2YQMA

Solution structure of the fyve domain in zinc finger fyve domain-containing protein 12
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
GSSGSSGIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the FYVE domain in zinc finger FYVE domain-containing protein 12
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords RUN and FYVE domain-containing protein 1
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yqmA01
2CSZA 1FBVA 3C5KA 5B78A 1WEOA 2KWKA 3ZTGA 3NG2A 3ZVZB 4GNEA 2MNYA 2KGIA 5KH9A 3L1ZB 4I7CA 3O37A 4N3WA 4XI1A 3ZVYA 1WFKA 5TDWA 2CSYA 1HYIA 5KH7A 1LDJB 1VD4A 2LXPC 2CKLA 2JMDA 2NAAA 3ZPV1 3FL2A 1WIMA 4N4FA 4V3KC 2L5UA 2HYED 3LQIA 1V87A 2DX8A 3O7AA 2RSDA 4AYCB 4YBTA 2G45A 2YUCA 5DINA 3V43A 2YQMA 4A4CA 2MT5A 4O64A 5EYAF 3MHSA 4L7XA 4NN2A 4YABA 2G6QA 1LDKC 2VJEA 1JM7B 2CKLB 2EGPA 3RTRB 5G0FA 3ASLA 3DPLR 2ECTA 2ECIA 2C2LA 4TKPB 2K1JA 4CCGX 2BAYA 1ZBDB 2XEUA 3SHBA 5LKXA 3N9OA 5C13A 2M6MA 2D8SA 1X4JA 4R7EA 1WILA 2KFTA 3N9LA 4BHWA 1U6GB 2L75A 4V3LC 3KNVA 4Q6FA 2M3HA 3M63A 2ECWA 3HTKC 2MA6A 2JRJA 5I3LA 3O34A 1CHCA 4S3OB 3M99A 2KGGA 3N9PA 2F6JA 3SOXA 1HYJA 2E6RA 3PHDA 4L58A 3ZYQA 3SOWA 4YATA 2L80A 1WESA 3QZVA 4AUQB 1WEPA 3HCUA 4YBMA 2IDAA 2Y1NA 3M62A 2E6SA 1JM7A 4BBQA 1MM3A 2LN0A 2KR4A 4I7DA 1WE9A 4UI9B 4YAXA 4YBSA 3RPGC 5B79A 2YHNA 2YSMA 1MM2A 3PURA 5FB0A 4ZUXU 2EODA 4A0CD 5B76A 4FIPA 2MIQA 3T6RA 5JG6A 1XWHA 5TRBA 3RPGB 1WEWA 2Y43A 1K2FA 3N9MA 1E4UA 2LQ6A 2MA5A 4CA1A 5D1LB 3U5PA 4IC2A 2PNXA 1F62A 2L43A 5DKAA 4PTBA 2Y1MA 4LLBA 2M1RA 4LADB 2EA6A 4FJCA 2ECNA 1Z2QA 1JOCA 2MUMA 3L11A 2LGKA 2KWNA 3U5NA 2YQLA 3LQJA 4R8PK 4R2YA 4UP5A 2MD7B 2YYRA 4C9ZA 4LK9A 2ZETC 2K16A 2F6NA 2ECVA 3T7LA 2YURA 4GNFA 2PUYA 5D1MB 4ZDTA 4W4UA 2VPDA 4A49A 5H1TA 2VPGA 4GB0A 4GNDA 4WZ3B 2FSAA 4MVTA 4I7BA 5G05B 4LKAA 2L0BA 5B77A 3SOUA 4AVXA 3L1XA 3U5OA 3KV5A 3ZNIA 2I50A 1WEMA 3KV6A 1DVPA 2YU4A 3EB5A 3HCTA 3KQIA 1T1HA 2K4DA 2LDRA 4F52B 4A4BA 5G04B 2F42A 4X3GA 5D1KB 3EB6A 5H1UA 5AIUA 1WEVA 2VJEB 4S3OC 2JMIA 2KE1A 4QF3A 2G43A 4YC9A 1WEUA 4P5OB 2UZGA 1IYMA 5LCWB 5B8DA 2C2VS 2YT5A 2QIZA 2FUUA 4AYCA 2YSJA 2ECGA 5J3XA 5LKTA 3GL6A 4PPEA 5B75A 1FP0A 4LJNA 2KWJA 3O36A 2MD8C 4B7YC 1BORA 2YHOA 4FK5A 1RMDA 2KU3A 5LKZA 3O70A 4YADA 4AP4A 4MSXA 2LV9A 2KREA 3VK6A 2YW8A 5FEYA 3IHPA 4FO9A 2VPBA 3U5MA 3O33A 2QICA 2VJFA 1WGMA 3DQVR 5KH3A 5TABA 1WENA 4QF2A 5FB1A 2KYUA 1G25A 1VFYA 3N9NA 4ZQLA 2VJFB 4IC3A 