 3U5OA 1XWHA 4P5OB 2QJ0A 5TRBA 2BAYA 2K16A 4YABA 3VK6A 2E6RA 3FL2A 1WEPA 2VJEB 2VNFA 3DQVR 4L58A 4GB0A 2ECTA 2YURA 1JOCA 4TKPB 2HYED 2RI7A 5TDWA 2XB1A 4WZ0A 1MM3A 2KWJA 2VJFA 5LKTA 4YBTA 5H1VA 4A0CD 5C11A
chains in the Genus database with same CATH superfamily
3KV6A 2ZETC 4R2YA 2MUMA 2KWKA 4FK5A 4YC9A 1HYJA 5AIUA 4ZDTA 1VYXA 2VPBA 3ASLA 3M62A 3L1ZB 1WIMA 2VPEA 2OWAA 3LQIA 4N3WA 1LDJB 1K2FA 5LCWB 4YBMA 2CRRA 2M3HA 1WEUA 1WFKA 2MT5A 4QF3A 1BORA 4FJCA 2H0DA 3T6RA 2L7PA 1T1HA 2Y1NA 4WZ3B 3N9MA 2OXQC 4B86C 2YHOA 3LQJA 2CSZA 2KREA 2ECVA 4AYCA 3RPGB 2YYRA 3HCSA 3C6WA 2ECWA 4I7BA 1Z6UA 2YW8A 3N9NA 5DKAA 4CA1A 1RMDA 1IYMA 2M1RA 3DDTA 2MNYA 4QF2A 5D1LB 5G05B 4PPEA 2K17A 2IQJA 3ZVYA 2FSAA 5KH7A 2FD4A 4Z0RA 2CT2A 2B0OE 2KU3A 2EGMA 4IC2A 4R8PK 2VPDA 3SOWA 2LRIC 2JM3A 4L7XA 1WEEA 3HTKC 1X4UA 1WEMA 4S3OB 3KNVA 5K3QA 3MDBC 2DX8A 3V43A 5B78A 2H0DB 2C2VS 3IHPA 3N9OA 2HDPA 3FM8C 2CSYA 4F52B 5B76A 2KWNA 4V3KC 3ZVZB 4A4CA 5TBNA 4AYCB 2L43A 1CHCA 2EODA 1FP0A 5KH3A 2LN0A 2KE1A 5EYAF 2YQLA 3U5MA 4YBSA 2JMIA 4AP4A 1WE9A 1ZBDB 3ZPV1 4YAXA 3PLWA 2G45A 3FEHA 3O7AA 3ZYQA 2PNXA 5LKUA 3DPLR 3SOUA 3DWDA 4LK9A 3M99A 4Q6FA 1E4UA 4GNFA 2UZGA 1U6GB 3LQHA 4FO9A 3NG2A 1WEOA 4BBQA 2KFTA 5SVXA 5B75A 2XOCA 3M63A 2KKXA 2CKLA 4BHWA 4W4UA 4GNDA 4GNEA 2MKEA 2LGKA 2KGIA 3MHSA 1WENA 5TABA 2MA6A 2P57A 3EB6A 3FANA 5H1UA 3C5KA 5G04B 2KR4A 5D1MB 5C13A 5JG6A 2KIZA 4NN2A 2NAAA 2QIZA 5FB0A 4ZQLA 1MBMA 3N9QA 4WA6A 3FAOA 4LKAA 1Z2QA 2YSJA 3SUBA 2JUNA 4IC3A 1WILA 3U5PA 3T9KA 2ECJA 2YSMA 2LGVA 2IDAA 2CSVA 2KKYA 2YT5A 2FFWA 3L11A 2K1JA 2FUUA 2QICA 3O36A 4WZ2A 3N9LA 2E6SA 4FIPA 4O64A 3U5NA 5FERA 4YATA 2D8SA 2FUIA 2CKLB 1X4IA 2MIQA 1WEQA 4UP0A 3SHBA 2VP7A 4YADA 4UI9B 5B8DA 4X3GA 2DSMA 4ZUXU 2L0BA 3KQIA 1MM2A 1JM7A 3RPGC 2KYUA 2CONA 4OGCA 2YREA 4MVTA 5B79A 1G25A 3ZTGA 4A49A 2F42A 3H7HA 2JMDA 3GV4A 4LJNA 5DINA 2D8UA 4OGEA 3O70A 1LDKC 5B77A 2MA5A 1Z60A 2G43A 2L80A 4A4BA 2E61A 2PUYA 3I2DA 3L1XA 5H1TA 1WEWA 2I50A 4MSXA 3QZVA 4S3OC 2L75A 4C9ZA 3LRQA 2JMJA 2AN6A 3EB5A 2VPGA 5G0FA 4UP5A 3T7LA 2C2LA 3PURA 4R7EA 5FB1A 2M6MA 3JUEA 5I3LA 