2YQMA

Solution structure of the fyve domain in zinc finger fyve domain-containing protein 12
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
GSSGSSGIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords RUN and FYVE domain-containing protein 1
publication title Solution structure of the FYVE domain in zinc finger FYVE domain-containing protein 12
rcsb
source organism Homo sapiens
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yqmA01
3M99A 3L1XA 2KR4A 2AN6A 2YSJA 3HCUA 3DPLR 4IC2A 2K1JA 1X4UA 1WEMA 4NN2A 2VJFB 1WEVA 4O64A 1WIMA 1FP0A 1F62A 1BORA 3SHBA 1WEOA 1RMDA 3HCSA 2MA6A 3FL2A 5B79A 2KREA 4I7BA 3O7AA 5FB1A 2L0BA 3SOUA 4S3OC 3N9NA 3PHDA 4MVTA 4X3GA 1E4UA 3N9OA 3HCTA 5LKTA 2LGLA 2L5UA 2VJEA 4BBQA 4WZ2A 5TDRA 4R8PK 3LQIA 3U5NA 3MHHA 3EB6A 5FB0A 2LDRA 3PURA 3RPGC 2G45A 1N87A 2M3HA 2KYUA 2EA6A 2F6NA 4B86C 4Q6FA 2KFTA 4GNGA 2NAAA 2VPDA 3PUQA 5LKZA 4A4CA 2M1RA 4LKAA 2YURA 1WEUA 4S3OB 1T1HA 3O36A 3L11A 4LK9A 2MNZA 5B78A 1CHCA 3EB5A 2D8SA 4V3KC 4PTBA 2MA5A 5C11A 3N9QA 3RPGB 4QF3A 2G6QA 2MUMA 2QIZA 5TABA 2YSMA 1WEPA 2G43A 4B7YC 2F42A 4AYCA 2YQLA 2F6JA 3L1ZB 1WENA 2M85A 4AP4A 2LV9A 2RI7A 4W4UA 3SOWA 2UZGA 2YHOA 3ZTGA 3O37A 4AVXA 3T6RA 4R7EA 2ECWA 2Y43A 2MIQA 2PNXA 4CCGX 2CSYA 5LKUA 4UP5A 4I7CA 3RTRB 1DVPA 2L43A 1U6GB 4FK5A 2EODA 3HTKC 3MHSA 2K16A 3I2DA 4V3LC 4YADA 5G05B 3N9PA 2ZETC 3ASLA 3C5KA 4UI9B 1JOCA 5B77A 1LDKC 3N9LA 4WA6A 2QJ0A 2KGIA 4AUQB 5D1MB 5D1KB 2OXQC 4YATA 2FUIA 1FBVA 2JMIA 5G04B 5H1UA 3GL6A 2HYED 4GNEA 3KV5A 5TRBA 4YBTA 2KU3A 2LXPC 1MM2A 2YU4A 4QF2A 5KH7A 4A0CD 4R2YA 2LRIC 2VP7A 2CKLA 2KE1A 3IHPA 1Z60A 3LQJA 2ECIA 4N4FA 4YBSA 4YC9A 2H0DA 3ZVYA 2JMDA 4IC3A 5B8DA 4ZDTA 3ZPV1 4GNFA 2JRJA 3ZNIA 5J3XA 3KV6A 2JMJA 3T7LA 4LJNA 2EGPA 3O34A 1WGMA 3GV4A 5DKAA 2ECJA 1MM3A 2Y1NA 5B76A 2VJEB 2FSAA 2VNFA 4A49A 2LGKA 2Y1MA 2VJFA 3ZVZB 2QICA 1K2FA 2L80A 3LRQA 5EYAF 1Z2QA 1WFKA 4FIPA 2MNYA 4L7XA 4A4BA 4CA1A 2RSDA 4UP0A 1V87A 5KH9A 5FERA 1G25A 1IYMA 2KWKA 4ZQLA 2LQ6A 2KGGA 2L75A 1WEEA 2VPEA 2YUCA 3DQVR 2CT2A 1WEQA 2LGVA 3O70A 4FJCA 3ZPVE 2ECGA 4WZ0A 2M6MA 3NG2A 2LGGA 1LDJB 2K17A 2ECNA 5FEYA 2BAYA 2XB1A 3ZYQA 2VPGA 2I50A 4FO9A 4AYCB 1X4IA 4L58A 3O33A 1ZBDB 5AIUA 4F52B 5JG6A 1VD4A 3N9MA 2C2VS 2K4DA 5B75A 1JM7A 4ZUXU 3U5PA 5C13A 3SOXA 2KWOA 3C6WA 5LCWB 4YBMA 2MD7B 4LLBA 2YHNA 2MD8C 2ECVA 2CSZA 4YAXA 3U5OA 5H9MA 2YT5A 2C2LA 3V43A 2YW8A 2E6RA 2KWJA 4MSXA 2FUUA 4XI1A 