2FUIA 1VYXA 2M85A 4B86C 2YREA 4UP0A 4WA6A 2JMJA 5AITA 2LGGA 2ECJA 2LXHC 1X4IA 2HDPA 3N9QA 2VPEA 2K17A 5H1VA 2RI7A 3O35A 3C6WA 5TDRA 2CT2A 1X4UA 3ZPVE 5FERA 1Z60A 2XB1A 3PUQA 4WZ0A 4GNGA 2LGVA 3I2DA 2QJ0A 2VNFA 2H0DA 5H9MA 1WEQA 1Z6UA 2LGLA 2MNZA 5TBNA 2AN6A 2KWOA 2H0DB 2LRIC 2KIZA 5LKUA 2VP7A 3HCSA 3MHHA 1WEEA 5C11A 3LQHA 1N87A 2OXQC 3GV4A 3LRQA 4WZ2A
chains in the Genus database with same CATH superfamily
2CSZA 1FBVA 3C5KA 5B78A 1WEOA 2KWKA 3ZTGA 5SVIB 4Z0OA 3NG2A 3ZVZB 4GNEA 2MNYA 2KGIA 5KH9A 3L1ZB 4I7CA 3O37A 4OGEA 4N3WA 4XI1A 3ZVYA 1WFKA 5TDWA 2CSYA 1HYIA 5KH7A 2FFWA 1LDJB 1VD4A 2LXPC 2CKLA 2JMDA 2D8UA 2NAAA 3ZPV1 3FL2A 1WIMA 4N4FA 4V3KC 2L5UA 2HYED 3LQIA 1V87A 2DX8A 3O7AA 2RSDA 4AYCB 4YBTA 2G45A 2YUCA 5DINA 3V43A 2YQMA 4A4CA 2MT5A 4H9DA 4O64A 5K3QA 5EYAF 3MHSA 4L7XA 4NN2A 4YABA 3T9KA 1LDKC 2G6QA 2VJEA 1JM7B 2CKLB 2EGPA 3FANA 3RTRB 5G0FA 3ASLA 3DPLR 2ECTA 2ECIA 2C2LA 2CRWA 4TKPB 2K1JA 4OGCA 3LVRE 4CCGX 2BAYA 1ZBDB 2JUNA 2XEUA 3SHBA 5LKXA 3N9OA 5C13A 2M6MA 2D8SA 1X4JA 2XOYA 2E61A 4R7EA 1WILA 2KFTA 2DJAA 3N9LA 4BHWA 1U6GB 2L75A 4V3LC 3KNVA 2JM3A 4Q6FA 2M3HA 3M63A 2ECWA 3HTKC 2MA6A 2JRJA 5I3LA 3O34A 1CHCA 4S3OB 3M99A 3DWDA 2KGGA 3N9PA 2DSMA 2F6JA 3SOXA 1HYJA 3FAOA 2YVRA 2E6RA 3PHDA 4L58A 3ZYQA 3SOWA 4YATA 2L80A 1WESA 3QZVA 4AUQB 1WEPA 3HCUA 4YBMA 2IDAA 2Y1NA 3M62A 2FD4A 2E6SA 1JM7A 4BBQA 1MM3A 2KKXA 2MKEA 2LN0A 2KR4A 3MDBC 4I7DA 1WE9A 4UI9B 4YAXA 2XOZA 4YBSA 2LAUA 4O62A 3RPGC 3O47A 5B79A 2YHNA 2YSMA 1MM2A 3PURA 5FB0A 4ZUXU 2EODA 3DDTA 4A0CD 5B76A 4FIPA 2MIQA 3T6RA 5JG6A 1XWHA 5TRBA 3RPGB 1WEWA 2Y43A 1K2FA 3N9MA 1E4UA 2LQ6A 2MA5A 4CA1A 5D1LB 3U5PA 4IC2A 5SVYA 2PNXA 1F62A 2L43A 5DKAA 5SVIA 4PTBA 2Y1MA 4LLBA 2M1RA 4LADB 2EA6A 4FJCA 2ECNA 3FEHA 1Z2QA 1JOCA 2MUMA 3L11A 2LGKA 2KWNA 3U5NA 2OWAA 2YQLA 3LQJA 4R8PK 2XOCA 4R2YA 4UP5A 2MD7B 2YYRA 2CSVA 4C9ZA 4LK9A 2ZETC 2K16A 2F6NA 2ECVA 3T7LA 2YURA 4GNFA 2PUYA 5D1MB 4ZDTA 4W4UA 2VPDA 4A49A 3JUEA 5H1TA 2VPGA 4GB0A 4GNDA 4WZ3B 2FSAA 4MVTA 4I7BA 5G05B 4LKAA 2L0BA 5B77A 2EXUA 3SOUA 4AVXA 3L1XA 3U5OA 3KV5A 3ZNIA 2I50A 1WEMA 3KV6A 1DVPA 2YU4A 3EB5A 3HCTA 3KQIA 3KDEC 1T1HA 2K4DA 2LDRA 4F52B 4A4BA 5G04B 2F42A 4X3GA 5D1KB 3EB6A 5H1UA 5AIUA 1WEVA 2VJEB 4S3OC 2JMIA 2KE1A 4QF3A 2G43A 4YC9A 1WEUA 2XP0A 4P5OB 3SUBA 2UZGA 1IYMA 5LCWB 5B8DA 2C2VS 2YT5A 4F1PA 2QIZA 2FUUA 4AYCA 3M7KA 2YSJA 2ECGA 5J3XA 5LKTA 3LJUX 2B0OE 3GL6A 4PPEA 5B75A 1FP0A 