1JM7B 1N87A 5AITA 4O62A 2LXHC 2EGPA 2EA6A 2KWOA 1V87A 3O37A 5TDRA 3PHDA 5LKXA 4F1PA 1X4JA 5SVIA 1VD4A 2ECNA 2L5UA 2LGLA 3HCTA 5H9MA 2XOZA 2LGGA 3O47A 4H9DA 1F62A 2ECGA 2ECIA 2LQ6A 2YQMA 2XP0A 3LVRE 3O34A 2YHNA 3LJUX 3RTRB 2M13A 2YU4A 2VJEA 2LDRA 2XOYA 4AUQB 2YUCA 4I7CA 4GNGA 4QQ4A 4B7YC 2F6NA 5KH9A 1FBVA 2DJAA 2LV9A 3PUQA 4N4FA 2RSDA 3ZNIA 5D1KB 2KGGA 2CRWA 2EXUA 4XI1A 5J3XA 2G6QA 3HCUA 2VJFB 2XEUA 2Y1MA 2RR4A 3N9PA 4PTBA 4LADB 1WESA 4LLBA 3SOXA 3M7KA 5SVYA 5LKZA 4AVXA 3ZPVE 2MD7B 3O35A 1DVPA 2K4DA 2M85A 2MD8C 4V3LC 3KV5A 4CCGX 5FEYA 2LXPC 2MNZA 1VFYA 1WEVA 3Q1DA 2LAUA 3KDEC 3MHHA 2JRJA 5SVIB 4I7DA 2F6JA 3O33A 2Y43A 3GL6A 1WGMA 1HYIA 3U5OA 1XWHA 4P5OB 2QJ0A 5TRBA 2BAYA 2K16A 4YABA 3VK6A 2E6RA 3FL2A 1WEPA 2VJEB 2VNFA 3DQVR 4L58A 2YVRA 4GB0A 2ECTA 2YURA 1JOCA 4TKPB 3LDYA 2HYED 2RI7A 5TDWA 2XB1A 3E2DA 4WZ0A 3FJUB 1MM3A 2KWJA 2VJFA 3LVQE 5LKTA 1DCQA 4YBTA 4Z0OA 5H1VA 4A0CD 5C11A
chains in the Genus database with same CATH topology
3KV6A 2ZETC 4R2YA 2MUMA 2KWKA 4FK5A 4YC9A 1HYJA 5AIUA 4ZDTA 1VYXA 2VPBA 3ASLA 3M62A 3L1ZB 1WIMA 2VPEA 3LQIA 4N3WA 1LDJB 1K2FA 5LCWB 4YBMA 2M3HA 1WEUA 1WFKA 2MT5A 4QF3A 1BORA 4FJCA 2H0DA 3T6RA 1T1HA 2Y1NA 4WZ3B 3N9MA 2OXQC 4B86C 2YHOA 3LQJA 2CSZA 2KREA 2ECVA 4AYCA 3RPGB 2YYRA 3HCSA 3C6WA 2ECWA 4I7BA 1Z6UA 2YW8A 3N9NA 5DKAA 4CA1A 1RMDA 1IYMA 2M1RA 4QF2A 2MNYA 5D1LB 5G05B 4PPEA 2K17A 3ZVYA 2FSAA 5KH7A 2CT2A 2KU3A 4IC2A 4R8PK 2VPDA 3SOWA 2LRIC 4L7XA 1WEEA 3HTKC 1X4UA 1WEMA 4S3OB 3KNVA 2DX8A 3V43A 5B78A 2H0DB 2C2VS 3IHPA 3N9OA 2HDPA 2CSYA 4F52B 5B76A 2KWNA 4V3KC 3ZVZB 4A4CA 5TBNA 4AYCB 2L43A 1CHCA 2EODA 1FP0A 5KH3A 2LN0A 2KE1A 5EYAF 2YQLA 3U5MA 4YBSA 2JMIA 4AP4A 1WE9A 1ZBDB 3ZPV1 4YAXA 2G45A 3O7AA 3ZYQA 2PNXA 5LKUA 3DPLR 3SOUA 4LK9A 3M99A 4Q6FA 1E4UA 4GNFA 2UZGA 1U6GB 3LQHA 4FO9A 3NG2A 1WEOA 4BBQA 2KFTA 5B75A 3M63A 2CKLA 4BHWA 4W4UA 4GNDA 4GNEA 2LGKA 2KGIA 3MHSA 1WENA 5TABA 2MA6A 3EB6A 5H1UA 3C5KA 5G04B 2KR4A 5D1MB 5C13A 5JG6A 2KIZA 4NN2A 2NAAA 2QIZA 5FB0A 4ZQLA 3N9QA 4WA6A 4LKAA 1Z2QA 2YSJA 4IC3A 1WILA 3U5PA 2ECJA 2YSMA 2LGVA 2IDAA 2YT5A 3L11A 