2YQMA

Solution structure of the fyve domain in zinc finger fyve domain-containing protein 12
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
GSSGSSGIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUN and FYVE domain-containing protein 1
publication title Solution structure of the FYVE domain in zinc finger FYVE domain-containing protein 12
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yqmA01
2MA5A 1DVPA 4B86C 3ASLA 5FB1A 2C2LA 3KQIA 2MA6A 4TKPB 2Y43A 2MNYA 2VJFB 1ZBDB 3PHDA 5LKXA 2L0BA 5LKZA 4CA1A 1WEQA 3RPGC 1Z60A 3GL6A 2BAYA 2YHOA 5I3LA 2CKLA 2HDPA 3LQIA 1WENA 1WEVA 2ECIA 5DINA 2JMJA 2LGLA 4QF3A 2VPDA 2AN6A 2QIZA 4R2YA 2D8SA 2Y1NA 3KV5A 3M62A 3T7LA 4FK5A 2Y1MA 2KFTA 2VJFA 3O34A 2CSYA 2VNFA 4WZ2A 2KWNA 3HCSA 2YSJA 3N9PA 5FERA 4YABA 2EODA 5J3XA 5H9MA 5TRBA 2MD7B 3M63A 2JMDA 2YW8A 1FBVA 2JMIA 4YBTA 3N9MA 3GV4A 3MHHA 4UP5A 1MM2A 3M99A 3L1XA 2YT5A 4I7CA 3NG2A 4BHWA 2ECTA 5H1TA 5G04B 2KU3A 2M85A 2PUYA 3SOXA 5KH3A 5AIUA 5DKAA 1VYXA 2KWJA 3EB5A 2C2VS 3ZTGA 2MUMA 2MD8C 1LDJB 4LKAA 2RI7A 1T1HA 2H0DB 2G45A 1VD4A 3U5MA 4WZ3B 4AP4A 2M6MA 4AYCA 3C6WA 2DX8A 2KREA 5TDRA 3HTKC 4A0CD 5LKTA 4V3LC 4QF2A 5H1VA 4S3OB 3L1ZB 2FUUA 2NAAA 2YYRA 3O33A 4PTBA 2L5UA 4ZUXU 4LLBA 3N9NA 1JM7B 1WEEA 4N4FA 1CHCA 1WESA 3V43A 1N87A 2LQ6A 4F52B 2H0DA 3U5PA 1JOCA 1X4JA 4C9ZA 1LDKC 2KWOA 2VPBA 2KGIA 2VP7A 4YADA 2YQLA 3SOUA 1VFYA 5D1LB 4B7YC 2K4DA 5B76A 2EA6A 2YQMA 2YUCA 5EYAF 3ZNIA 1JM7A 2K1JA 3VK6A 4R8PK 5D1MB 4V3KC 4YC9A 3QZVA 2I50A 2ZETC 1WE9A 2G6QA 3T6RA 3ZPVE 2KGGA 1Z6UA 4LADB 5D1KB 2CSZA 5B8DA 5B79A 3O35A 4ZQLA 4LK9A 4P5OB 2KIZA 1WEUA 1WIMA 1WGMA 4AYCB 2ECNA 3N9LA 4UI9B 5LKUA 5G0FA 5JG6A 5B78A 2LDRA 2L75A 2LGVA 3L11A 2RSDA 4GB0A 4L7XA 2F42A 2LXPC 4GNFA 4X3GA 2YURA 4AVXA 5H1UA 2K16A 4IC3A 4O64A 2MT5A 4LJNA 1HYIA 4BBQA 2KWKA 2XEUA 5C13A 3C5KA 2FUIA 3RPGB 3U5NA 2KYUA 3O37A 2LV9A 3IHPA 4ZDTA 2PNXA 3ZPV1 4FIPA 2FSAA 5G05B 1XWHA 4WA6A 1WEOA 3N9QA 1MM3A 2M3HA 3DQVR 3HCUA 2IDAA 2YSMA 4MSXA 3LQJA 4UP0A 4FJCA 3O36A 2E6RA 2E6SA 1E4UA 4MVTA 1WEPA 5FEYA 5B77A 1FP0A 3MHSA 4W4UA 4WZ0A 2VPEA 5KH7A 2KE1A 1BORA 3KV6A 5C11A 1G25A 3EB6A 3PUQA 4S3OC 3ZYQA 2F6JA 2LGGA 3KNVA 3DPLR 4XI1A 2VJEA 5TBNA 4GNGA 5LCWB 2CT2A 4NN2A 1K2FA 4AUQB 2QJ0A 4CCGX 3FL2A 2L43A 2YU4A 1WFKA 2LRIC 4A49A 1WEMA 5FB0A 3O7AA 2G43A 3ZVYA 3ZVZB 1U6GB 3LQHA 2MNZA 2QICA 2XB1A 2M1RA 2K17A 4YBMA 1WILA 1RMDA 3N9OA 3RTRB 2UZGA 4R7EA 5AITA 3SOWA 1IYMA 4FO9A 3HCTA 2LN0A 3O70A 4YBSA 1Z2QA 5TDWA 4Q6FA 2JRJA 2LXHC 1X4IA 3I2DA 3SHBA 2F6NA 2YREA 4YATA 4IC2A 2ECGA 1HYJA 4PPEA 2LGKA 3PURA 2ECJA 4N3WA 2ECVA 4L58A 1X4UA 3LRQA 5TABA 2OXQC 4A4BA 1F62A 2YHNA 2HYED 2EGPA 4A4CA 1V87A 2ECWA 5KH9A 4GNDA 2VJEB 2VPGA 2CKLB 4I7BA 1WEWA 3U5OA 4YAXA 5B75A 4I7DA 2L80A 2KR4A 2MIQA 4GNEA