4LJNA 3FJUB 2KWJA 3O36A 2MD8C 4B7YC 1BORA 3PLWA 2YHOA 4FK5A 2M13A 1RMDA 2EGMA 2P57A 2KU3A 5LKZA 3O70A 4YADA 3E2DA 3Q1DA 4MSXA 2LV9A 4AP4A 2KREA 2IQJA 3VK6A 2YW8A 5FEYA 3IHPA 4FO9A 2VPBA 3U5MA 3O33A 2QICA 3LVQE 2VJFA 1WGMA 3DQVR 1MBMA 5KH3A 5TABA 1WENA 4QF2A 5FB1A 2KYUA 1G25A 4Z0RA 1VFYA 1DCQA 3N9NA 4ZQLA 2VJFB 4IC3A 2FUIA 2RR4A 1VYXA 2M85A 2CONA 4B86C 2YREA 4UP0A 4WA6A 3FM8C 2JMJA 5AITA 2LGGA 2ECJA 2LXHC 1X4IA 2HDPA 3N9QA 2VPEA 2K17A 2L7PA 5H1VA 2RI7A 3O35A 3C6WA 5TDRA 2CT2A 1X4UA 3LDYA 5SVXA 3ZPVE 3H7HA 5FERA 1Z60A 2KKYA 2XB1A 3PUQA 4WZ0A 4GNGA 2LGVA 3I2DA 2QJ0A 2VNFA 2H0DA 2CRRA 5H9MA 1WEQA 4QQ4A 1Z6UA 2LGLA 2MNZA 5TBNA 2AN6A 2KWOA 2H0DB 2LRIC 2KIZA 5LKUA 2VP7A 3HCSA 3MHHA 1WEEA 5C11A 3LQHA 1N87A 2OXQC 3GV4A 3LRQA 4WZ2A
chains in the Genus database with same CATH topology
2CSZA 1FBVA 3C5KA 5B78A 1WEOA 2KWKA 3ZTGA 3NG2A 3ZVZB 4GNEA 2MNYA 2KGIA 5KH9A 3L1ZB 4I7CA 3O37A 4N3WA 4XI1A 3ZVYA 1WFKA 5TDWA 2CSYA 1HYIA 5KH7A 1LDJB 1VD4A 2LXPC 2CKLA 2JMDA 2NAAA 3ZPV1 3FL2A 1WIMA 4N4FA 4V3KC 2L5UA 2HYED 3LQIA 1V87A 2DX8A 3O7AA 2RSDA 4AYCB 4YBTA 2G45A 2YUCA 5DINA 3V43A 2YQMA 4A4CA 2MT5A 4O64A 5EYAF 3MHSA 4L7XA 4NN2A 4YABA 2G6QA 1LDKC 2VJEA 1JM7B 2CKLB 2EGPA 3RTRB 5G0FA 3ASLA 3DPLR 2ECTA 2ECIA 2C2LA 4TKPB 2K1JA 4CCGX 2BAYA 1ZBDB 2XEUA 3SHBA 5LKXA 3N9OA 5C13A 2M6MA 2D8SA 1X4JA 4R7EA 1WILA 2KFTA 3N9LA 4BHWA 1U6GB 2L75A 4V3LC 3KNVA 4Q6FA 2M3HA 3M63A 2ECWA 3HTKC 2MA6A 2JRJA 5I3LA 3O34A 1CHCA 4S3OB 3M99A 2KGGA 3N9PA 2F6JA 3SOXA 1HYJA 2E6RA 3PHDA 4L58A 3ZYQA 3SOWA 4YATA 2L80A 1WESA 3QZVA 4AUQB 1WEPA 3HCUA 4YBMA 2IDAA 2Y1NA 3M62A 2E6SA 1JM7A 4BBQA 1MM3A 2LN0A 2KR4A 4I7DA 1WE9A 4UI9B 4YAXA 4YBSA 3RPGC 5B79A 2YHNA 2YSMA 1MM2A 3PURA 5FB0A 4ZUXU 2EODA 4A0CD 5B76A 4FIPA 2MIQA 3T6RA 5JG6A 1XWHA 5TRBA 3RPGB 1WEWA 2Y43A 1K2FA 3N9MA 1E4UA 2LQ6A 2MA5A 4CA1A 5D1LB 3U5PA 4IC2A 2PNXA 1F62A 2L43A 5DKAA 4PTBA 2Y1MA 4LLBA 2M1RA 4LADB 2EA6A 4FJCA 2ECNA 1Z2QA 1JOCA 2MUMA 3L11A 2LGKA 2KWNA 3U5NA 2YQLA 3LQJA 4R8PK 4R2YA 4UP5A 2MD7B 2YYRA 4C9ZA 4LK9A 2ZETC 2K16A 2F6NA 2ECVA 3T7LA 2YURA 4GNFA 2PUYA 5D1MB 4ZDTA 4W4UA 2VPDA 4A49A 5H1TA 2VPGA 4GB0A 4GNDA 4WZ3B 2FSAA 4MVTA 4I7BA 5G05B 4LKAA 2L0BA 5B77A 3SOUA 4AVXA 3L1XA 3U5OA 3KV5A 3ZNIA 2I50A 1WEMA 3KV6A 1DVPA 2YU4A 3EB5A 3HCTA 3KQIA 1T1HA 2K4DA 2LDRA 4F52B 4A4BA 5G04B 2F42A 4X3GA 5D1KB 3EB6A 5H1UA 5AIUA 1WEVA 2VJEB 4S3OC 2JMIA 2KE1A 4QF3A 2G43A 4YC9A 1WEUA 4P5OB 