2K1JA 2FUUA 2QICA 3O36A 4WZ2A 3N9LA 2E6SA 4FIPA 4O64A 3U5NA 5FERA 4YATA 2D8SA 2FUIA 2CKLB 1X4IA 2MIQA 1WEQA 4UP0A 3SHBA 2VP7A 4YADA 4UI9B 5B8DA 4X3GA 4ZUXU 2L0BA 3KQIA 1MM2A 1JM7A 3RPGC 2KYUA 2YREA 4MVTA 5B79A 1G25A 3ZTGA 4A49A 2F42A 2JMDA 3GV4A 4LJNA 5DINA 3O70A 1LDKC 5B77A 2MA5A 1Z60A 2G43A 2L80A 4A4BA 2PUYA 3I2DA 3L1XA 5H1TA 1WEWA 2I50A 4MSXA 3QZVA 4S3OC 2L75A 4C9ZA 3LRQA 2JMJA 2AN6A 3EB5A 2VPGA 5G0FA 4UP5A 3T7LA 2C2LA 3PURA 4R7EA 5FB1A 2M6MA 5I3LA 1JM7B 1N87A 5AITA 2LXHC 2EGPA 2EA6A 2KWOA 1V87A 3O37A 5TDRA 3PHDA 5LKXA 1X4JA 1VD4A 2ECNA 2L5UA 2LGLA 3HCTA 5H9MA 2LGGA 1F62A 2ECGA 2ECIA 2LQ6A 2YQMA 3O34A 2YHNA 3RTRB 2YU4A 2VJEA 2LDRA 4AUQB 2YUCA 4I7CA 4GNGA 4B7YC 2F6NA 5KH9A 1FBVA 2LV9A 3PUQA 4N4FA 2RSDA 3ZNIA 5D1KB 2KGGA 5J3XA 4XI1A 2G6QA 3HCUA 2VJFB 2XEUA 2Y1MA 3N9PA 4PTBA 4LADB 1WESA 4LLBA 3SOXA 5LKZA 4AVXA 3ZPVE 2MD7B 3O35A 1DVPA 2K4DA 2M85A 2MD8C 4V3LC 3KV5A 4CCGX 5FEYA 2LXPC 2MNZA 1VFYA 1WEVA 3MHHA 2JRJA 4I7DA 2F6JA 3O33A 2Y43A 3GL6A 1WGMA 1HYIA 3U5OA 1XWHA 4P5OB 2QJ0A 5TRBA 2BAYA 2K16A 4YABA 3VK6A 2E6RA 3FL2A 1WEPA 2VJEB 2VNFA 3DQVR 4L58A 4GB0A 2ECTA 2YURA 1JOCA 4TKPB 2HYED 2RI7A 5TDWA 2XB1A 4WZ0A 1MM3A 2KWJA 2VJFA 5LKTA 4YBTA 5H1VA 4A0CD 5C11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV6 A;  2ZET C;  4R2Y A;  2MUM A;  2KWK A;  4FK5 A;  4YC9 A;  1HYJ A;  5AIU A;  4ZDT A;  1VYX A;  2VPB A;  3ASL A;  3M62 A;  3L1Z B;  1WIM A;  2VPE A;  3LQI A;  4N3W A;  1LDJ B;  1K2F A;  5LCW B;  4YBM A;  2M3H A;  1WEU A;  1WFK A;  2MT5 A;  4QF3 A;  1BOR A;  4FJC A;  2H0D A;  3T6R A;  1T1H A;  2Y1N A;  4WZ3 B;  3N9M A;  2OXQ C;  4B86 C;  2YHO A;  3LQJ A;  2CSZ A;  2KRE A;  2ECV A;  4AYC A;  3RPG B;  2YYR A;  3HCS A;  3C6W A;  2ECW A;  4I7B A;  1Z6U A;  2YW8 A;  3N9N A;  5DKA A;  4CA1 A;  1RMD A;  1IYM A;  2M1R A;  4QF2 A;  2MNY A;  5D1L B;  5G05 B;  4PPE A;  2K17 A;  3ZVY A;  2FSA A;  5KH7 A;  2CT2 A;  2KU3 A;  4IC2 A;  4R8P K;  2VPD A;  3SOW A;  2LRI C;  4L7X A;  1WEE A;  3HTK C;  1X4U A;  1WEM A;  4S3O B;  3KNV A;  2DX8 A;  3V43 A;  5B78 A;  2H0D B;  2C2V S;  3IHP A;  