2YQMA

Solution structure of the fyve domain in zinc finger fyve domain-containing protein 12
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
GSSGSSGIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUN and FYVE domain-containing protein 1
publication title Solution structure of the FYVE domain in zinc finger FYVE domain-containing protein 12
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yqmA01
5DKAA 3O37A 3IHPA 4YBMA 4AYCA 2LN0A 1V87A 2G45A 2LRIC 4PTBA 3DPLR 2AN6A 2VJFA 2VPEA 2K17A 3U5PA 2ZETC 2YQMA 2L0BA 5G04B 3I2DA 3SOXA 3N9OA 2F42A 5JG6A 4Q6FA 2ECTA 2LQ6A 3KV5A 2K16A 2MT5A 4GNGA 4WZ2A 2LGKA 2YHOA 4MSXA 4S3OB 4L7XA 5LKTA 4TKPB 1WEQA 2MD8C 4ZUXU 2CKLA 4FJCA 2XB1A 4L58A 2YUCA 2E6SA 2VP7A 2LXPC 1LDKC 5LKXA 2LDRA 3RTRB 4YC9A 2YT5A 3LQHA 2M1RA 1VD4A 2M85A 5H1UA 4YABA 2KWJA 1Z2QA 2G43A 4LADB 2PUYA 3ZNIA 4B86C 4GNFA 1WIMA 1WENA 1WEWA 2KWKA 4QF2A 4O64A 3L1ZB 4X3GA 5D1KB 2KGIA 3SOWA 5TRBA 2C2VS 2KREA 2E6RA 2RI7A 3U5OA 2HDPA 2QJ0A 3QZVA 1VYXA 1WEVA 2Y43A 3SHBA 3GL6A 1WILA 2FUIA 3LQJA 5KH3A 1ZBDB 2OXQC 2UZGA 1LDJB 2YSMA 3MHSA 3M62A 2VJEA 5LKUA 4A49A 2C2LA 1BORA 4F52B 3EB6A 3C6WA 4A4BA 4FIPA 4ZQLA 5TBNA 1IYMA 5B78A 2L75A 2FUUA 5AITA 2H0DA 2VPGA 3LQIA 5C11A 3M63A 5FB1A 4FO9A 2LXHC 4AVXA 2ECWA 2YU4A 2Y1NA 2K4DA 2KFTA 4GB0A 4AYCB 2KGGA 2M3HA 4P5OB 4R7EA 4CA1A 3O34A 3LRQA 5TDRA 1HYIA 3O36A 3ZPVE 2ECNA 2KR4A 3ZVZB 4C9ZA 2VJFB 4B7YC 4A4CA 3RPGB 5H1TA 2IDAA 3N9LA 3DQVR 3L11A 3ZPV1 2KIZA 4IC2A 3C5KA 3O70A 5C13A 1WEPA 2PNXA 1JM7A 4YBSA 2YHNA 1VFYA 2LGVA 3T7LA 2M6MA 3HTKC 1XWHA 4LK9A 3HCSA 5KH9A 2CKLB 2BAYA 2L80A 4BBQA 3T6RA 5FEYA 1JOCA 2MA6A 1U6GB 3N9NA 1Z60A 2YW8A 2MIQA 2RSDA 1FP0A 4S3OC 4YBTA 4A0CD 1WEEA 1E4UA 2KE1A 5EYAF 2LGGA 1CHCA 4AP4A 4V3KC 2QIZA 2LV9A 2Y1MA 4NN2A 3U5NA 2KWOA 4AUQB 4N3WA 2YSJA 1WEMA 2VPDA 3PURA 5B79A 3U5MA 1MM2A 2YURA 4GNEA 4PPEA 5TDWA 5D1MB 4BHWA 2MUMA 4FK5A 4IC3A 5H9MA 2LGLA 2YQLA 4LJNA 3HCUA 5B77A 1MM3A 2VJEB 2MNZA 1HYJA 4CCGX 1X4IA 