2UZGA 1IYMA 5LCWB 5B8DA 2C2VS 2YT5A 2QIZA 2FUUA 4AYCA 2YSJA 2ECGA 5J3XA 5LKTA 3GL6A 4PPEA 5B75A 1FP0A 4LJNA 2KWJA 3O36A 2MD8C 4B7YC 1BORA 2YHOA 4FK5A 1RMDA 2KU3A 5LKZA 3O70A 4YADA 4AP4A 4MSXA 2LV9A 2KREA 3VK6A 2YW8A 5FEYA 3IHPA 4FO9A 2VPBA 3U5MA 3O33A 2QICA 2VJFA 1WGMA 3DQVR 5KH3A 5TABA 1WENA 4QF2A 5FB1A 2KYUA 1G25A 1VFYA 3N9NA 4ZQLA 2VJFB 4IC3A 2FUIA 1VYXA 2M85A 4B86C 2YREA 4UP0A 4WA6A 2JMJA 5AITA 2LGGA 2ECJA 2LXHC 1X4IA 2HDPA 3N9QA 2VPEA 2K17A 5H1VA 2RI7A 3O35A 3C6WA 5TDRA 2CT2A 1X4UA 3ZPVE 5FERA 1Z60A 2XB1A 3PUQA 4WZ0A 4GNGA 2LGVA 3I2DA 2QJ0A 2VNFA 2H0DA 5H9MA 1WEQA 1Z6UA 2LGLA 2MNZA 5TBNA 2AN6A 2KWOA 2H0DB 2LRIC 2KIZA 5LKUA 2VP7A 3HCSA 3MHHA 1WEEA 5C11A 3LQHA 1N87A 2OXQC 3GV4A 3LRQA 4WZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSZ A;  1FBV A;  3C5K A;  5B78 A;  1WEO A;  2KWK A;  3ZTG A;  3NG2 A;  3ZVZ B;  4GNE A;  2MNY A;  2KGI A;  5KH9 A;  3L1Z B;  4I7C A;  3O37 A;  4N3W A;  4XI1 A;  3ZVY A;  1WFK A;  5TDW A;  2CSY A;  1HYI A;  5KH7 A;  1LDJ B;  1VD4 A;  2LXP C;  2CKL A;  2JMD A;  2NAA A;  3ZPV 1;  3FL2 A;  1WIM A;  4N4F A;  4V3K C;  2L5U A;  2HYE D;  3LQI A;  1V87 A;  2DX8 A;  3O7A A;  2RSD A;  4AYC B;  4YBT A;  2G45 A;  2YUC A;  5DIN A;  3V43 A;  2YQM A;  4A4C A;  2MT5 A;  4O64 A;  5EYA F;  3MHS A;  4L7X A;  4NN2 A;  4YAB A;  2G6Q A;  1LDK C;  2VJE A;  1JM7 B;  2CKL B;  2EGP A;  3RTR B;  5G0F A;  3ASL A;  3DPL R;  2ECT A;  2ECI A;  2C2L A;  4TKP B;  2K1J A;  4CCG X;  2BAY A;  1ZBD B;  2XEU A;  3SHB A;  5LKX A;  3N9O A;  5C13 A;  2M6M A;  2D8S A;  1X4J A;  4R7E A;  1WIL A;  2KFT A;  3N9L A;  4BHW A;  1U6G B;  2L75 A;  4V3L C;  3KNV A;  4Q6F A;  2M3H A;  3M63 A;  2ECW A;  3HTK C;  2MA6 A;  2JRJ A;  5I3L A;  3O34 A;  1CHC A;  4S3O B;  3M99 A;  2KGG A;  3N9P A;  2F6J A;  3SOX A;  1HYJ A;  2E6R A;  3PHD A;  4L58 A;  3ZYQ A;  3SOW A;  4YAT A;  2L80 A;  1WES A;  3QZV A;  4AUQ B;  1WEP A;  3HCU A;  4YBM A;  2IDA A;  2Y1N A;  3M62 A;  2E6S A;  1JM7 A;  4BBQ A;  1MM3 A;  2LN0 A;  2KR4 A;  4I7D A;  1WE9 A;  4UI9 B;  4YAX A;  4YBS A;  3RPG C;  5B79 A;  2YHN A;  2YSM A;  1MM2 A;  3PUR A;  5FB0 A;  4ZUX U;  2EOD A;  4A0C D;  5B76 A;  4FIP A;  2MIQ A;  3T6R A;  5JG6 A;  1XWH A;  5TRB A;  3RPG B;  1WEW A;  2Y43 A;  1K2F A;  3N9M A;  1E4U A;  2LQ6 A;  2MA5 A;  4CA1 A;  5D1L B;  3U5P A;  4IC2 A;  2PNX A;  1F62 A;  2L43 A;  5DKA A;  4PTB A;  2Y1M A;  4LLB A;  2M1R