1VYXA 4BHWA 1HYJA 1Z6UA 4P5OB 5TBNA 3VK6A 5H1VA 2YYRA 5AITA 2PUYA 3M63A 5DINA 3LQHA 3U5MA 1VFYA 4PPEA 2KIZA 5D1LB 1JM7B 2E6SA 4GNDA 2DX8A 3QZVA 4LADB 3M62A 1WILA 5TDWA 2HDPA 5KH3A 2KWNA 5I3LA 5G0FA 2LXHC 2MT5A 4C9ZA 1WEWA 5LKXA 1HYIA 1X4JA 2CKLB 1WESA 3O35A 2ECTA 2YREA 3KNVA 1XWHA 4WZ3B 4YABA 1WE9A 5H1TA 2H0DB 2YQMA 2IDAA 2VPBA 2LN0A 4I7DA 4N3WA 4GB0A 2XEUA 3KQIA 4TKPB
chains in the Genus database with same CATH superfamily
3M99A 3L1XA 2KR4A 4Z0OA 2AN6A 2YSJA 3HCUA 4OGEA 2KKXA 3DPLR 4IC2A 2K1JA 1X4UA 1WEMA 5K3QA 4NN2A 2VJFB 1WEVA 3O47A 4O64A 1WIMA 1FP0A 2CONA 1F62A 1BORA 3FANA 3SHBA 1WEOA 1RMDA 3HCSA 2MA6A 3FL2A 5B79A 2KREA 4I7BA 3O7AA 5FB1A 2L0BA 3SOUA 4OGCA 4S3OC 4F1PA 3N9NA 3PHDA 4MVTA 2E61A 4X3GA 1E4UA 2XOYA 3N9OA 3HCTA 5LKTA 2LGLA 2L5UA 2VJEA 3FAOA 4BBQA 4WZ2A 5TDRA 4R8PK 3LQIA 3U5NA 3MHHA 3EB6A 5FB0A 2LDRA 3PURA 3RPGC 2G45A 1N87A 2M3HA 2KYUA 2LAUA 2EA6A 2F6NA 4B86C 4Q6FA 2KFTA 4GNGA 2NAAA 2VPDA 3PUQA 5LKZA 4A4CA 2M1RA 4LKAA 2YURA 1WEUA 4S3OB 1T1HA 3E2DA 3O36A 3L11A 4LK9A 3Q1DA 2MNZA 5B78A 1CHCA 3EB5A 2D8SA 4V3KC 4PTBA 2MA5A 5C11A 3N9QA 3RPGB 4QF3A 2G6QA 2MUMA 2QIZA 5TABA 2YSMA 1WEPA 2G43A 4B7YC 2F42A 4AYCA 3FM8C 2YQLA 2F6JA 3L1ZB 1WENA 2M85A 4AP4A 2LV9A 2RI7A 4W4UA 3SOWA 2UZGA 2YHOA 3ZTGA 3O37A 4AVXA 3T6RA 2DJAA 2ECWA 4R7EA 2Y43A 2MIQA 2PNXA 4CCGX 2CSYA 5LKUA 4UP5A 4I7CA 3RTRB 1DVPA 2L43A 3FJUB 1U6GB 4FK5A 2EODA 3HTKC 3MHSA 2K16A 3I2DA 4V3LC 4YADA 5G05B 3N9PA 2ZETC 3ASLA 3C5KA 4UI9B 1JOCA 5B77A 1LDKC 3N9LA 4WA6A 2QJ0A 2KGIA 4AUQB 5D1MB 2OWAA 2D8UA 2OXQC 4YATA 2FUIA 1FBVA 2JMIA 5D1KB 5G04B 5H1UA 2CRRA 3GL6A 2HYED 4GNEA 3KV5A 5TRBA 4YBTA 2KU3A 2XOZA 2LXPC 1MM2A 5SVIA 2B0OE 2YU4A 4QF2A 2XP0A 5KH7A 4A0CD 4R2YA 2LRIC 2VP7A 3SUBA 2CKLA 2KE1A 3IHPA 3T9KA 1Z60A 3LQJA 5SVYA 2ECIA 4N4FA 4YBSA 4YC9A 2H0DA 3ZVYA 2FD4A 2JMDA 4IC3A 5B8DA 2JUNA 4ZDTA 3ZPV1 4GNFA 2IQJA 2JRJA 3ZNIA 2CSVA 5J3XA 3KV6A 2JMJA 3T7LA 4LJNA 2EGPA 3O34A 1WGMA 3GV4A 5DKAA 2ECJA 1MM3A 2Y1NA 5B76A 2VJEB 2KKYA 2MKEA 3LDYA 2FSAA 2VNFA 4A49A 2LGKA 2Y1MA 2VJFA 3ZVZB 2QICA 1K2FA 5SVIB 2L80A 3LRQA 4QQ4A 5EYAF 1Z2QA 1WFKA 4FIPA 2DSMA 1DCQA 2MNYA 4L7XA 4A4BA 4CA1A 2RSDA 4UP0A 1V87A 5KH9A 5FERA 1G25A 4H9DA 1IYMA 2KWKA 4ZQLA 2LQ6A 2KGGA 2L75A 1WEEA 2VPEA 2YUCA 3DQVR 2CT2A 1WEQA 2LGVA 3O70A 4FJCA 3ZPVE 2ECGA 4WZ0A 2YVRA 2L7PA 2M6MA 3NG2A 2LGGA 1LDJB 2K17A 3DDTA 2ECNA 5FEYA 2BAYA 2XB1A 3ZYQA 2VPGA 2I50A 4FO9A 4AYCB 1X4IA 