3N9O A;  2HDP A;  2CSY A;  4F52 B;  5B76 A;  2KWN A;  4V3K C;  3ZVZ B;  4A4C A;  5TBN A;  4AYC B;  2L43 A;  1CHC A;  2EOD A;  1FP0 A;  5KH3 A;  2LN0 A;  2KE1 A;  5EYA F;  2YQL A;  3U5M A;  4YBS A;  2JMI A;  4AP4 A;  1WE9 A;  1ZBD B;  3ZPV 1;  4YAX A;  2G45 A;  3O7A A;  3ZYQ A;  2PNX A;  5LKU A;  3DPL R;  3SOU A;  4LK9 A;  3M99 A;  4Q6F A;  1E4U A;  4GNF A;  2UZG A;  1U6G B;  3LQH A;  4FO9 A;  3NG2 A;  1WEO A;  4BBQ A;  2KFT A;  5B75 A;  3M63 A;  2CKL A;  4BHW A;  4W4U A;  4GND A;  4GNE A;  2LGK A;  2KGI A;  3MHS A;  1WEN A;  5TAB A;  2MA6 A;  3EB6 A;  5H1U A;  3C5K A;  5G04 B;  2KR4 A;  5D1M B;  5C13 A;  5JG6 A;  2KIZ A;  4NN2 A;  2NAA A;  2QIZ A;  5FB0 A;  4ZQL A;  3N9Q A;  4WA6 A;  4LKA A;  1Z2Q A;  2YSJ A;  4IC3 A;  1WIL A;  3U5P A;  2ECJ A;  2YSM A;  2LGV A;  2IDA A;  2YT5 A;  3L11 A;  2K1J A;  2FUU A;  2QIC A;  3O36 A;  4WZ2 A;  3N9L A;  2E6S A;  4FIP A;  4O64 A;  3U5N A;  5FER A;  4YAT A;  2D8S A;  2FUI A;  2CKL B;  1X4I A;  2MIQ A;  1WEQ A;  4UP0 A;  3SHB A;  2VP7 A;  4YAD A;  4UI9 B;  5B8D A;  4X3G A;  4ZUX U;  2L0B A;  3KQI A;  1MM2 A;  1JM7 A;  3RPG C;  2KYU A;  2YRE A;  4MVT A;  5B79 A;  1G25 A;  3ZTG A;  4A49 A;  2F42 A;  2JMD A;  3GV4 A;  4LJN A;  5DIN A;  3O70 A;  1LDK C;  5B77 A;  2MA5 A;  1Z60 A;  2G43 A;  2L80 A;  4A4B A;  2PUY A;  3I2D A;  3L1X A;  5H1T A;  1WEW A;  2I50 A;  4MSX A;  3QZV A;  4S3O C;  2L75 A;  4C9Z A;  3LRQ A;  2JMJ A;  2AN6 A;  3EB5 A;  2VPG A;  5G0F A;  4UP5 A;  3T7L A;  2C2L A;  3PUR A;  4R7E A;  5FB1 A;  2M6M A;  5I3L A;  1JM7 B;  1N87 A;  5AIT A;  2LXH C;  2EGP A;  2EA6 A;  2KWO A;  1V87 A;  3O37 A;  5TDR A;  3PHD A;  5LKX A;  1X4J A;  1VD4 A;  2ECN A;  2L5U A;  2LGL A;  3HCT A;  5H9M A;  2LGG A;  1F62 A;  2ECG A;  2ECI A;  2LQ6 A;  2YQM A;  3O34 A;  2YHN A;  3RTR B;  2YU4 A;  2VJE A;  2LDR A;  4AUQ B;  2YUC A;  4I7C A;  4GNG A;  4B7Y C;  2F6N A;  5KH9 A;  1FBV A;  2LV9 A;  3PUQ A;  4N4F A;  2RSD A;  3ZNI A;  5D1K B;  2KGG A;  5J3X A;  4XI1 A;  2G6Q A;  3HCU A;  2VJF B;  2XEU A;  2Y1M A;  3N9P A;  4PTB A;  4LAD B;  1WES A;  