chains in the Genus database with same CATH superfamily
2MA5A 1DVPA 3O47A 3ASLA 4B86C 5FB1A 2C2LA 3DWDA 3KQIA 2MA6A 4TKPB 2Y43A 2MNYA 2VJFB 1ZBDB 3PHDA 3FANA 5K3QA 5SVIB 5LKXA 2L0BA 5LKZA 4CA1A 1WEQA 3RPGC 1Z60A 3GL6A 2BAYA 2YHOA 5I3LA 4Z0OA 5SVYA 2CKLA 2HDPA 3LQIA 1WENA 1WEVA 3LDYA 2ECIA 5DINA 2JMJA 2LGLA 4QF3A 2VPDA 2AN6A 2QIZA 4R2YA 2D8SA 2Y1NA 3KV5A 3M62A 3T9KA 3T7LA 4FK5A 2Y1MA 2RR4A 2KFTA 2VJFA 3O34A 2CSYA 2VNFA 4WZ2A 2KWNA 3HCSA 2YSJA 3FJUB 3N9PA 5FERA 4YABA 2EODA 5J3XA 5H9MA 5TRBA 2MD7B 3M63A 2JMDA 2YW8A 1FBVA 2JMIA 3LJUX 4YBTA 3N9MA 3GV4A 3MHHA 4UP5A 1MM2A 3M99A 3L1XA 2YT5A 4I7CA 3NG2A 4BHWA 3FEHA 2ECTA 5H1TA 5G04B 2KU3A 2M85A 2PUYA 3SOXA 5KH3A 2CRWA 5AIUA 5DKAA 1VYXA 2KWJA 3EB5A 2IQJA 2C2VS 3ZTGA 2MUMA 2MD8C 1LDJB 4LKAA 2RI7A 2L7PA 1T1HA 2H0DB 3JUEA 2G45A 1VD4A 3U5MA 4WZ3B 4AP4A 2M6MA 3LVQE 4AYCA 3C6WA 2EXUA 2DX8A 2KREA 5TDRA 4OGEA 3HTKC 4A0CD 5LKTA 4V3LC 4QF2A 2JM3A 2FFWA 5H1VA 4S3OB 3L1ZB 2FUUA 2NAAA 2P57A 2YYRA 3O33A 3Q1DA 4PTBA 2L5UA 4ZUXU 2YVRA 4LLBA 2D8UA 3N9NA 1JM7B 1WEEA 4N4FA 1CHCA 1WESA 3V43A 2DJAA 1N87A 2LQ6A 3DDTA 4F52B 2H0DA 3U5PA 1JOCA 1X4JA 4C9ZA 2B0OE 1LDKC 2KWOA 2VPBA 3KDEC 2KGIA 2VP7A 4YADA 2YQLA 4O62A 3SOUA 1VFYA 5D1LB 4B7YC 2K4DA 5B76A 2EA6A 2YQMA 2YUCA 5EYAF 3ZNIA 1JM7A 2K1JA 3VK6A 4R8PK 5D1MB 4V3KC 4YC9A 3QZVA 2I50A 2ZETC 2KKXA 1WE9A 2G6QA 3T6RA 3ZPVE 2KGGA 1Z6UA 4LADB 5D1KB 2CSZA 5B8DA 5B79A 3O35A 4ZQLA 4LK9A 4P5OB 2KIZA 1WEUA 1WIMA 1WGMA 4AYCB 2ECNA 4H9DA 3N9LA 4UI9B 5LKUA 5G0FA 5JG6A 5B78A 2LDRA 2L75A 2LGVA 3L11A 2DSMA 2RSDA 4GB0A 4L7XA 2F42A 2LXPC 4GNFA 4X3GA 2YURA 4AVXA 4OGCA 5H1UA 2K16A 4IC3A 4O64A 2OWAA 2CSVA 2MT5A 4LJNA 1HYIA 4BBQA 3H7HA 2KWKA 2XEUA 5C13A 3C5KA 2FUIA 3RPGB 3U5NA 2KYUA 3O37A 2LV9A 3IHPA 4ZDTA 2PNXA 3ZPV1 2JUNA 4FIPA 2FSAA 5G05B 1XWHA 4WA6A 1WEOA 3N9QA 3PLWA 1MM3A 2M3HA 3DQVR 3HCUA 2IDAA 2YSMA 4MSXA 2XOCA 3LQJA 4UP0A 4FJCA 3O36A 1MBMA 2E6RA 2E6SA 1E4UA 4MVTA 1WEPA 5FEYA 4QQ4A 5B77A 1FP0A 3MHSA 4W4UA 4WZ0A 2VPEA 5KH7A 2KE1A 1BORA 3KV6A 5C11A 1G25A 3EB6A 4Z0RA 3PUQA 4S3OC 3ZYQA 2F6JA 