4L58A 3O33A 1ZBDB 5AIUA 3LJUX 2JM3A 4F52B 5JG6A 1VD4A 3N9MA 2C2VS 2K4DA 2EXUA 5B75A 1JM7A 3PLWA 4ZUXU 3U5PA 5C13A 3SOXA 2EGMA 2KWOA 3C6WA 3H7HA 5LCWB 4YBMA 2MD7B 4LLBA 2YHNA 2MD8C 2ECVA 2CSZA 4O62A 4YAXA 3U5OA 5H9MA 2YT5A 3M7KA 2C2LA 3V43A 2YW8A 2E6RA 2KWJA 4MSXA 2FUUA 3JUEA 4XI1A 1VYXA 4BHWA 1HYJA 1Z6UA 4P5OB 5TBNA 3VK6A 5H1VA 2YYRA 5AITA 2PUYA 3M63A 2P57A 5DINA 3LQHA 3U5MA 1VFYA 3DWDA 4PPEA 2KIZA 5D1LB 2XOCA 4Z0RA 1MBMA 1JM7B 2E6SA 4GNDA 2DX8A 3QZVA 4LADB 3MDBC 3M62A 1WILA 5TDWA 2HDPA 5KH3A 2KWNA 5I3LA 5G0FA 2LXHC 3LVQE 2MT5A 3FEHA 3KDEC 3LVRE 4C9ZA 1WEWA 5LKXA 2CRWA 1HYIA 1X4JA 2CKLB 1WESA 3O35A 2ECTA 5SVXA 2RR4A 2YREA 3KNVA 1XWHA 4WZ3B 4YABA 1WE9A 2FFWA 5H1TA 2H0DB 2M13A 2YQMA 2IDAA 2VPBA 2LN0A 4I7DA 4N3WA 4GB0A 2XEUA 3KQIA 4TKPB
chains in the Genus database with same CATH topology
3M99A 3L1XA 2KR4A 2AN6A 2YSJA 3HCUA 3DPLR 4IC2A 2K1JA 1X4UA 1WEMA 4NN2A 2VJFB 1WEVA 4O64A 1WIMA 1FP0A 1F62A 1BORA 3SHBA 1WEOA 1RMDA 3HCSA 2MA6A 3FL2A 5B79A 2KREA 4I7BA 3O7AA 5FB1A 2L0BA 3SOUA 4S3OC 3N9NA 3PHDA 4MVTA 4X3GA 1E4UA 3N9OA 3HCTA 5LKTA 2LGLA 2L5UA 2VJEA 4BBQA 4WZ2A 5TDRA 4R8PK 3LQIA 3U5NA 3MHHA 3EB6A 5FB0A 2LDRA 3PURA 3RPGC 2G45A 1N87A 2M3HA 2KYUA 2EA6A 2F6NA 4B86C 4Q6FA 2KFTA 4GNGA 2NAAA 2VPDA 3PUQA 5LKZA 4A4CA 2M1RA 4LKAA 2YURA 1WEUA 4S3OB 1T1HA 3O36A 3L11A 4LK9A 2MNZA 5B78A 1CHCA 3EB5A 2D8SA 4V3KC 4PTBA 2MA5A 5C11A 3N9QA 3RPGB 4QF3A 2G6QA 2MUMA 2QIZA 5TABA 2YSMA 1WEPA 2G43A 4B7YC 2F42A 4AYCA 2YQLA 2F6JA 3L1ZB 1WENA 2M85A 4AP4A 2LV9A 2RI7A 4W4UA 3SOWA 2UZGA 2YHOA 3ZTGA 3O37A 4AVXA 3T6RA 4R7EA 2ECWA 2Y43A 2MIQA 2PNXA 4CCGX 2CSYA 5LKUA 4UP5A 4I7CA 3RTRB 1DVPA 2L43A 1U6GB 4FK5A 2EODA 3HTKC 3MHSA 2K16A 3I2DA 4V3LC 4YADA 5G05B 3N9PA 2ZETC 3ASLA 3C5KA 4UI9B 1JOCA 5B77A 1LDKC 3N9LA 4WA6A 2QJ0A 2KGIA 4AUQB 5D1MB 5D1KB 2OXQC 4YATA 2FUIA 1FBVA 2JMIA 5G04B 5H1UA 3GL6A 2HYED 4GNEA 3KV5A 5TRBA 4YBTA 2KU3A 2LXPC 1MM2A 2YU4A 4QF2A 5KH7A 4A0CD 4R2YA 2LRIC 2VP7A 2CKLA 2KE1A 3IHPA 1Z60A 3LQJA 2ECIA 4N4FA 4YBSA 4YC9A 2H0DA 3ZVYA 2JMDA 4IC3A 5B8DA 4ZDTA 3ZPV1 4GNFA 2JRJA 3ZNIA 5J3XA 3KV6A 2JMJA 3T7LA 4LJNA 2EGPA 3O34A 1WGMA 3GV4A 5DKAA 2ECJA 1MM3A 2Y1NA 5B76A 2VJEB 2FSAA 2VNFA 4A49A 2LGKA 2Y1MA 2VJFA 3ZVZB 2QICA 1K2FA 2L80A 3LRQA 5EYAF 1Z2QA 1WFKA 4FIPA 2MNYA 4L7XA 4A4BA 4CA1A 2RSDA 4UP0A 1V87A 5KH9A 5FERA 1G25A 1IYMA 2KWKA 4ZQLA 2LQ6A 2KGGA 2L75A 1WEEA 2VPEA 2YUCA 3DQVR 2CT2A 1WEQA 2LGVA 3O70A 