A;  4LAD B;  2EA6 A;  4FJC A;  2ECN A;  1Z2Q A;  1JOC A;  2MUM A;  3L11 A;  2LGK A;  2KWN A;  3U5N A;  2YQL A;  3LQJ A;  4R8P K;  4R2Y A;  4UP5 A;  2MD7 B;  2YYR A;  4C9Z A;  4LK9 A;  2ZET C;  2K16 A;  2F6N A;  2ECV A;  3T7L A;  2YUR A;  4GNF A;  2PUY A;  5D1M B;  4ZDT A;  4W4U A;  2VPD A;  4A49 A;  5H1T A;  2VPG A;  4GB0 A;  4GND A;  4WZ3 B;  2FSA A;  4MVT A;  4I7B A;  5G05 B;  4LKA A;  2L0B A;  5B77 A;  3SOU A;  4AVX A;  3L1X A;  3U5O A;  3KV5 A;  3ZNI A;  2I50 A;  1WEM A;  3KV6 A;  1DVP A;  2YU4 A;  3EB5 A;  3HCT A;  3KQI A;  1T1H A;  2K4D A;  2LDR A;  4F52 B;  4A4B A;  5G04 B;  2F42 A;  4X3G A;  5D1K B;  3EB6 A;  5H1U A;  5AIU A;  1WEV A;  2VJE B;  4S3O C;  2JMI A;  2KE1 A;  4QF3 A;  2G43 A;  4YC9 A;  1WEU A;  4P5O B;  2UZG A;  1IYM A;  5LCW B;  5B8D A;  2C2V S;  2YT5 A;  2QIZ A;  2FUU A;  4AYC A;  2YSJ A;  2ECG A;  5J3X A;  5LKT A;  3GL6 A;  4PPE A;  5B75 A;  1FP0 A;  4LJN A;  2KWJ A;  3O36 A;  2MD8 C;  4B7Y C;  1BOR A;  2YHO A;  4FK5 A;  1RMD A;  2KU3 A;  5LKZ A;  3O70 A;  4YAD A;  4AP4 A;  4MSX A;  2LV9 A;  2KRE A;  3VK6 A;  2YW8 A;  5FEY A;  3IHP A;  4FO9 A;  2VPB A;  3U5M A;  3O33 A;  2QIC A;  2VJF A;  1WGM A;  3DQV R;  5KH3 A;  5TAB A;  1WEN A;  4QF2 A;  5FB1 A;  2KYU A;  1G25 A;  1VFY A;  3N9N A;  4ZQL A;  2VJF B;  4IC3 A;  2FUI A;  1VYX A;  2M85 A;  4B86 C;  2YRE A;  4UP0 A;  4WA6 A;  2JMJ A;  5AIT A;  2LGG A;  2ECJ A;  2LXH C;  1X4I A;  2HDP A;  3N9Q A;  2VPE A;  2K17 A;  5H1V A;  2RI7 A;  3O35 A;  3C6W A;  5TDR A;  2CT2 A;  1X4U A;  3ZPV E;  5FER A;  1Z60 A;  2XB1 A;  3PUQ A;  4WZ0 A;  4GNG A;  2LGV A;  3I2D A;  2QJ0 A;  2VNF A;  2H0D A;  5H9M A;  1WEQ A;  1Z6U A;  2LGL A;  2MNZ A;  5TBN A;  2AN6 A;  2KWO A;  2H0D B;  2LRI C;  2KIZ A;  5LKU A;  2VP7 A;  3HCS A;  3MHH A;  1WEE A;  5C11 A;  3LQH A;  1N87 A;  2OXQ C;  3GV4 A;  3LRQ A;  4WZ2 A; 
#chains in the Genus database with same CATH topology
 2CSZ A;  1FBV A;  3C5K A;  5B78 A;  1WEO A;  2KWK A;  3ZTG A;  5SVI B;  4Z0O A;  3NG2 A;  3ZVZ B;  4GNE A;  2MNY A;  2KGI A;  5KH9 A;  3L1Z B;  4I7C A;  3O37 A;  4OGE A;  4N3W A;  4XI1 A;  3ZVY A;  1WFK A;  5TDW A;  2CSY A;  1HYI A;  5KH7 A;  2FFW A;  1LDJ B;  1VD4 A;  2LXP C;  2CKL A;  2JMD A;  2D8U A;  2NAA A;  3ZPV 1;  3FL2 A;  1WIM A;  4N4F A;  4V3K C;  2L5U A;  2HYE D;  3LQI A;  1V87 A;  2DX8 A;  3O7A A;  2RSD A;  4AYC B;  4YBT A;  2G45 A;  2YUC A;  5DIN A;  