2LGGA 5SVXA 3FM8C 3KNVA 3DPLR 4XI1A 2KKYA 2VJEA 5TBNA 4GNGA 5LCWB 2CT2A 4NN2A 1K2FA 4AUQB 2QJ0A 2CRRA 4CCGX 3FL2A 2L43A 2YU4A 1WFKA 4F1PA 3M7KA 2LRIC 4A49A 2XP0A 1WEMA 5FB0A 3O7AA 5SVIA 2G43A 3ZVYA 3ZVZB 1U6GB 3LQHA 2FD4A 2MNZA 2QICA 2XB1A 2M1RA 2K17A 4YBMA 1WILA 1RMDA 3N9OA 3MDBC 3RTRB 2UZGA 4R7EA 5AITA 2MKEA 3SOWA 1IYMA 4FO9A 3SUBA 2M13A 3HCTA 2LN0A 3LVRE 3O70A 4YBSA 1Z2QA 5TDWA 4Q6FA 2JRJA 2LXHC 1X4IA 3I2DA 2EGMA 3SHBA 2F6NA 2YREA 4YATA 4IC2A 2ECGA 1HYJA 4PPEA 2XOYA 2LGKA 3PURA 2ECJA 4N3WA 2ECVA 4L58A 3FAOA 1X4UA 3LRQA 5TABA 2OXQC 4A4BA 1F62A 2YHNA 2HYED 2EGPA 2XOZA 4A4CA 2LAUA 1V87A 2ECWA 5KH9A 1DCQA 4GNDA 2VJEB 2VPGA 3E2DA 2CKLB 4I7BA 1WEWA 2E61A 3U5OA 4YAXA 5B75A 2CONA 4I7DA 2L80A 2KR4A 2MIQA 4GNEA
chains in the Genus database with same CATH topology
2MA5A 1DVPA 4B86C 3ASLA 5FB1A 2C2LA 3KQIA 2MA6A 4TKPB 2Y43A 2MNYA 2VJFB 1ZBDB 3PHDA 5LKXA 2L0BA 5LKZA 4CA1A 1WEQA 3RPGC 1Z60A 3GL6A 2BAYA 2YHOA 5I3LA 2CKLA 2HDPA 3LQIA 1WENA 1WEVA 2ECIA 5DINA 2JMJA 2LGLA 4QF3A 2VPDA 2AN6A 2QIZA 4R2YA 2D8SA 2Y1NA 3KV5A 3M62A 3T7LA 4FK5A 2Y1MA 2KFTA 2VJFA 3O34A 2CSYA 2VNFA 4WZ2A 2KWNA 3HCSA 2YSJA 3N9PA 5FERA 4YABA 2EODA 5J3XA 5H9MA 5TRBA 2MD7B 3M63A 2JMDA 2YW8A 1FBVA 2JMIA 4YBTA 3N9MA 3GV4A 3MHHA 4UP5A 1MM2A 3M99A 3L1XA 2YT5A 4I7CA 3NG2A 4BHWA 2ECTA 5H1TA 5G04B 2KU3A 2M85A 2PUYA 3SOXA 5KH3A 5AIUA 5DKAA 1VYXA 2KWJA 3EB5A 2C2VS 3ZTGA 2MUMA 2MD8C 1LDJB 4LKAA 2RI7A 1T1HA 2H0DB 2G45A 1VD4A 3U5MA 4WZ3B 4AP4A 2M6MA 4AYCA 3C6WA 2DX8A 2KREA 5TDRA 3HTKC 4A0CD 5LKTA 4V3LC 4QF2A 5H1VA 4S3OB 3L1ZB 2FUUA 2NAAA 2YYRA 3O33A 4PTBA 2L5UA 4ZUXU 4LLBA 3N9NA 1JM7B 1WEEA 4N4FA 1CHCA 1WESA 3V43A 1N87A 2LQ6A 4F52B 2H0DA 3U5PA 1JOCA 1X4JA 4C9ZA 1LDKC 2KWOA 2VPBA 2KGIA 2VP7A 4YADA 2YQLA 3SOUA 1VFYA 5D1LB 4B7YC 2K4DA 5B76A 2EA6A 2YQMA 2YUCA 5EYAF 3ZNIA 1JM7A 2K1JA 3VK6A 4R8PK 5D1MB 4V3KC 4YC9A 3QZVA 2I50A 2ZETC 1WE9A 2G6QA 3T6RA 3ZPVE 2KGGA 1Z6UA 4LADB 5D1KB 2CSZA 5B8DA 5B79A 3O35A 4ZQLA 4LK9A 4P5OB 2KIZA 1WEUA 1WIMA 1WGMA 4AYCB 2ECNA 3N9LA 4UI9B 5LKUA 5G0FA 5JG6A 5B78A 2LDRA 2L75A 2LGVA 3L11A 2RSDA 4GB0A 4L7XA 2F42A 2LXPC 4GNFA 4X3GA 2YURA 4AVXA 5H1UA 2K16A 4IC3A 4O64A 2MT5A 4LJNA 1HYIA 4BBQA 2KWKA 2XEUA 5C13A 3C5KA 2FUIA 3RPGB 3U5NA 2KYUA 3O37A 2LV9A 3IHPA 4ZDTA 2PNXA 3ZPV1 4FIPA 2FSAA 5G05B 1XWHA 4WA6A 1WEOA 3N9QA 1MM3A 2M3HA 3DQVR 3HCUA 2IDAA 2YSMA 4MSXA 3LQJA 4UP0A 4FJCA 3O36A 2E6RA 2E6SA 1E4UA 4MVTA 