4LLB A;  3SOX A;  5LKZ A;  4AVX A;  3ZPV E;  2MD7 B;  3O35 A;  1DVP A;  2K4D A;  2M85 A;  2MD8 C;  4V3L C;  3KV5 A;  4CCG X;  5FEY A;  2LXP C;  2MNZ A;  1VFY A;  1WEV A;  3MHH A;  2JRJ A;  4I7D A;  2F6J A;  3O33 A;  2Y43 A;  3GL6 A;  1WGM A;  1HYI A;  3U5O A;  1XWH A;  4P5O B;  2QJ0 A;  5TRB A;  2BAY A;  2K16 A;  4YAB A;  3VK6 A;  2E6R A;  3FL2 A;  1WEP A;  2VJE B;  2VNF A;  3DQV R;  4L58 A;  4GB0 A;  2ECT A;  2YUR A;  1JOC A;  4TKP B;  2HYE D;  2RI7 A;  5TDW A;  2XB1 A;  4WZ0 A;  1MM3 A;  2KWJ A;  2VJF A;  5LKT A;  4YBT A;  5H1V A;  4A0C D;  5C11 A; 
#chains in the Genus database with same CATH topology
 3KV6 A;  2ZET C;  4R2Y A;  2MUM A;  2KWK A;  4FK5 A;  4YC9 A;  1HYJ A;  5AIU A;  4ZDT A;  1VYX A;  2VPB A;  3ASL A;  3M62 A;  3L1Z B;  1WIM A;  2VPE A;  2OWA A;  3LQI A;  4N3W A;  1LDJ B;  1K2F A;  5LCW B;  4YBM A;  2CRR A;  2M3H A;  1WEU A;  1WFK A;  2MT5 A;  4QF3 A;  1BOR A;  4FJC A;  2H0D A;  3T6R A;  2L7P A;  1T1H A;  2Y1N A;  4WZ3 B;  3N9M A;  2OXQ C;  4B86 C;  2YHO A;  3LQJ A;  2CSZ A;  2KRE A;  2ECV A;  4AYC A;  3RPG B;  2YYR A;  3HCS A;  3C6W A;  2ECW A;  4I7B A;  1Z6U A;  2YW8 A;  3N9N A;  5DKA A;  4CA1 A;  1RMD A;  1IYM A;  2M1R A;  3DDT A;  2MNY A;  4QF2 A;  5D1L B;  5G05 B;  4PPE A;  2K17 A;  2IQJ A;  3ZVY A;  2FSA A;  5KH7 A;  2FD4 A;  4Z0R A;  2CT2 A;  2B0O E;  2KU3 A;  2EGM A;  4IC2 A;  4R8P K;  2VPD A;  3SOW A;  2LRI C;  2JM3 A;  4L7X A;  1WEE A;  3HTK C;  1X4U A;  1WEM A;  4S3O B;  3KNV A;  5K3Q A;  3MDB C;  2DX8 A;  3V43 A;  5B78 A;  2H0D B;  2C2V S;  3IHP A;  3N9O A;  2HDP A;  3FM8 C;  2CSY A;  4F52 B;  5B76 A;  2KWN A;  4V3K C;  3ZVZ B;  4A4C A;  5TBN A;  4AYC B;  2L43 A;  1CHC A;  2EOD A;  1FP0 A;  5KH3 A;  2LN0 A;  2KE1 A;  5EYA F;  2YQL A;  3U5M A;  4YBS A;  2JMI A;  4AP4 A;  1WE9 A;  1ZBD B;  3ZPV 1;  4YAX A;  3PLW A;  2G45 A;  3FEH A;  3O7A A;  3ZYQ A;  2PNX A;  5LKU A;  3DPL R;  3SOU A;  3DWD A;  4LK9 A;  3M99 A;  4Q6F A;  1E4U A;  4GNF A;  2UZG A;  1U6G B;  3LQH A;  4FO9 A;  3NG2 A;  1WEO A;  4BBQ A;  2KFT A;  5SVX A;  5B75 A;  2XOC A;  