4FJCA 3ZPVE 2ECGA 4WZ0A 2M6MA 3NG2A 2LGGA 1LDJB 2K17A 2ECNA 5FEYA 2BAYA 2XB1A 3ZYQA 2VPGA 2I50A 4FO9A 4AYCB 1X4IA 4L58A 3O33A 1ZBDB 5AIUA 4F52B 5JG6A 1VD4A 3N9MA 2C2VS 2K4DA 5B75A 1JM7A 4ZUXU 3U5PA 5C13A 3SOXA 2KWOA 3C6WA 5LCWB 4YBMA 2MD7B 4LLBA 2YHNA 2MD8C 2ECVA 2CSZA 4YAXA 3U5OA 5H9MA 2YT5A 2C2LA 3V43A 2YW8A 2E6RA 2KWJA 4MSXA 2FUUA 4XI1A 1VYXA 4BHWA 1HYJA 1Z6UA 4P5OB 5TBNA 3VK6A 5H1VA 2YYRA 5AITA 2PUYA 3M63A 5DINA 3LQHA 3U5MA 1VFYA 4PPEA 2KIZA 5D1LB 1JM7B 2E6SA 4GNDA 2DX8A 3QZVA 4LADB 3M62A 1WILA 5TDWA 2HDPA 5KH3A 2KWNA 5I3LA 5G0FA 2LXHC 2MT5A 4C9ZA 1WEWA 5LKXA 1HYIA 1X4JA 2CKLB 1WESA 3O35A 2ECTA 2YREA 3KNVA 1XWHA 4WZ3B 4YABA 1WE9A 5H1TA 2H0DB 2YQMA 2IDAA 2VPBA 2LN0A 4I7DA 4N3WA 4GB0A 2XEUA 3KQIA 4TKPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M99 A;  3L1X A;  2KR4 A;  2AN6 A;  2YSJ A;  3HCU A;  3DPL R;  4IC2 A;  2K1J A;  1X4U A;  1WEM A;  4NN2 A;  2VJF B;  1WEV A;  4O64 A;  1WIM A;  1FP0 A;  1F62 A;  1BOR A;  3SHB A;  1WEO A;  1RMD A;  3HCS A;  2MA6 A;  3FL2 A;  5B79 A;  2KRE A;  4I7B A;  3O7A A;  5FB1 A;  2L0B A;  3SOU A;  4S3O C;  3N9N A;  3PHD A;  4MVT A;  4X3G A;  1E4U A;  3N9O A;  3HCT A;  5LKT A;  2LGL A;  2L5U A;  2VJE A;  4BBQ A;  4WZ2 A;  5TDR A;  4R8P K;  3LQI A;  3U5N A;  3MHH A;  3EB6 A;  5FB0 A;  2LDR A;  3PUR A;  3RPG C;  2G45 A;  1N87 A;  2M3H A;  2KYU A;  2EA6 A;  2F6N A;  4B86 C;  4Q6F A;  2KFT A;  4GNG A;  2NAA A;  2VPD A;  3PUQ A;  5LKZ A;  4A4C A;  2M1R A;  4LKA A;  2YUR A;  1WEU A;  4S3O B;  1T1H A;  3O36 A;  3L11 A;  4LK9 A;  2MNZ A;  5B78 A;  1CHC A;  3EB5 A;  2D8S A;  4V3K C;  4PTB A;  2MA5 A;  5C11 A;  3N9Q A;  3RPG B;  4QF3 A;  2G6Q A;  2MUM A;  2QIZ A;  5TAB A;  2YSM A;  1WEP A;  2G43 A;  4B7Y C;  2F42 A;  4AYC A;  2YQL A;  2F6J A;  3L1Z B;  1WEN A;  2M85 A;  4AP4 A;  2LV9 A;  2RI7 A;  4W4U A;  3SOW A;  2UZG A;  2YHO A;  3ZTG A;  3O37 A;  4AVX A;  3T6R A;  4R7E A;  2ECW A;  2Y43 A;  2MIQ A;  2PNX A;  4CCG X;  2CSY A;  5LKU A;  4UP5 A;  4I7C A;  3RTR B;  1DVP A;  2L43 A;  1U6G B;  4FK5 A;  2EOD A;  3HTK C;  3MHS A;  2K16 A;  3I2D A;  4V3L C;  4YAD A;  5G05 B;  3N9P A;  2ZET C;  3ASL A;  3C5K A;  4UI9 B;  1JOC A;  5B77 A;  1LDK C;  3N9L A;  4WA6 A;  2QJ0 A;  2KGI A;  4AUQ B;  5D1M B;  5D1K B;  2OXQ C;  4YAT A;  2FUI A;  1FBV A;  2JMI A;  5G04 B;  5H1U A;  3GL6 A;  2HYE D;  4GNE A;  3KV5 A;  5TRB A;  4YBT A;  2KU3 A;  2LXP C;  1MM2 