1WEPA 5FEYA 5B77A 1FP0A 3MHSA 4W4UA 4WZ0A 2VPEA 5KH7A 2KE1A 1BORA 3KV6A 5C11A 1G25A 3EB6A 3PUQA 4S3OC 3ZYQA 2F6JA 2LGGA 3KNVA 3DPLR 4XI1A 2VJEA 5TBNA 4GNGA 5LCWB 2CT2A 4NN2A 1K2FA 4AUQB 2QJ0A 4CCGX 3FL2A 2L43A 2YU4A 1WFKA 2LRIC 4A49A 1WEMA 5FB0A 3O7AA 2G43A 3ZVYA 3ZVZB 1U6GB 3LQHA 2MNZA 2QICA 2XB1A 2M1RA 2K17A 4YBMA 1WILA 1RMDA 3N9OA 3RTRB 2UZGA 4R7EA 5AITA 3SOWA 1IYMA 4FO9A 3HCTA 2LN0A 3O70A 4YBSA 1Z2QA 5TDWA 4Q6FA 2JRJA 2LXHC 1X4IA 3I2DA 3SHBA 2F6NA 2YREA 4YATA 4IC2A 2ECGA 1HYJA 4PPEA 2LGKA 3PURA 2ECJA 4N3WA 2ECVA 4L58A 1X4UA 3LRQA 5TABA 2OXQC 4A4BA 1F62A 2YHNA 2HYED 2EGPA 4A4CA 1V87A 2ECWA 5KH9A 4GNDA 2VJEB 2VPGA 2CKLB 4I7BA 1WEWA 3U5OA 4YAXA 5B75A 4I7DA 2L80A 2KR4A 2MIQA 4GNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA5 A;  1DVP A;  4B86 C;  3ASL A;  5FB1 A;  2C2L A;  3KQI A;  2MA6 A;  4TKP B;  2Y43 A;  2MNY A;  2VJF B;  1ZBD B;  3PHD A;  5LKX A;  2L0B A;  5LKZ A;  4CA1 A;  1WEQ A;  3RPG C;  1Z60 A;  3GL6 A;  2BAY A;  2YHO A;  5I3L A;  2CKL A;  2HDP A;  3LQI A;  1WEN A;  1WEV A;  2ECI A;  5DIN A;  2JMJ A;  2LGL A;  4QF3 A;  2VPD A;  2AN6 A;  2QIZ A;  4R2Y A;  2D8S A;  2Y1N A;  3KV5 A;  3M62 A;  3T7L A;  4FK5 A;  2Y1M A;  2KFT A;  2VJF A;  3O34 A;  2CSY A;  2VNF A;  4WZ2 A;  2KWN A;  3HCS A;  2YSJ A;  3N9P A;  5FER A;  4YAB A;  2EOD A;  5J3X A;  5H9M A;  5TRB A;  2MD7 B;  3M63 A;  2JMD A;  2YW8 A;  1FBV A;  2JMI A;  4YBT A;  3N9M A;  3GV4 A;  3MHH A;  4UP5 A;  1MM2 A;  3M99 A;  3L1X A;  2YT5 A;  4I7C A;  3NG2 A;  4BHW A;  2ECT A;  5H1T A;  5G04 B;  2KU3 A;  2M85 A;  2PUY A;  3SOX A;  5KH3 A;  5AIU A;  5DKA A;  1VYX A;  2KWJ A;  3EB5 A;  2C2V S;  3ZTG A;  2MUM A;  2MD8 C;  1LDJ B;  4LKA A;  2RI7 A;  1T1H A;  2H0D B;  2G45 A;  1VD4 A;  3U5M A;  4WZ3 B;  4AP4 A;  2M6M A;  4AYC A;  3C6W A;  2DX8 A;  2KRE A;  5TDR A;  3HTK C;  4A0C D;  5LKT A;  4V3L C;  4QF2 A;  5H1V A;  4S3O B;  3L1Z B;  2FUU A;  2NAA A;  2YYR A;  3O33 A;  4PTB A;  2L5U A;  4ZUX U;  4LLB A;  3N9N A;  1JM7 B;  1WEE A;  4N4F A;  1CHC A;  1WES A;  3V43 A;  1N87 A;  2LQ6 A;  4F52 B;  2H0D A;  3U5P A;  1JOC A;  1X4J A;  4C9Z A;  1LDK C;  2KWO A;  2VPB A;  2KGI A;  2VP7 A;  4YAD A;  2YQL A;  3SOU A;  1VFY A;  5D1L B;  4B7Y C;  2K4D A;  5B76 A;  2EA6 A;  2YQM A;  2YUC A;  5EYA F;  3ZNI A;  1JM7 A;  2K1J A;  3VK6 A;  4R8P K;  5D1M B;  4V3K C;  4YC9 A;  3QZV A;  2I50 A;  2ZET C;  1WE9 A;  2G6Q A;  