5B76A 4W4UA 2CSZA 2VPBA 4YAXA 2H0DB 3KV6A 1WEOA 1N87A 4I7DA 4MVTA 4WZ3B 2ECGA 2JRJA 1Z6UA 1WE9A 2VNFA 1RMDA 2L5UA 2KU3A 2KYUA 3HCTA 2G6QA 4UI9B 2KWNA 2CSYA 5KH7A 2EODA 3ZYQA 2NAAA 4YADA 2F6NA 3V43A 4LLBA 5I3LA 3N9MA 3MHHA 3KQIA 2I50A 1FBVA 2MA5A 5TABA 2JMIA 2ECJA 4N4FA 2YYRA 3SOUA 2EA6A 3L1XA 4ZDTA 5J3XA 3O7AA 3N9PA 3N9QA 1F62A 4QF3A 2CT2A 2HYED 4I7CA 5H1VA 2ECIA 4V3LC 5G05B 5D1LB 2L43A 1X4UA 1JM7B 4XI1A 4WZ0A 4R2YA 5LKZA 2MD7B 5AIUA 3EB5A 3RPGC 3ASLA 2DX8A 2QICA 4I7BA 3PHDA 1WFKA 1G25A 3O35A 2EGPA 3ZTGA 3O33A 4UP0A 2XEUA 2K1JA 2JMJA 2D8SA 1K2FA 5DINA 3FL2A 5G0FA 1WESA 4WA6A 1WGMA 4LKAA 2MNYA 2YREA 5B8DA 1DVPA 3M99A 5LCWB 5FERA 4R8PK 3GV4A 5FB0A 1T1HA 3KNVA 5B75A 3VK6A 1WEUA 2FSAA 3NG2A 3ZVYA 4YATA 3PUQA 4UP5A 4GNDA 2ECVA 1X4JA 2JMDA 2F6JA
chains in the Genus database with same CATH superfamily
5DKAA 3O37A 3IHPA 4YBMA 4AYCA 2LN0A 5K3QA 1V87A 2G45A 2LRIC 4PTBA 3DPLR 3LVQE 2AN6A 2VJFA 2VPEA 2K17A 3U5PA 2ZETC 2YQMA 2L0BA 5G04B 3I2DA 3SOXA 3N9OA 2F42A 5JG6A 4Q6FA 2ECTA 2LQ6A 3KV5A 2K16A 2MT5A 4GNGA 2CONA 4WZ2A 4F1PA 2LGKA 4OGCA 2YHOA 2B0OE 2CRRA 4MSXA 4S3OB 4L7XA 5LKTA 4TKPB 2MKEA 3FM8C 1WEQA 2MD8C 4ZUXU 2CKLA 4FJCA 2XB1A 4L58A 2YUCA 2E6SA 2VP7A 2LXPC 1LDKC 5LKXA 2YVRA 2LDRA 3RTRB 4YC9A 2YT5A 3LQHA 2M1RA 2XOCA 1VD4A 2M85A 5H1UA 4YABA 2KWJA 1Z2QA 2G43A 4LADB 2PUYA 3ZNIA 3KDEC 4B86C 4GNFA 2FFWA 1WIMA 1WENA 1WEWA 2KWKA 4QF2A 3M7KA 4O64A 3L1ZB 4X3GA 5D1KB 2KGIA 3SOWA 5TRBA 2C2VS 2KREA 2E6RA 2RI7A 3U5OA 2HDPA 1MBMA 2QJ0A 2XOZA 3QZVA 1VYXA 1WEVA 2Y43A 3SHBA 3LJUX 3GL6A 1WILA 2FUIA 3LQJA 5KH3A 1ZBDB 2OXQC 2UZGA 1LDJB 4Z0RA 4Z0OA 2YSMA 3MHSA 3M62A 2VJEA 5LKUA 4A49A 2C2LA 1BORA 4F52B 3EB6A 3C6WA 4A4BA 4FIPA 4ZQLA 5TBNA 1IYMA 5B78A 2L75A 2FUUA 5AITA 2H0DA 2VPGA 3LQIA 5C11A 3M63A 5FB1A 4FO9A 2LXHC 4AVXA 2ECWA 2YU4A 5SVIA 2Y1NA 2K4DA 2KFTA 4GB0A 4AYCB 2KGGA 2M3HA 4P5OB 4R7EA 4CA1A 3O34A 3LRQA 5TDRA 5SVXA 1HYIA 3O36A 3ZPVE 2ECNA 2KR4A 3ZVZB 4C9ZA 2VJFB 4B7YC 3PLWA 4A4CA 