A;  2YU4 A;  4QF2 A;  5KH7 A;  4A0C D;  4R2Y A;  2LRI C;  2VP7 A;  2CKL A;  2KE1 A;  3IHP A;  1Z60 A;  3LQJ A;  2ECI A;  4N4F A;  4YBS A;  4YC9 A;  2H0D A;  3ZVY A;  2JMD A;  4IC3 A;  5B8D A;  4ZDT A;  3ZPV 1;  4GNF A;  2JRJ A;  3ZNI A;  5J3X A;  3KV6 A;  2JMJ A;  3T7L A;  4LJN A;  2EGP A;  3O34 A;  1WGM A;  3GV4 A;  5DKA A;  2ECJ A;  1MM3 A;  2Y1N A;  5B76 A;  2VJE B;  2FSA A;  2VNF A;  4A49 A;  2LGK A;  2Y1M A;  2VJF A;  3ZVZ B;  2QIC A;  1K2F A;  2L80 A;  3LRQ A;  5EYA F;  1Z2Q A;  1WFK A;  4FIP A;  2MNY A;  4L7X A;  4A4B A;  4CA1 A;  2RSD A;  4UP0 A;  1V87 A;  5KH9 A;  5FER A;  1G25 A;  1IYM A;  2KWK A;  4ZQL A;  2LQ6 A;  2KGG A;  2L75 A;  1WEE A;  2VPE A;  2YUC A;  3DQV R;  2CT2 A;  1WEQ A;  2LGV A;  3O70 A;  4FJC A;  3ZPV E;  2ECG A;  4WZ0 A;  2M6M A;  3NG2 A;  2LGG A;  1LDJ B;  2K17 A;  2ECN A;  5FEY A;  2BAY A;  2XB1 A;  3ZYQ A;  2VPG A;  2I50 A;  4FO9 A;  4AYC B;  1X4I A;  4L58 A;  3O33 A;  1ZBD B;  5AIU A;  4F52 B;  5JG6 A;  1VD4 A;  3N9M A;  2C2V S;  2K4D A;  5B75 A;  1JM7 A;  4ZUX U;  3U5P A;  5C13 A;  3SOX A;  2KWO A;  3C6W A;  5LCW B;  4YBM A;  2MD7 B;  4LLB A;  2YHN A;  2MD8 C;  2ECV A;  2CSZ A;  4YAX A;  3U5O A;  5H9M A;  2YT5 A;  2C2L A;  3V43 A;  2YW8 A;  2E6R A;  2KWJ A;  4MSX A;  2FUU A;  4XI1 A;  1VYX A;  4BHW A;  1HYJ A;  1Z6U A;  4P5O B;  5TBN A;  3VK6 A;  5H1V A;  2YYR A;  5AIT A;  2PUY A;  3M63 A;  5DIN A;  3LQH A;  3U5M A;  1VFY A;  4PPE A;  2KIZ A;  5D1L B;  1JM7 B;  2E6S A;  4GND A;  2DX8 A;  3QZV A;  4LAD B;  3M62 A;  1WIL A;  5TDW A;  2HDP A;  5KH3 A;  2KWN A;  5I3L A;  5G0F A;  2LXH C;  2MT5 A;  4C9Z A;  1WEW A;  5LKX A;  1HYI A;  1X4J A;  2CKL B;  1WES A;  3O35 A;  2ECT A;  2YRE A;  3KNV A;  1XWH A;  4WZ3 B;  4YAB A;  1WE9 A;  5H1T A;  2H0D B;  2YQM A;  2IDA A;  2VPB A;  2LN0 A;  4I7D A;  4N3W A;  4GB0 A;  2XEU A;  3KQI A;  4TKP B; 
#chains in the Genus database with same CATH topology
 3M99 A;  3L1X A;  2KR4 A;  4Z0O A;  2AN6 A;  2YSJ A;  3HCU A;  4OGE A;  2KKX A;  3DPL R;  4IC2 A;  2K1J A;  1X4U A;  1WEM A;  5K3Q A;  4NN2 A;  2VJF B;  1WEV A;  3O47 A;  4O64 A;  1WIM A;  1FP0 A;  2CON A;  1F62 A;  1BOR A;  3FAN A;  3SHB A;  1WEO A;  1RMD A;  3HCS A;  2MA6 A;  3FL2 A;  5B79 A;  2KRE A;  4I7B A;  3O7A A;  5FB1 A;  2L0B A;  3SOU A;  4OGC A;  4S3O C;  4F1P A;  3N9N A;  3PHD A;  4MVT A;  2E61 A;  4X3G A;  1E4U A;  2XOY A;  3N9O A;  3HCT A;  