3T6R A;  3ZPV E;  2KGG A;  1Z6U A;  4LAD B;  5D1K B;  2CSZ A;  5B8D A;  5B79 A;  3O35 A;  4ZQL A;  4LK9 A;  4P5O B;  2KIZ A;  1WEU A;  1WIM A;  1WGM A;  4AYC B;  2ECN A;  3N9L A;  4UI9 B;  5LKU A;  5G0F A;  5JG6 A;  5B78 A;  2LDR A;  2L75 A;  2LGV A;  3L11 A;  2RSD A;  4GB0 A;  4L7X A;  2F42 A;  2LXP C;  4GNF A;  4X3G A;  2YUR A;  4AVX A;  5H1U A;  2K16 A;  4IC3 A;  4O64 A;  2MT5 A;  4LJN A;  1HYI A;  4BBQ A;  2KWK A;  2XEU A;  5C13 A;  3C5K A;  2FUI A;  3RPG B;  3U5N A;  2KYU A;  3O37 A;  2LV9 A;  3IHP A;  4ZDT A;  2PNX A;  3ZPV 1;  4FIP A;  2FSA A;  5G05 B;  1XWH A;  4WA6 A;  1WEO A;  3N9Q A;  1MM3 A;  2M3H A;  3DQV R;  3HCU A;  2IDA A;  2YSM A;  4MSX A;  3LQJ A;  4UP0 A;  4FJC A;  3O36 A;  2E6R A;  2E6S A;  1E4U A;  4MVT A;  1WEP A;  5FEY A;  5B77 A;  1FP0 A;  3MHS A;  4W4U A;  4WZ0 A;  2VPE A;  5KH7 A;  2KE1 A;  1BOR A;  3KV6 A;  5C11 A;  1G25 A;  3EB6 A;  3PUQ A;  4S3O C;  3ZYQ A;  2F6J A;  2LGG A;  3KNV A;  3DPL R;  4XI1 A;  2VJE A;  5TBN A;  4GNG A;  5LCW B;  2CT2 A;  4NN2 A;  1K2F A;  4AUQ B;  2QJ0 A;  4CCG X;  3FL2 A;  2L43 A;  2YU4 A;  1WFK A;  2LRI C;  4A49 A;  1WEM A;  5FB0 A;  3O7A A;  2G43 A;  3ZVY A;  3ZVZ B;  1U6G B;  3LQH A;  2MNZ A;  2QIC A;  2XB1 A;  2M1R A;  2K17 A;  4YBM A;  1WIL A;  1RMD A;  3N9O A;  3RTR B;  2UZG A;  4R7E A;  5AIT A;  3SOW A;  1IYM A;  4FO9 A;  3HCT A;  2LN0 A;  3O70 A;  4YBS A;  1Z2Q A;  5TDW A;  4Q6F A;  2JRJ A;  2LXH C;  1X4I A;  3I2D A;  3SHB A;  2F6N A;  2YRE A;  4YAT A;  4IC2 A;  2ECG A;  1HYJ A;  4PPE A;  2LGK A;  3PUR A;  2ECJ A;  4N3W A;  2ECV A;  4L58 A;  1X4U A;  3LRQ A;  5TAB A;  2OXQ C;  4A4B A;  1F62 A;  2YHN A;  2HYE D;  2EGP A;  4A4C A;  1V87 A;  2ECW A;  5KH9 A;  4GND A;  2VJE B;  2VPG A;  2CKL B;  4I7B A;  1WEW A;  3U5O A;  4YAX A;  5B75 A;  4I7D A;  2L80 A;  2KR4 A;  2MIQ A;  4GNE A; 
#chains in the Genus database with same CATH topology
 2MA5 A;  1DVP A;  3O47 A;  3ASL A;  4B86 C;  5FB1 A;  2C2L A;  3DWD A;  3KQI A;  2MA6 A;  4TKP B;  2Y43 A;  2MNY A;  2VJF B;  1ZBD B;  3PHD A;  3FAN A;  5K3Q A;  5SVI B;  5LKX A;  2L0B A;  5LKZ A;  4CA1 A;  1WEQ A;  3RPG C;  1Z60 A;  3GL6 A;  2BAY A;  2YHO A;  5I3L A;  4Z0O A;  5SVY A;  2CKL A;  2HDP A;  3LQI A;  1WEN A;  1WEV A;  3LDY A;  2ECI A;  5DIN A;  2JMJ A;  2LGL A;  4QF3 A;  2VPD A;  2AN6 A;  2QIZ A;  4R2Y A;  2D8S A;  2Y1N A;  3KV5 A;  3M62 A;  3T9K A;  3T7L