3M63 A;  2KKX A;  2CKL A;  4BHW A;  4W4U A;  4GND A;  4GNE A;  2MKE A;  2LGK A;  2KGI A;  3MHS A;  1WEN A;  5TAB A;  2MA6 A;  2P57 A;  3EB6 A;  3FAN A;  5H1U A;  3C5K A;  5G04 B;  2KR4 A;  5D1M B;  5C13 A;  5JG6 A;  2KIZ A;  4NN2 A;  2NAA A;  2QIZ A;  5FB0 A;  4ZQL A;  1MBM A;  3N9Q A;  4WA6 A;  3FAO A;  4LKA A;  1Z2Q A;  2YSJ A;  3SUB A;  2JUN A;  4IC3 A;  1WIL A;  3U5P A;  3T9K A;  2ECJ A;  2YSM A;  2LGV A;  2IDA A;  2CSV A;  2KKY A;  2YT5 A;  2FFW A;  3L11 A;  2K1J A;  2FUU A;  2QIC A;  3O36 A;  4WZ2 A;  3N9L A;  2E6S A;  4FIP A;  4O64 A;  3U5N A;  5FER A;  4YAT A;  2D8S A;  2FUI A;  2CKL B;  1X4I A;  2MIQ A;  1WEQ A;  4UP0 A;  3SHB A;  2VP7 A;  4YAD A;  4UI9 B;  5B8D A;  4X3G A;  2DSM A;  4ZUX U;  2L0B A;  3KQI A;  1MM2 A;  1JM7 A;  3RPG C;  2KYU A;  2CON A;  4OGC A;  2YRE A;  4MVT A;  5B79 A;  1G25 A;  3ZTG A;  4A49 A;  2F42 A;  3H7H A;  2JMD A;  3GV4 A;  4LJN A;  5DIN A;  2D8U A;  4OGE A;  3O70 A;  1LDK C;  5B77 A;  2MA5 A;  1Z60 A;  2G43 A;  2L80 A;  4A4B A;  2E61 A;  2PUY A;  3I2D A;  3L1X A;  5H1T A;  1WEW A;  2I50 A;  4MSX A;  3QZV A;  4S3O C;  2L75 A;  4C9Z A;  3LRQ A;  2JMJ A;  2AN6 A;  3EB5 A;  2VPG A;  5G0F A;  4UP5 A;  3T7L A;  2C2L A;  3PUR A;  4R7E A;  5FB1 A;  2M6M A;  3JUE A;  5I3L A;  1JM7 B;  1N87 A;  5AIT A;  4O62 A;  2LXH C;  2EGP A;  2EA6 A;  2KWO A;  1V87 A;  3O37 A;  5TDR A;  3PHD A;  5LKX A;  4F1P A;  1X4J A;  5SVI A;  1VD4 A;  2ECN A;  2L5U A;  2LGL A;  3HCT A;  5H9M A;  2XOZ A;  2LGG A;  3O47 A;  4H9D A;  1F62 A;  2ECG A;  2ECI A;  2LQ6 A;  2YQM A;  2XP0 A;  3LVR E;  3O34 A;  2YHN A;  3LJU X;  3RTR B;  2M13 A;  2YU4 A;  2VJE A;  2LDR A;  2XOY A;  4AUQ B;  2YUC A;  4I7C A;  4GNG A;  4QQ4 A;  4B7Y C;  2F6N A;  5KH9 A;  1FBV A;  2DJA A;  2LV9 A;  3PUQ A;  4N4F A;  2RSD A;  3ZNI A;  5D1K B;  2KGG A;  2CRW A;  2EXU A;  4XI1 A;  5J3X A;  2G6Q A;  3HCU A;  2VJF B;  2XEU A;  2Y1M A;  2RR4 A;  3N9P A;  4PTB A;  4LAD B;  1WES A;  4LLB A;  3SOX A;  3M7K A;  5SVY A;  5LKZ A;  4AVX A;  3ZPV E;  2MD7 B;  3O35 A;  1DVP A;  2K4D A;  2M85 A;  2MD8 C;  4V3L