3RPGB 5H1TA 2IDAA 3N9LA 3DQVR 3E2DA 3L11A 3ZPV1 2KIZA 4IC2A 3C5KA 3Q1DA 3O70A 5C13A 1WEPA 2PNXA 1JM7A 4YBSA 3FAOA 2YHNA 1VFYA 2LGVA 3T7LA 2M6MA 3HTKC 4O62A 2D8UA 1XWHA 2DJAA 4LK9A 3HCSA 2CKLB 5KH9A 2BAYA 2L80A 3T9KA 4BBQA 3T6RA 5FEYA 1JOCA 2MA6A 1U6GB 3N9NA 1Z60A 2YW8A 3DWDA 2MIQA 2RSDA 1FP0A 4S3OC 4YBTA 4A0CD 3SUBA 1WEEA 1E4UA 2KE1A 5EYAF 2LGGA 1CHCA 4AP4A 4V3KC 2QIZA 2LV9A 2Y1MA 4NN2A 3U5NA 2M13A 2KWOA 4AUQB 4N3WA 2YSJA 1WEMA 2DSMA 2VPDA 3PURA 3U5MA 1MM2A 5B79A 2YURA 4GNEA 4PPEA 5TDWA 2E61A 5D1MB 4BHWA 2MUMA 3MDBC 4FK5A 4IC3A 5H9MA 2LGLA 2YQLA 2CSVA 4LJNA 3HCUA 5B77A 2EXUA 2XP0A 1MM3A 2VJEB 3LDYA 2MNZA 1HYJA 4CCGX 1X4IA 5B76A 4W4UA 2CSZA 2P57A 2VPBA 4YAXA 3LVRE 2H0DB 3O47A 3KV6A 1WEOA 1N87A 4I7DA 1DCQA 4MVTA 4WZ3B 2ECGA 2JRJA 3FANA 1Z6UA 1WE9A 5SVIB 2VNFA 2JM3A 1RMDA 2L5UA 2KU3A 2KYUA 3HCTA 2G6QA 4UI9B 2KWNA 2CSYA 5KH7A 2EODA 3ZYQA 2NAAA 2OWAA 4YADA 2F6NA 3V43A 4LLBA 5I3LA 3N9MA 3MHHA 3KQIA 3H7HA 2I50A 4QQ4A 1FBVA 2MA5A 5SVYA 5TABA 2JMIA 2ECJA 4N4FA 2YYRA 3SOUA 3FJUB 2EA6A 3L1XA 2RR4A 4ZDTA 5J3XA 3O7AA 3N9PA 3N9QA 1F62A 2KKYA 4QF3A 2CT2A 2EGMA 2LAUA 2HYED 4I7CA 5H1VA 2CRWA 2ECIA 4V3LC 5G05B 5D1LB 2L43A 1X4UA 1JM7B 4XI1A 4WZ0A 4R2YA 5LKZA 2MD7B 5AIUA 3EB5A 3RPGC 3ASLA 2KKXA 2DX8A 2QICA 4I7BA 3PHDA 1WFKA 1G25A 2JUNA 3O35A 2EGPA 3ZTGA 3O33A 2IQJA 4UP0A 2XEUA 2L7PA 2K1JA 2JMJA 2D8SA 1K2FA 5DINA 3FL2A 5G0FA 3FEHA 1WESA 4WA6A 1WGMA 4LKAA 2MNYA 2YREA 3JUEA 5B8DA 1DVPA 3M99A 5LCWB 5FERA 4R8PK 3GV4A 4H9DA 5FB0A 1T1HA 3KNVA 2FD4A 5B75A 2XOYA 3VK6A 1WEUA 2FSAA 3DDTA 3NG2A 3ZVYA 4YATA 3PUQA 4UP5A 4GNDA 2ECVA 1X4JA 2F6JA 2JMDA 4OGEA
chains in the Genus database with same CATH topology
5DKAA 3O37A 3IHPA 4YBMA 4AYCA 2LN0A 1V87A 2G45A 2LRIC 4PTBA 3DPLR 2AN6A 2VJFA 2VPEA 2K17A 3U5PA 2ZETC 2YQMA 2L0BA 5G04B 3I2DA 3SOXA 3N9OA 2F42A 5JG6A 4Q6FA 2ECTA 2LQ6A 3KV5A 2K16A 2MT5A 4GNGA 4WZ2A 2LGKA 2YHOA 4MSXA 4S3OB 4L7XA 5LKTA 4TKPB 1WEQA 2MD8C 4ZUXU 2CKLA 4FJCA 2XB1A 4L58A 2YUCA 2E6SA 