A;  4FK5 A;  2Y1M A;  2RR4 A;  2KFT A;  2VJF A;  3O34 A;  2CSY A;  2VNF A;  4WZ2 A;  2KWN A;  3HCS A;  2YSJ A;  3FJU B;  3N9P A;  5FER A;  4YAB A;  2EOD A;  5J3X A;  5H9M A;  5TRB A;  2MD7 B;  3M63 A;  2JMD A;  2YW8 A;  1FBV A;  2JMI A;  3LJU X;  4YBT A;  3N9M A;  3GV4 A;  3MHH A;  4UP5 A;  1MM2 A;  3M99 A;  3L1X A;  2YT5 A;  4I7C A;  3NG2 A;  4BHW A;  3FEH A;  2ECT A;  5H1T A;  5G04 B;  2KU3 A;  2M85 A;  2PUY A;  3SOX A;  5KH3 A;  2CRW A;  5AIU A;  5DKA A;  1VYX A;  2KWJ A;  3EB5 A;  2IQJ A;  2C2V S;  3ZTG A;  2MUM A;  2MD8 C;  1LDJ B;  4LKA A;  2RI7 A;  2L7P A;  1T1H A;  2H0D B;  3JUE A;  2G45 A;  1VD4 A;  3U5M A;  4WZ3 B;  4AP4 A;  2M6M A;  3LVQ E;  4AYC A;  3C6W A;  2EXU A;  2DX8 A;  2KRE A;  5TDR A;  4OGE A;  3HTK C;  4A0C D;  5LKT A;  4V3L C;  4QF2 A;  2JM3 A;  2FFW A;  5H1V A;  4S3O B;  3L1Z B;  2FUU A;  2NAA A;  2P57 A;  2YYR A;  3O33 A;  3Q1D A;  4PTB A;  2L5U A;  4ZUX U;  2YVR A;  4LLB A;  2D8U A;  3N9N A;  1JM7 B;  1WEE A;  4N4F A;  1CHC A;  1WES A;  3V43 A;  2DJA A;  1N87 A;  2LQ6 A;  3DDT A;  4F52 B;  2H0D A;  3U5P A;  1JOC A;  1X4J A;  4C9Z A;  2B0O E;  1LDK C;  2KWO A;  2VPB A;  3KDE C;  2KGI A;  2VP7 A;  4YAD A;  2YQL A;  4O62 A;  3SOU A;  1VFY A;  5D1L B;  4B7Y C;  2K4D A;  5B76 A;  2EA6 A;  2YQM A;  2YUC A;  5EYA F;  3ZNI A;  1JM7 A;  2K1J A;  3VK6 A;  4R8P K;  5D1M B;  4V3K C;  4YC9 A;  3QZV A;  2I50 A;  2ZET C;  2KKX A;  1WE9 A;  2G6Q A;  3T6R A;  3ZPV E;  2KGG A;  1Z6U A;  4LAD B;  5D1K B;  2CSZ A;  5B8D A;  5B79 A;  3O35 A;  4ZQL A;  4LK9 A;  4P5O B;  2KIZ A;  1WEU A;  1WIM A;  1WGM A;  4AYC B;  2ECN A;  4H9D A;  3N9L A;  4UI9 B;  5LKU A;  5G0F A;  5JG6 A;  5B78 A;  2LDR A;  2L75 A;  2LGV A;  3L11 A;  2DSM A;  2RSD A;  4GB0 A;  4L7X A;  2F42 A;  2LXP C;  4GNF A;  4X3G A;  2YUR A;  4AVX A;  4OGC A;  5H1U A;  2K16 A;  4IC3 A;  4O64 A;  2OWA A;  2CSV A;  2MT5 A;  4LJN A;  1HYI A;  4BBQ A;  3H7H A;  2KWK A;  2XEU A;  5C13 A;  3C5K A;  2FUI A;  3RPG B;  3U5N A;  2KYU A;  3O37 A;  2LV9 A;  3IHP A;  4ZDT A;  2PNX A;  3ZPV 1;  2JUN A;  4FIP A;  2FSA A;  5G05 B;  1XWH A;  4WA6 A;  1WEO A;  3N9Q A;  3PLW A;  1MM3 A;  2M3H A;  3DQV R;  3HCU A;  2IDA A;  2YSM A;  4MSX A;  2XOC A;  3LQJ A;  4UP0 A;  4FJC A;  3O36 A;  1MBM A;  2E6R A;  2E6S A;  1E4U A;  4MVT A;  1WEP A;  5FEY A;  4QQ4 A;  5B77 A;  1FP0 A;  3MHS A;  4W4U A;  4WZ0 A;  2VPE A;  5KH7 A;  2KE1 