3V43 A;  2YQM A;  4A4C A;  2MT5 A;  4H9D A;  4O64 A;  5K3Q A;  5EYA F;  3MHS A;  4L7X A;  4NN2 A;  4YAB A;  3T9K A;  1LDK C;  2G6Q A;  2VJE A;  1JM7 B;  2CKL B;  2EGP A;  3FAN A;  3RTR B;  5G0F A;  3ASL A;  3DPL R;  2ECT A;  2ECI A;  2C2L A;  2CRW A;  4TKP B;  2K1J A;  4OGC A;  3LVR E;  4CCG X;  2BAY A;  1ZBD B;  2JUN A;  2XEU A;  3SHB A;  5LKX A;  3N9O A;  5C13 A;  2M6M A;  2D8S A;  1X4J A;  2XOY A;  2E61 A;  4R7E A;  1WIL A;  2KFT A;  2DJA A;  3N9L A;  4BHW A;  1U6G B;  2L75 A;  4V3L C;  3KNV A;  2JM3 A;  4Q6F A;  2M3H A;  3M63 A;  2ECW A;  3HTK C;  2MA6 A;  2JRJ A;  5I3L A;  3O34 A;  1CHC A;  4S3O B;  3M99 A;  3DWD A;  2KGG A;  3N9P A;  2DSM A;  2F6J A;  3SOX A;  1HYJ A;  3FAO A;  2YVR A;  2E6R A;  3PHD A;  4L58 A;  3ZYQ A;  3SOW A;  4YAT A;  2L80 A;  1WES A;  3QZV A;  4AUQ B;  1WEP A;  3HCU A;  4YBM A;  2IDA A;  2Y1N A;  3M62 A;  2FD4 A;  2E6S A;  1JM7 A;  4BBQ A;  1MM3 A;  2KKX A;  2MKE A;  2LN0 A;  2KR4 A;  3MDB C;  4I7D A;  1WE9 A;  4UI9 B;  4YAX A;  2XOZ A;  4YBS A;  2LAU A;  4O62 A;  3RPG C;  3O47 A;  5B79 A;  2YHN A;  2YSM A;  1MM2 A;  3PUR A;  5FB0 A;  4ZUX U;  2EOD A;  3DDT A;  4A0C D;  5B76 A;  4FIP A;  2MIQ A;  3T6R A;  5JG6 A;  1XWH A;  5TRB A;  3RPG B;  1WEW A;  2Y43 A;  1K2F A;  3N9M A;  1E4U A;  2LQ6 A;  2MA5 A;  4CA1 A;  5D1L B;  3U5P A;  4IC2 A;  5SVY A;  2PNX A;  1F62 A;  2L43 A;  5DKA A;  5SVI A;  4PTB A;  2Y1M A;  4LLB A;  2M1R A;  4LAD B;  2EA6 A;  4FJC A;  2ECN A;  3FEH A;  1Z2Q A;  1JOC A;  2MUM A;  3L11 A;  2LGK A;  2KWN A;  3U5N A;  2OWA A;  2YQL A;  3LQJ A;  4R8P K;  2XOC A;  4R2Y A;  4UP5 A;  2MD7 B;  2YYR A;  2CSV A;  4C9Z A;  4LK9 A;  2ZET C;  2K16 A;  2F6N A;  2ECV A;  3T7L A;  2YUR A;  4GNF A;  2PUY A;  5D1M B;  4ZDT A;  4W4U A;  2VPD A;  4A49 A;  3JUE A;  5H1T A;  2VPG A;  4GB0 A;  4GND A;  4WZ3 B;  2FSA A;  4MVT A;  4I7B A;  5G05 B;  4LKA A;  2L0B A;  5B77 A;  2EXU A;  3SOU A;  4AVX A;  3L1X A;  3U5O A;  3KV5 A;  3ZNI A;  2I50 A;  1WEM A;  3KV6 A;  1DVP A;  2YU4 A;  3EB5 A;  3HCT A;  3KQI A;  3KDE C;  1T1H A;  2K4D A;  2LDR A;  4F52 B;  4A4B A;  5G04 B;  2F42 A;  4X3G A;  5D1K B;  3EB6 A;  5H1U A;  5AIU A;  1WEV A;  2VJE B;  4S3O C;  2JMI A;  2KE1 A;  4QF3 A;  2G43 A;  4YC9 A;  1WEU A;  2XP0 A;  4P5O B;  3SUB A;  2UZG A;  1IYM A;  5LCW B;  5B8D A;  2C2V S;  2YT5 A;  4F1P A;  2QIZ A;  2FUU A;  4AYC A;  3M7K A;  2YSJ A;  2ECG A;  