2VP7A 2LXPC 1LDKC 5LKXA 2LDRA 3RTRB 4YC9A 2YT5A 3LQHA 2M1RA 1VD4A 2M85A 5H1UA 4YABA 2KWJA 1Z2QA 2G43A 4LADB 2PUYA 3ZNIA 4B86C 4GNFA 1WIMA 1WENA 1WEWA 2KWKA 4QF2A 4O64A 3L1ZB 4X3GA 5D1KB 2KGIA 3SOWA 5TRBA 2C2VS 2KREA 2E6RA 2RI7A 3U5OA 2HDPA 2QJ0A 3QZVA 1VYXA 1WEVA 2Y43A 3SHBA 3GL6A 1WILA 2FUIA 3LQJA 5KH3A 1ZBDB 2OXQC 2UZGA 1LDJB 2YSMA 3MHSA 3M62A 2VJEA 5LKUA 4A49A 2C2LA 1BORA 4F52B 3EB6A 3C6WA 4A4BA 4FIPA 4ZQLA 5TBNA 1IYMA 5B78A 2L75A 2FUUA 5AITA 2H0DA 2VPGA 3LQIA 5C11A 3M63A 5FB1A 4FO9A 2LXHC 4AVXA 2ECWA 2YU4A 2Y1NA 2K4DA 2KFTA 4GB0A 4AYCB 2KGGA 2M3HA 4P5OB 4R7EA 4CA1A 3O34A 3LRQA 5TDRA 1HYIA 3O36A 3ZPVE 2ECNA 2KR4A 3ZVZB 4C9ZA 2VJFB 4B7YC 4A4CA 3RPGB 5H1TA 2IDAA 3N9LA 3DQVR 3L11A 3ZPV1 2KIZA 4IC2A 3C5KA 3O70A 5C13A 1WEPA 2PNXA 1JM7A 4YBSA 2YHNA 1VFYA 2LGVA 3T7LA 2M6MA 3HTKC 1XWHA 4LK9A 3HCSA 5KH9A 2CKLB 2BAYA 2L80A 4BBQA 3T6RA 5FEYA 1JOCA 2MA6A 1U6GB 3N9NA 1Z60A 2YW8A 2MIQA 2RSDA 1FP0A 4S3OC 4YBTA 4A0CD 1WEEA 1E4UA 2KE1A 5EYAF 2LGGA 1CHCA 4AP4A 4V3KC 2QIZA 2LV9A 2Y1MA 4NN2A 3U5NA 2KWOA 4AUQB 4N3WA 2YSJA 1WEMA 2VPDA 3PURA 5B79A 3U5MA 1MM2A 2YURA 4GNEA 4PPEA 5TDWA 5D1MB 4BHWA 2MUMA 4FK5A 4IC3A 5H9MA 2LGLA 2YQLA 4LJNA 3HCUA 5B77A 1MM3A 2VJEB 2MNZA 1HYJA 4CCGX 1X4IA 5B76A 4W4UA 2CSZA 2VPBA 4YAXA 2H0DB 3KV6A 1WEOA 1N87A 4I7DA 4MVTA 4WZ3B 2ECGA 2JRJA 1Z6UA 1WE9A 2VNFA 1RMDA 2L5UA 2KU3A 2KYUA 3HCTA 2G6QA 4UI9B 2KWNA 2CSYA 5KH7A 2EODA 3ZYQA 2NAAA 4YADA 2F6NA 3V43A 4LLBA 5I3LA 3N9MA 3MHHA 3KQIA 2I50A 1FBVA 2MA5A 5TABA 2JMIA 2ECJA 4N4FA 2YYRA 3SOUA 2EA6A 3L1XA 4ZDTA 5J3XA 3O7AA 3N9PA 3N9QA 1F62A 4QF3A 2CT2A 2HYED 4I7CA 5H1VA 2ECIA 4V3LC 5G05B 5D1LB 2L43A 1X4UA 1JM7B 4XI1A 4WZ0A 4R2YA 5LKZA 2MD7B 5AIUA 3EB5A 3RPGC 3ASLA 2DX8A 2QICA 4I7BA 3PHDA 1WFKA 1G25A 3O35A 2EGPA 3ZTGA 3O33A 4UP0A 2XEUA 2K1JA 2JMJA 2D8SA 1K2FA 5DINA 3FL2A 5G0FA 1WESA 4WA6A 1WGMA 4LKAA 2MNYA 2YREA 5B8DA 1DVPA 3M99A 5LCWB 5FERA 4R8PK 3GV4A 5FB0A 1T1HA 3KNVA 5B75A 3VK6A 1WEUA 2FSAA 3NG2A 3ZVYA 