A;  1BOR A;  3KV6 A;  5C11 A;  1G25 A;  3EB6 A;  4Z0R A;  3PUQ A;  4S3O C;  3ZYQ A;  2F6J A;  2LGG A;  5SVX A;  3FM8 C;  3KNV A;  3DPL R;  4XI1 A;  2KKY A;  2VJE A;  5TBN A;  4GNG A;  5LCW B;  2CT2 A;  4NN2 A;  1K2F A;  4AUQ B;  2QJ0 A;  2CRR A;  4CCG X;  3FL2 A;  2L43 A;  2YU4 A;  1WFK A;  4F1P A;  3M7K A;  2LRI C;  4A49 A;  2XP0 A;  1WEM A;  5FB0 A;  3O7A A;  5SVI A;  2G43 A;  3ZVY A;  3ZVZ B;  1U6G B;  3LQH A;  2FD4 A;  2MNZ A;  2QIC A;  2XB1 A;  2M1R A;  2K17 A;  4YBM A;  1WIL A;  1RMD A;  3N9O A;  3MDB C;  3RTR B;  2UZG A;  4R7E A;  5AIT A;  2MKE A;  3SOW A;  1IYM A;  4FO9 A;  3SUB A;  2M13 A;  3HCT A;  2LN0 A;  3LVR E;  3O70 A;  4YBS A;  1Z2Q A;  5TDW A;  4Q6F A;  2JRJ A;  2LXH C;  1X4I A;  3I2D A;  2EGM A;  3SHB A;  2F6N A;  2YRE A;  4YAT A;  4IC2 A;  2ECG A;  1HYJ A;  4PPE A;  2XOY A;  2LGK A;  3PUR A;  2ECJ A;  4N3W A;  2ECV A;  4L58 A;  3FAO A;  1X4U A;  3LRQ A;  5TAB A;  2OXQ C;  4A4B A;  1F62 A;  2YHN A;  2HYE D;  2EGP A;  2XOZ A;  4A4C A;  2LAU A;  1V87 A;  2ECW A;  5KH9 A;  1DCQ A;  4GND A;  2VJE B;  2VPG A;  3E2D A;  2CKL B;  4I7B A;  1WEW A;  2E61 A;  3U5O A;  4YAX A;  5B75 A;  2CON A;  4I7D A;  2L80 A;  2KR4 A;  2MIQ A;  4GNE A; 
#chains in the Genus database with same CATH homology
 2MA5 A;  1DVP A;  4B86 C;  3ASL A;  5FB1 A;  2C2L A;  3KQI A;  2MA6 A;  4TKP B;  2Y43 A;  2MNY A;  2VJF B;  1ZBD B;  3PHD A;  5LKX A;  2L0B A;  5LKZ A;  4CA1 A;  1WEQ A;  3RPG C;  1Z60 A;  3GL6 A;  2BAY A;  2YHO A;  5I3L A;  2CKL A;  2HDP A;  3LQI A;  1WEN A;  1WEV A;  2ECI A;  5DIN A;  2JMJ A;  2LGL A;  4QF3 A;  2VPD A;  2AN6 A;  2QIZ A;  4R2Y A;  2D8S A;  2Y1N A;  3KV5 A;  3M62 A;  3T7L A;  4FK5 A;  2Y1M A;  2KFT A;  2VJF A;  3O34 A;  2CSY A;  2VNF A;  4WZ2 A;  2KWN A;  3HCS A;  2YSJ A;  3N9P A;  5FER A;  4YAB A;  2EOD A;  5J3X A;  5H9M A;  5TRB A;  2MD7 B;  3M63 A;  2JMD A;  2YW8 A;  1FBV A;  2JMI A;  4YBT A;  3N9M A;  3GV4 A;  3MHH A;  4UP5 A;  1MM2 A;  3M99 A;  3L1X A;  2YT5 A;  4I7C A;  3NG2 A;  4BHW A;  2ECT A;  5H1T A;  5G04 B;  2KU3 A;  2M85 A;  2PUY A;  3SOX A;  5KH3 A;  5AIU A;  5DKA A;  1VYX A;  2KWJ A;  3EB5 A;  2C2V S;  3ZTG A;  2MUM A;  2MD8 C;  1LDJ B;  4LKA A;  2RI7 A;  1T1H A;  2H0D B;  2G45 A;  1VD4 A;  3U5M A;  4WZ3 B;  4AP4 A;  2M6M A;  4AYC A;  3C6W A;  2DX8 A;  2KRE A;  5TDR A;  3HTK C;  4A0C D;  5LKT A;  4V3L C;  4QF2 A;  5H1V A;  4S3O B;  3L1Z