5LKT A;  2LGL A;  2L5U A;  2VJE A;  3FAO A;  4BBQ A;  4WZ2 A;  5TDR A;  4R8P K;  3LQI A;  3U5N A;  3MHH A;  3EB6 A;  5FB0 A;  2LDR A;  3PUR A;  3RPG C;  2G45 A;  1N87 A;  2M3H A;  2KYU A;  2LAU A;  2EA6 A;  2F6N A;  4B86 C;  4Q6F A;  2KFT A;  4GNG A;  2NAA A;  2VPD A;  3PUQ A;  5LKZ A;  4A4C A;  2M1R A;  4LKA A;  2YUR A;  1WEU A;  4S3O B;  1T1H A;  3E2D A;  3O36 A;  3L11 A;  4LK9 A;  3Q1D A;  2MNZ A;  5B78 A;  1CHC A;  3EB5 A;  2D8S A;  4V3K C;  4PTB A;  2MA5 A;  5C11 A;  3N9Q A;  3RPG B;  4QF3 A;  2G6Q A;  2MUM A;  2QIZ A;  5TAB A;  2YSM A;  1WEP A;  2G43 A;  4B7Y C;  2F42 A;  4AYC A;  3FM8 C;  2YQL A;  2F6J A;  3L1Z B;  1WEN A;  2M85 A;  4AP4 A;  2LV9 A;  2RI7 A;  4W4U A;  3SOW A;  2UZG A;  2YHO A;  3ZTG A;  3O37 A;  4AVX A;  3T6R A;  2DJA A;  2ECW A;  4R7E A;  2Y43 A;  2MIQ A;  2PNX A;  4CCG X;  2CSY A;  5LKU A;  4UP5 A;  4I7C A;  3RTR B;  1DVP A;  2L43 A;  3FJU B;  1U6G B;  4FK5 A;  2EOD A;  3HTK C;  3MHS A;  2K16 A;  3I2D A;  4V3L C;  4YAD A;  5G05 B;  3N9P A;  2ZET C;  3ASL A;  3C5K A;  4UI9 B;  1JOC A;  5B77 A;  1LDK C;  3N9L A;  4WA6 A;  2QJ0 A;  2KGI A;  4AUQ B;  5D1M B;  2OWA A;  2D8U A;  2OXQ C;  4YAT A;  2FUI A;  1FBV A;  2JMI A;  5D1K B;  5G04 B;  5H1U A;  2CRR A;  3GL6 A;  2HYE D;  4GNE A;  3KV5 A;  5TRB A;  4YBT A;  2KU3 A;  2XOZ A;  2LXP C;  1MM2 A;  5SVI A;  2B0O E;  2YU4 A;  4QF2 A;  2XP0 A;  5KH7 A;  4A0C D;  4R2Y A;  2LRI C;  2VP7 A;  3SUB A;  2CKL A;  2KE1 A;  3IHP A;  3T9K A;  1Z60 A;  3LQJ A;  5SVY A;  2ECI A;  4N4F A;  4YBS A;  4YC9 A;  2H0D A;  3ZVY A;  2FD4 A;  2JMD A;  4IC3 A;  5B8D A;  2JUN A;  4ZDT A;  3ZPV 1;  4GNF A;  2IQJ A;  2JRJ A;  3ZNI A;  2CSV A;  5J3X A;  3KV6 A;  2JMJ A;  3T7L A;  4LJN A;  2EGP A;  3O34 A;  1WGM A;  3GV4 A;  5DKA A;  2ECJ A;  1MM3 A;  2Y1N A;  5B76 A;  2VJE B;  2KKY A;  2MKE A;  3LDY A;  2FSA A;  2VNF A;  4A49 A;  2LGK A;  2Y1M A;  2VJF A;  3ZVZ B;  2QIC A;  1K2F A;  5SVI B;  2L80 A;  3LRQ A;  4QQ4 A;  5EYA F;  1Z2Q A;  1WFK A;  4FIP A;  2DSM A;  1DCQ A;  2MNY A;  4L7X A;  4A4B A;  4CA1 A;  2RSD A;  4UP0 A;  1V87 A;  5KH9 A;  5FER A;  1G25 A;  4H9D A;  1IYM A;  2KWK A;  4ZQL A;  2LQ6 A;  2KGG A;  2L75 A;  1WEE A;  2VPE A;  2YUC A;  3DQV R;  2CT2 A;  1WEQ A;  2LGV A;  3O70 A;  4FJC A;  3ZPV E;  2ECG A;  4WZ0 A;  2YVR A;  2L7P A;  2M6M A;  3NG2 A;  2LGG A;  1LDJ B;  2K17 A;  3DDT A;  2ECN A;  5FEY A;  2BAY A;  2XB1 