4YATA 3PUQA 4UP5A 4GNDA 2ECVA 1X4JA 2JMDA 2F6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKA A;  3O37 A;  3IHP A;  4YBM A;  4AYC A;  2LN0 A;  1V87 A;  2G45 A;  2LRI C;  4PTB A;  3DPL R;  2AN6 A;  2VJF A;  2VPE A;  2K17 A;  3U5P A;  2ZET C;  2YQM A;  2L0B A;  5G04 B;  3I2D A;  3SOX A;  3N9O A;  2F42 A;  5JG6 A;  4Q6F A;  2ECT A;  2LQ6 A;  3KV5 A;  2K16 A;  2MT5 A;  4GNG A;  4WZ2 A;  2LGK A;  2YHO A;  4MSX A;  4S3O B;  4L7X A;  5LKT A;  4TKP B;  1WEQ A;  2MD8 C;  4ZUX U;  2CKL A;  4FJC A;  2XB1 A;  4L58 A;  2YUC A;  2E6S A;  2VP7 A;  2LXP C;  1LDK C;  5LKX A;  2LDR A;  3RTR B;  4YC9 A;  2YT5 A;  3LQH A;  2M1R A;  1VD4 A;  2M85 A;  5H1U A;  4YAB A;  2KWJ A;  1Z2Q A;  2G43 A;  4LAD B;  2PUY A;  3ZNI A;  4B86 C;  4GNF A;  1WIM A;  1WEN A;  1WEW A;  2KWK A;  4QF2 A;  4O64 A;  3L1Z B;  4X3G A;  5D1K B;  2KGI A;  3SOW A;  5TRB A;  2C2V S;  2KRE A;  2E6R A;  2RI7 A;  3U5O A;  2HDP A;  2QJ0 A;  3QZV A;  1VYX A;  1WEV A;  2Y43 A;  3SHB A;  3GL6 A;  1WIL A;  2FUI A;  3LQJ A;  5KH3 A;  1ZBD B;  2OXQ C;  2UZG A;  1LDJ B;  2YSM A;  3MHS A;  3M62 A;  2VJE A;  5LKU A;  4A49 A;  2C2L A;  1BOR A;  4F52 B;  3EB6 A;  3C6W A;  4A4B A;  4FIP A;  4ZQL A;  5TBN A;  1IYM A;  5B78 A;  2L75 A;  2FUU A;  5AIT A;  2H0D A;  2VPG A;  3LQI A;  5C11 A;  3M63 A;  5FB1 A;  4FO9 A;  2LXH C;  4AVX A;  2ECW A;  2YU4 A;  2Y1N A;  2K4D A;  2KFT A;  4GB0 A;  4AYC B;  2KGG A;  2M3H A;  4P5O B;  4R7E A;  4CA1 A;  3O34 A;  3LRQ A;  5TDR A;  1HYI A;  3O36 A;  3ZPV E;  2ECN A;  2KR4 A;  3ZVZ B;  4C9Z A;  2VJF B;  4B7Y C;  4A4C A;  3RPG B;  5H1T A;  2IDA A;  3N9L A;  3DQV R;  3L11 A;  3ZPV 1;  2KIZ A;  4IC2 A;  3C5K A;  3O70 A;  5C13 A;  1WEP A;  2PNX A;  1JM7 A;  4YBS A;  2YHN A;  1VFY A;  2LGV A;  3T7L A;  2M6M A;  3HTK C;  1XWH A;  4LK9 A;  3HCS A;  5KH9 A;  2CKL B;  2BAY A;  2L80 A;  4BBQ A;  3T6R A;  5FEY A;  1JOC A;  2MA6 A;  1U6G B;  3N9N A;  1Z60 A;  2YW8 A;  2MIQ A;  2RSD A;  1FP0 A;  4S3O