B;  2FUU A;  2NAA A;  2YYR A;  3O33 A;  4PTB A;  2L5U A;  4ZUX U;  4LLB A;  3N9N A;  1JM7 B;  1WEE A;  4N4F A;  1CHC A;  1WES A;  3V43 A;  1N87 A;  2LQ6 A;  4F52 B;  2H0D A;  3U5P A;  1JOC A;  1X4J A;  4C9Z A;  1LDK C;  2KWO A;  2VPB A;  2KGI A;  2VP7 A;  4YAD A;  2YQL A;  3SOU A;  1VFY A;  5D1L B;  4B7Y C;  2K4D A;  5B76 A;  2EA6 A;  2YQM A;  2YUC A;  5EYA F;  3ZNI A;  1JM7 A;  2K1J A;  3VK6 A;  4R8P K;  5D1M B;  4V3K C;  4YC9 A;  3QZV A;  2I50 A;  2ZET C;  1WE9 A;  2G6Q A;  3T6R A;  3ZPV E;  2KGG A;  1Z6U A;  4LAD B;  5D1K B;  2CSZ A;  5B8D A;  5B79 A;  3O35 A;  4ZQL A;  4LK9 A;  4P5O B;  2KIZ A;  1WEU A;  1WIM A;  1WGM A;  4AYC B;  2ECN A;  3N9L A;  4UI9 B;  5LKU A;  5G0F A;  5JG6 A;  5B78 A;  2LDR A;  2L75 A;  2LGV A;  3L11 A;  2RSD A;  4GB0 A;  4L7X A;  2F42 A;  2LXP C;  4GNF A;  4X3G A;  2YUR A;  4AVX A;  5H1U A;  2K16 A;  4IC3 A;  4O64 A;  2MT5 A;  4LJN A;  1HYI A;  4BBQ A;  2KWK A;  2XEU A;  5C13 A;  3C5K A;  2FUI A;  3RPG B;  3U5N A;  2KYU A;  3O37 A;  2LV9 A;  3IHP A;  4ZDT A;  2PNX A;  3ZPV 1;  4FIP A;  2FSA A;  5G05 B;  1XWH A;  4WA6 A;  1WEO A;  3N9Q A;  1MM3 A;  2M3H A;  3DQV R;  3HCU A;  2IDA A;  2YSM A;  4MSX A;  3LQJ A;  4UP0 A;  4FJC A;  3O36 A;  2E6R A;  2E6S A;  1E4U A;  4MVT A;  1WEP A;  5FEY A;  5B77 A;  1FP0 A;  3MHS A;  4W4U A;  4WZ0 A;  2VPE A;  5KH7 A;  2KE1 A;  1BOR A;  3KV6 A;  5C11 A;  1G25 A;  3EB6 A;  3PUQ A;  4S3O C;  3ZYQ A;  2F6J A;  2LGG A;  3KNV A;  3DPL R;  4XI1 A;  2VJE A;  5TBN A;  4GNG A;  5LCW B;  2CT2 A;  4NN2 A;  1K2F A;  4AUQ B;  2QJ0 A;  4CCG X;  3FL2 A;  2L43 A;  2YU4 A;  1WFK A;  2LRI C;  4A49 A;  1WEM A;  5FB0 A;  3O7A A;  2G43 A;  3ZVY A;  3ZVZ B;  1U6G B;  3LQH A;  2MNZ A;  2QIC A;  2XB1 A;  2M1R A;  2K17 A;  4YBM A;  1WIL A;  1RMD A;  3N9O A;  3RTR B;  2UZG A;  4R7E A;  5AIT A;  3SOW A;  1IYM A;  4FO9 A;  3HCT A;  2LN0 A;  3O70 A;  4YBS A;  1Z2Q A;  5TDW A;  4Q6F A;  2JRJ A;  2LXH C;  1X4I A;  3I2D A;  3SHB A;  2F6N A;  2YRE A;  4YAT A;  4IC2 A;  2ECG A;  1HYJ A;  4PPE A;  2LGK A;  3PUR A;  2ECJ A;  4N3W A;  2ECV A;  4L58 A;  1X4U A;  3LRQ A;  5TAB A;  2OXQ C;  4A4B A;  1F62 A;  2YHN A;  2HYE D;  2EGP A;  4A4C A;  1V87 A;  2ECW A;  5KH9 A;  4GND A;  2VJE B;  2VPG A;  2CKL B;  4I7B A;  1WEW A;  3U5O A;  4YAX A;  5B75 A;  4I7D A;  2L80 A;  2KR4 A;  2MIQ A;  4GNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...