A;  3ZYQ A;  2VPG A;  2I50 A;  4FO9 A;  4AYC B;  1X4I A;  4L58 A;  3O33 A;  1ZBD B;  5AIU A;  3LJU X;  2JM3 A;  4F52 B;  5JG6 A;  1VD4 A;  3N9M A;  2C2V S;  2K4D A;  2EXU A;  5B75 A;  1JM7 A;  3PLW A;  4ZUX U;  3U5P A;  5C13 A;  3SOX A;  2EGM A;  2KWO A;  3C6W A;  3H7H A;  5LCW B;  4YBM A;  2MD7 B;  4LLB A;  2YHN A;  2MD8 C;  2ECV A;  2CSZ A;  4O62 A;  4YAX A;  3U5O A;  5H9M A;  2YT5 A;  3M7K A;  2C2L A;  3V43 A;  2YW8 A;  2E6R A;  2KWJ A;  4MSX A;  2FUU A;  3JUE A;  4XI1 A;  1VYX A;  4BHW A;  1HYJ A;  1Z6U A;  4P5O B;  5TBN A;  3VK6 A;  5H1V A;  2YYR A;  5AIT A;  2PUY A;  3M63 A;  2P57 A;  5DIN A;  3LQH A;  3U5M A;  1VFY A;  3DWD A;  4PPE A;  2KIZ A;  5D1L B;  2XOC A;  4Z0R A;  1MBM A;  1JM7 B;  2E6S A;  4GND A;  2DX8 A;  3QZV A;  4LAD B;  3MDB C;  3M62 A;  1WIL A;  5TDW A;  2HDP A;  5KH3 A;  2KWN A;  5I3L A;  5G0F A;  2LXH C;  3LVQ E;  2MT5 A;  3FEH A;  3KDE C;  3LVR E;  4C9Z A;  1WEW A;  5LKX A;  2CRW A;  1HYI A;  1X4J A;  2CKL B;  1WES A;  3O35 A;  2ECT A;  5SVX A;  2RR4 A;  2YRE A;  3KNV A;  1XWH A;  4WZ3 B;  4YAB A;  1WE9 A;  2FFW A;  5H1T A;  2H0D B;  2M13 A;  2YQM A;  2IDA A;  2VPB A;  2LN0 A;  4I7D A;  4N3W A;  4GB0 A;  2XEU A;  3KQI A;  4TKP B; 
#chains in the Genus database with same CATH homology
 3M99 A;  3L1X A;  2KR4 A;  2AN6 A;  2YSJ A;  3HCU A;  3DPL R;  4IC2 A;  2K1J A;  1X4U A;  1WEM A;  4NN2 A;  2VJF B;  1WEV A;  4O64 A;  1WIM A;  1FP0 A;  1F62 A;  1BOR A;  3SHB A;  1WEO A;  1RMD A;  3HCS A;  2MA6 A;  3FL2 A;  5B79 A;  2KRE A;  4I7B A;  3O7A A;  5FB1 A;  2L0B A;  3SOU A;  4S3O C;  3N9N A;  3PHD A;  4MVT A;  4X3G A;  1E4U A;  3N9O A;  3HCT A;  5LKT A;  2LGL A;  2L5U A;  2VJE A;  4BBQ A;  4WZ2 A;  5TDR A;  4R8P K;  3LQI A;  3U5N A;  3MHH A;  3EB6 A;  5FB0 A;  2LDR A;  3PUR A;  3RPG C;  2G45 A;  1N87 A;  2M3H A;  2KYU A;  2EA6 A;  2F6N A;  4B86 C;  4Q6F A;  2KFT A;  4GNG A;  2NAA A;  2VPD A;  3PUQ A;  5LKZ A;  4A4C A;  2M1R A;  4LKA A;  2YUR A;  1WEU A;  4S3O B;  1T1H A;  3O36 A;  3L11 A;  4LK9 A;  2MNZ A;  5B78 A;  1CHC A;  3EB5 A;  2D8S A;  4V3K C;  4PTB A;  2MA5 A;  5C11 A;  3N9Q A;  3RPG B;  4QF3 A;  2G6Q A;  2MUM A;  2QIZ A;  5TAB A;  2YSM A;  1WEP A;  2G43 A;  4B7Y C;  2F42 A;  4AYC A;  2YQL A;  2F6J A;  3L1Z B;  1WEN A;  2M85 A;  4AP4 A;  2LV9 A;  2RI7 A;  4W4U A;  3SOW A;  2UZG A;  2YHO A;  3ZTG A;  3O37 A;  4AVX A;  3T6R A;  4R7E A;  2ECW A;  