C;  3KV5 A;  4CCG X;  5FEY A;  2LXP C;  2MNZ A;  1VFY A;  1WEV A;  3Q1D A;  2LAU A;  3KDE C;  3MHH A;  2JRJ A;  5SVI B;  4I7D A;  2F6J A;  3O33 A;  2Y43 A;  3GL6 A;  1WGM A;  1HYI A;  3U5O A;  1XWH A;  4P5O B;  2QJ0 A;  5TRB A;  2BAY A;  2K16 A;  4YAB A;  3VK6 A;  2E6R A;  3FL2 A;  1WEP A;  2VJE B;  2VNF A;  3DQV R;  4L58 A;  2YVR A;  4GB0 A;  2ECT A;  2YUR A;  1JOC A;  4TKP B;  3LDY A;  2HYE D;  2RI7 A;  5TDW A;  2XB1 A;  3E2D A;  4WZ0 A;  3FJU B;  1MM3 A;  2KWJ A;  2VJF A;  3LVQ E;  5LKT A;  1DCQ A;  4YBT A;  4Z0O A;  5H1V A;  4A0C D;  5C11 A; 
#chains in the Genus database with same CATH homology
 3KV6 A;  2ZET C;  4R2Y A;  2MUM A;  2KWK A;  4FK5 A;  4YC9 A;  1HYJ A;  5AIU A;  4ZDT A;  1VYX A;  2VPB A;  3ASL A;  3M62 A;  3L1Z B;  1WIM A;  2VPE A;  3LQI A;  4N3W A;  1LDJ B;  1K2F A;  5LCW B;  4YBM A;  2M3H A;  1WEU A;  1WFK A;  2MT5 A;  4QF3 A;  1BOR A;  4FJC A;  2H0D A;  3T6R A;  1T1H A;  2Y1N A;  4WZ3 B;  3N9M A;  2OXQ C;  4B86 C;  2YHO A;  3LQJ A;  2CSZ A;  2KRE A;  2ECV A;  4AYC A;  3RPG B;  2YYR A;  3HCS A;  3C6W A;  2ECW A;  4I7B A;  1Z6U A;  2YW8 A;  3N9N A;  5DKA A;  4CA1 A;  1RMD A;  1IYM A;  2M1R A;  4QF2 A;  2MNY A;  5D1L B;  5G05 B;  4PPE A;  2K17 A;  3ZVY A;  2FSA A;  5KH7 A;  2CT2 A;  2KU3 A;  4IC2 A;  4R8P K;  2VPD A;  3SOW A;  2LRI C;  4L7X A;  1WEE A;  3HTK C;  1X4U A;  1WEM A;  4S3O B;  3KNV A;  2DX8 A;  3V43 A;  5B78 A;  2H0D B;  2C2V S;  3IHP A;  3N9O A;  2HDP A;  2CSY A;  4F52 B;  5B76 A;  2KWN A;  4V3K C;  3ZVZ B;  4A4C A;  5TBN A;  4AYC B;  2L43 A;  1CHC A;  2EOD A;  1FP0 A;  5KH3 A;  2LN0 A;  2KE1 A;  5EYA F;  2YQL A;  3U5M A;  4YBS A;  2JMI A;  4AP4 A;  1WE9 A;  1ZBD B;  3ZPV 1;  4YAX A;  2G45 A;  3O7A A;  3ZYQ A;  2PNX A;  5LKU A;  3DPL R;  3SOU A;  4LK9 A;  3M99 A;  4Q6F A;  1E4U A;  4GNF A;  2UZG A;  1U6G B;  3LQH A;  4FO9 A;  3NG2 A;  1WEO A;  4BBQ A;  2KFT A;  5B75 A;  3M63 A;  2CKL A;  4BHW A;  4W4U A;  4GND A;  4GNE A;  2LGK A;  2KGI A;  3MHS A;  1WEN A;  5TAB A;  2MA6 A;  3EB6 A;  5H1U A;  3C5K A;  5G04 B;  2KR4 A;  5D1M B;  5C13 