5J3X A;  5LKT A;  3LJU X;  2B0O E;  3GL6 A;  4PPE A;  5B75 A;  1FP0 A;  4LJN A;  3FJU B;  2KWJ A;  3O36 A;  2MD8 C;  4B7Y C;  1BOR A;  3PLW A;  2YHO A;  4FK5 A;  2M13 A;  1RMD A;  2EGM A;  2P57 A;  2KU3 A;  5LKZ A;  3O70 A;  4YAD A;  3E2D A;  3Q1D A;  4MSX A;  2LV9 A;  4AP4 A;  2KRE A;  2IQJ A;  3VK6 A;  2YW8 A;  5FEY A;  3IHP A;  4FO9 A;  2VPB A;  3U5M A;  3O33 A;  2QIC A;  3LVQ E;  2VJF A;  1WGM A;  3DQV R;  1MBM A;  5KH3 A;  5TAB A;  1WEN A;  4QF2 A;  5FB1 A;  2KYU A;  1G25 A;  4Z0R A;  1VFY A;  1DCQ A;  3N9N A;  4ZQL A;  2VJF B;  4IC3 A;  2FUI A;  2RR4 A;  1VYX A;  2M85 A;  2CON A;  4B86 C;  2YRE A;  4UP0 A;  4WA6 A;  3FM8 C;  2JMJ A;  5AIT A;  2LGG A;  2ECJ A;  2LXH C;  1X4I A;  2HDP A;  3N9Q A;  2VPE A;  2K17 A;  2L7P A;  5H1V A;  2RI7 A;  3O35 A;  3C6W A;  5TDR A;  2CT2 A;  1X4U A;  3LDY A;  5SVX A;  3ZPV E;  3H7H A;  5FER A;  1Z60 A;  2KKY A;  2XB1 A;  3PUQ A;  4WZ0 A;  4GNG A;  2LGV A;  3I2D A;  2QJ0 A;  2VNF A;  2H0D A;  2CRR A;  5H9M A;  1WEQ A;  4QQ4 A;  1Z6U A;  2LGL A;  2MNZ A;  5TBN A;  2AN6 A;  2KWO A;  2H0D B;  2LRI C;  2KIZ A;  5LKU A;  2VP7 A;  3HCS A;  3MHH A;  1WEE A;  5C11 A;  3LQH A;  1N87 A;  2OXQ C;  3GV4 A;  3LRQ A;  4WZ2 A; 
#chains in the Genus database with same CATH homology
 2CSZ A;  1FBV A;  3C5K A;  5B78 A;  1WEO A;  2KWK A;  3ZTG A;  3NG2 A;  3ZVZ B;  4GNE A;  2MNY A;  2KGI A;  5KH9 A;  3L1Z B;  4I7C A;  3O37 A;  4N3W A;  4XI1 A;  3ZVY A;  1WFK A;  5TDW A;  2CSY A;  1HYI A;  5KH7 A;  1LDJ B;  1VD4 A;  2LXP C;  2CKL A;  2JMD A;  2NAA A;  3ZPV 1;  3FL2 A;  1WIM A;  4N4F A;  4V3K C;  2L5U A;  2HYE D;  3LQI A;  1V87 A;  2DX8 A;  3O7A A;  2RSD A;  4AYC B;  4YBT A;  2G45 A;  2YUC A;  5DIN A;  3V43 A;  2YQM A;  4A4C A;  2MT5 A;  4O64 A;  5EYA F;  3MHS A;  4L7X A;  4NN2 A;  4YAB A;  2G6Q A;  1LDK C;  2VJE A;  1JM7 B;  2CKL B;  2EGP A;  3RTR B;  5G0F A;  3ASL A;  3DPL R;  2ECT A;  2ECI A;  2C2L A;  4TKP B;  2K1J A;  4CCG X;  2BAY A;  1ZBD B;  2XEU A;  3SHB A;  5LKX A;  3N9O A;  5C13 A;  2M6M A;  2D8S A;  1X4J A;  4R7E A;  1WIL A;  2KFT A;  3N9L A;  4BHW A;  1U6G B;  2L75 A;  4V3L C;  3KNV A;  4Q6F A;  2M3H A;  3M63 A;  2ECW A;  3HTK C;  2MA6 A;  2JRJ A;  5I3L A;  3O34 A;  1CHC A;  4S3O B;  3M99 A;  2KGG A;  3N9P A;  2F6J A;  3SOX A;  1HYJ A;  2E6R A;  3PHD A;  4L58 A;  3ZYQ A;  3SOW A;  4YAT A;  2L80 A;  1WES A;  3QZV A;  4AUQ B;  1WEP A;  3HCU