2Y43 A;  2MIQ A;  2PNX A;  4CCG X;  2CSY A;  5LKU A;  4UP5 A;  4I7C A;  3RTR B;  1DVP A;  2L43 A;  1U6G B;  4FK5 A;  2EOD A;  3HTK C;  3MHS A;  2K16 A;  3I2D A;  4V3L C;  4YAD A;  5G05 B;  3N9P A;  2ZET C;  3ASL A;  3C5K A;  4UI9 B;  1JOC A;  5B77 A;  1LDK C;  3N9L A;  4WA6 A;  2QJ0 A;  2KGI A;  4AUQ B;  5D1M B;  5D1K B;  2OXQ C;  4YAT A;  2FUI A;  1FBV A;  2JMI A;  5G04 B;  5H1U A;  3GL6 A;  2HYE D;  4GNE A;  3KV5 A;  5TRB A;  4YBT A;  2KU3 A;  2LXP C;  1MM2 A;  2YU4 A;  4QF2 A;  5KH7 A;  4A0C D;  4R2Y A;  2LRI C;  2VP7 A;  2CKL A;  2KE1 A;  3IHP A;  1Z60 A;  3LQJ A;  2ECI A;  4N4F A;  4YBS A;  4YC9 A;  2H0D A;  3ZVY A;  2JMD A;  4IC3 A;  5B8D A;  4ZDT A;  3ZPV 1;  4GNF A;  2JRJ A;  3ZNI A;  5J3X A;  3KV6 A;  2JMJ A;  3T7L A;  4LJN A;  2EGP A;  3O34 A;  1WGM A;  3GV4 A;  5DKA A;  2ECJ A;  1MM3 A;  2Y1N A;  5B76 A;  2VJE B;  2FSA A;  2VNF A;  4A49 A;  2LGK A;  2Y1M A;  2VJF A;  3ZVZ B;  2QIC A;  1K2F A;  2L80 A;  3LRQ A;  5EYA F;  1Z2Q A;  1WFK A;  4FIP A;  2MNY A;  4L7X A;  4A4B A;  4CA1 A;  2RSD A;  4UP0 A;  1V87 A;  5KH9 A;  5FER A;  1G25 A;  1IYM A;  2KWK A;  4ZQL A;  2LQ6 A;  2KGG A;  2L75 A;  1WEE A;  2VPE A;  2YUC A;  3DQV R;  2CT2 A;  1WEQ A;  2LGV A;  3O70 A;  4FJC A;  3ZPV E;  2ECG A;  4WZ0 A;  2M6M A;  3NG2 A;  2LGG A;  1LDJ B;  2K17 A;  2ECN A;  5FEY A;  2BAY A;  2XB1 A;  3ZYQ A;  2VPG A;  2I50 A;  4FO9 A;  4AYC B;  1X4I A;  4L58 A;  3O33 A;  1ZBD B;  5AIU A;  4F52 B;  5JG6 A;  1VD4 A;  3N9M A;  2C2V S;  2K4D A;  5B75 A;  1JM7 A;  4ZUX U;  3U5P A;  5C13 A;  3SOX A;  2KWO A;  3C6W A;  5LCW B;  4YBM A;  2MD7 B;  4LLB A;  2YHN A;  2MD8 C;  2ECV A;  2CSZ A;  4YAX A;  3U5O A;  5H9M A;  2YT5 A;  2C2L A;  3V43 A;  2YW8 A;  2E6R A;  2KWJ A;  4MSX A;  2FUU A;  4XI1 A;  1VYX A;  4BHW A;  1HYJ A;  1Z6U A;  4P5O B;  5TBN A;  3VK6 A;  5H1V A;  2YYR A;  5AIT A;  2PUY A;  3M63 A;  5DIN A;  3LQH A;  3U5M A;  1VFY A;  4PPE A;  2KIZ A;  5D1L B;  1JM7 B;  2E6S A;  4GND A;  2DX8 A;  3QZV A;  4LAD B;  3M62 A;  1WIL A;  5TDW A;  2HDP A;  5KH3 A;  2KWN A;  5I3L A;  5G0F A;  2LXH C;  2MT5 A;  4C9Z A;  1WEW A;  5LKX A;  1HYI A;  1X4J A;  2CKL B;  1WES A;  3O35 A;  2ECT A;  2YRE A;  3KNV A;  1XWH A;  4WZ3 B;  4YAB A;  1WE9 A;  5H1T A;  2H0D B;  2YQM A;  2IDA A;  2VPB A;  2LN0 A;  4I7D A;  4N3W A;  4GB0 A;  2XEU A;  3KQI A;  4TKP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...