A;  5JG6 A;  2KIZ A;  4NN2 A;  2NAA A;  2QIZ A;  5FB0 A;  4ZQL A;  3N9Q A;  4WA6 A;  4LKA A;  1Z2Q A;  2YSJ A;  4IC3 A;  1WIL A;  3U5P A;  2ECJ A;  2YSM A;  2LGV A;  2IDA A;  2YT5 A;  3L11 A;  2K1J A;  2FUU A;  2QIC A;  3O36 A;  4WZ2 A;  3N9L A;  2E6S A;  4FIP A;  4O64 A;  3U5N A;  5FER A;  4YAT A;  2D8S A;  2FUI A;  2CKL B;  1X4I A;  2MIQ A;  1WEQ A;  4UP0 A;  3SHB A;  2VP7 A;  4YAD A;  4UI9 B;  5B8D A;  4X3G A;  4ZUX U;  2L0B A;  3KQI A;  1MM2 A;  1JM7 A;  3RPG C;  2KYU A;  2YRE A;  4MVT A;  5B79 A;  1G25 A;  3ZTG A;  4A49 A;  2F42 A;  2JMD A;  3GV4 A;  4LJN A;  5DIN A;  3O70 A;  1LDK C;  5B77 A;  2MA5 A;  1Z60 A;  2G43 A;  2L80 A;  4A4B A;  2PUY A;  3I2D A;  3L1X A;  5H1T A;  1WEW A;  2I50 A;  4MSX A;  3QZV A;  4S3O C;  2L75 A;  4C9Z A;  3LRQ A;  2JMJ A;  2AN6 A;  3EB5 A;  2VPG A;  5G0F A;  4UP5 A;  3T7L A;  2C2L A;  3PUR A;  4R7E A;  5FB1 A;  2M6M A;  5I3L A;  1JM7 B;  1N87 A;  5AIT A;  2LXH C;  2EGP A;  2EA6 A;  2KWO A;  1V87 A;  3O37 A;  5TDR A;  3PHD A;  5LKX A;  1X4J A;  1VD4 A;  2ECN A;  2L5U A;  2LGL A;  3HCT A;  5H9M A;  2LGG A;  1F62 A;  2ECG A;  2ECI A;  2LQ6 A;  2YQM A;  3O34 A;  2YHN A;  3RTR B;  2YU4 A;  2VJE A;  2LDR A;  4AUQ B;  2YUC A;  4I7C A;  4GNG A;  4B7Y C;  2F6N A;  5KH9 A;  1FBV A;  2LV9 A;  3PUQ A;  4N4F A;  2RSD A;  3ZNI A;  5D1K B;  2KGG A;  5J3X A;  4XI1 A;  2G6Q A;  3HCU A;  2VJF B;  2XEU A;  2Y1M A;  3N9P A;  4PTB A;  4LAD B;  1WES A;  4LLB A;  3SOX A;  5LKZ A;  4AVX A;  3ZPV E;  2MD7 B;  3O35 A;  1DVP A;  2K4D A;  2M85 A;  2MD8 C;  4V3L C;  3KV5 A;  4CCG X;  5FEY A;  2LXP C;  2MNZ A;  1VFY A;  1WEV A;  3MHH A;  2JRJ A;  4I7D A;  2F6J A;  3O33 A;  2Y43 A;  3GL6 A;  1WGM A;  1HYI A;  3U5O A;  1XWH A;  4P5O B;  2QJ0 A;  5TRB A;  2BAY A;  2K16 A;  4YAB A;  3VK6 A;  2E6R A;  3FL2 A;  1WEP A;  2VJE B;  2VNF A;  3DQV R;  4L58 A;  4GB0 A;  2ECT A;  2YUR A;  1JOC A;  4TKP B;  2HYE D;  2RI7 A;  5TDW A;  2XB1 A;  4WZ0 A;  1MM3 A;  2KWJ A;  2VJF A;  5LKT A;  4YBT A;  5H1V A;  4A0C D;  5C11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...