A;  4YBM A;  2IDA A;  2Y1N A;  3M62 A;  2E6S A;  1JM7 A;  4BBQ A;  1MM3 A;  2LN0 A;  2KR4 A;  4I7D A;  1WE9 A;  4UI9 B;  4YAX A;  4YBS A;  3RPG C;  5B79 A;  2YHN A;  2YSM A;  1MM2 A;  3PUR A;  5FB0 A;  4ZUX U;  2EOD A;  4A0C D;  5B76 A;  4FIP A;  2MIQ A;  3T6R A;  5JG6 A;  1XWH A;  5TRB A;  3RPG B;  1WEW A;  2Y43 A;  1K2F A;  3N9M A;  1E4U A;  2LQ6 A;  2MA5 A;  4CA1 A;  5D1L B;  3U5P A;  4IC2 A;  2PNX A;  1F62 A;  2L43 A;  5DKA A;  4PTB A;  2Y1M A;  4LLB A;  2M1R A;  4LAD B;  2EA6 A;  4FJC A;  2ECN A;  1Z2Q A;  1JOC A;  2MUM A;  3L11 A;  2LGK A;  2KWN A;  3U5N A;  2YQL A;  3LQJ A;  4R8P K;  4R2Y A;  4UP5 A;  2MD7 B;  2YYR A;  4C9Z A;  4LK9 A;  2ZET C;  2K16 A;  2F6N A;  2ECV A;  3T7L A;  2YUR A;  4GNF A;  2PUY A;  5D1M B;  4ZDT A;  4W4U A;  2VPD A;  4A49 A;  5H1T A;  2VPG A;  4GB0 A;  4GND A;  4WZ3 B;  2FSA A;  4MVT A;  4I7B A;  5G05 B;  4LKA A;  2L0B A;  5B77 A;  3SOU A;  4AVX A;  3L1X A;  3U5O A;  3KV5 A;  3ZNI A;  2I50 A;  1WEM A;  3KV6 A;  1DVP A;  2YU4 A;  3EB5 A;  3HCT A;  3KQI A;  1T1H A;  2K4D A;  2LDR A;  4F52 B;  4A4B A;  5G04 B;  2F42 A;  4X3G A;  5D1K B;  3EB6 A;  5H1U A;  5AIU A;  1WEV A;  2VJE B;  4S3O C;  2JMI A;  2KE1 A;  4QF3 A;  2G43 A;  4YC9 A;  1WEU A;  4P5O B;  2UZG A;  1IYM A;  5LCW B;  5B8D A;  2C2V S;  2YT5 A;  2QIZ A;  2FUU A;  4AYC A;  2YSJ A;  2ECG A;  5J3X A;  5LKT A;  3GL6 A;  4PPE A;  5B75 A;  1FP0 A;  4LJN A;  2KWJ A;  3O36 A;  2MD8 C;  4B7Y C;  1BOR A;  2YHO A;  4FK5 A;  1RMD A;  2KU3 A;  5LKZ A;  3O70 A;  4YAD A;  4AP4 A;  4MSX A;  2LV9 A;  2KRE A;  3VK6 A;  2YW8 A;  5FEY A;  3IHP A;  4FO9 A;  2VPB A;  3U5M A;  3O33 A;  2QIC A;  2VJF A;  1WGM A;  3DQV R;  5KH3 A;  5TAB A;  1WEN A;  4QF2 A;  5FB1 A;  2KYU A;  1G25 A;  1VFY A;  3N9N A;  4ZQL A;  2VJF B;  4IC3 A;  2FUI A;  1VYX A;  2M85 A;  4B86 C;  2YRE A;  4UP0 A;  4WA6 A;  2JMJ A;  5AIT A;  2LGG A;  2ECJ A;  2LXH C;  1X4I A;  2HDP A;  3N9Q A;  2VPE A;  2K17 A;  5H1V A;  2RI7 A;  3O35 A;  3C6W A;  5TDR A;  2CT2 A;  1X4U A;  3ZPV E;  5FER A;  1Z60 A;  2XB1 A;  3PUQ A;  4WZ0 A;  4GNG A;  2LGV A;  3I2D A;  2QJ0 A;  2VNF A;  2H0D A;  5H9M A;  1WEQ A;  1Z6U A;  2LGL A;  2MNZ A;  5TBN A;  2AN6 A;  2KWO A;  2H0D B;  2LRI C;  2KIZ A;  5LKU A;  2VP7 A;  3HCS A;  3MHH A;  1WEE A;  5C11 A;  3LQH A;  1N87 A;  2OXQ C;  3GV4 A;  3LRQ A;  4WZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...