C;  4YBT A;  4A0C D;  1WEE A;  1E4U A;  2KE1 A;  5EYA F;  2LGG A;  1CHC A;  4AP4 A;  4V3K C;  2QIZ A;  2LV9 A;  2Y1M A;  4NN2 A;  3U5N A;  2KWO A;  4AUQ B;  4N3W A;  2YSJ A;  1WEM A;  2VPD A;  3PUR A;  5B79 A;  3U5M A;  1MM2 A;  2YUR A;  4GNE A;  4PPE A;  5TDW A;  5D1M B;  4BHW A;  2MUM A;  4FK5 A;  4IC3 A;  5H9M A;  2LGL A;  2YQL A;  4LJN A;  3HCU A;  5B77 A;  1MM3 A;  2VJE B;  2MNZ A;  1HYJ A;  4CCG X;  1X4I A;  5B76 A;  4W4U A;  2CSZ A;  2VPB A;  4YAX A;  2H0D B;  3KV6 A;  1WEO A;  1N87 A;  4I7D A;  4MVT A;  4WZ3 B;  2ECG A;  2JRJ A;  1Z6U A;  1WE9 A;  2VNF A;  1RMD A;  2L5U A;  2KU3 A;  2KYU A;  3HCT A;  2G6Q A;  4UI9 B;  2KWN A;  2CSY A;  5KH7 A;  2EOD A;  3ZYQ A;  2NAA A;  4YAD A;  2F6N A;  3V43 A;  4LLB A;  5I3L A;  3N9M A;  3MHH A;  3KQI A;  2I50 A;  1FBV A;  2MA5 A;  5TAB A;  2JMI A;  2ECJ A;  4N4F A;  2YYR A;  3SOU A;  2EA6 A;  3L1X A;  4ZDT A;  5J3X A;  3O7A A;  3N9P A;  3N9Q A;  1F62 A;  4QF3 A;  2CT2 A;  2HYE D;  4I7C A;  5H1V A;  2ECI A;  4V3L C;  5G05 B;  5D1L B;  2L43 A;  1X4U A;  1JM7 B;  4XI1 A;  4WZ0 A;  4R2Y A;  5LKZ A;  2MD7 B;  5AIU A;  3EB5 A;  3RPG C;  3ASL A;  2DX8 A;  2QIC A;  4I7B A;  3PHD A;  1WFK A;  1G25 A;  3O35 A;  2EGP A;  3ZTG A;  3O33 A;  4UP0 A;  2XEU A;  2K1J A;  2JMJ A;  2D8S A;  1K2F A;  5DIN A;  3FL2 A;  5G0F A;  1WES A;  4WA6 A;  1WGM A;  4LKA A;  2MNY A;  2YRE A;  5B8D A;  1DVP A;  3M99 A;  5LCW B;  5FER A;  4R8P K;  3GV4 A;  5FB0 A;  1T1H A;  3KNV A;  5B75 A;  3VK6 A;  1WEU A;  2FSA A;  3NG2 A;  3ZVY A;  4YAT A;  3PUQ A;  4UP5 A;  4GND A;  2ECV A;  1X4J A;  2JMD A;  2F6J A; 
#chains in the Genus database with same CATH topology
 5DKA A;  3O37 A;  3IHP A;  4YBM A;  4AYC A;  2LN0 A;  5K3Q A;  1V87 A;  2G45 A;  2LRI C;  4PTB A;  3DPL R;  3LVQ E;  2AN6 A;  2VJF A;  2VPE A;  2K17 A;  3U5P A;  2ZET C;  2YQM A;  2L0B A;  5G04 B;  3I2D A;  3SOX A;  3N9O A;  2F42 A;  5JG6 A;  4Q6F A;  2ECT A;  2LQ6 A;  3KV5 A;  2K16 A;  2MT5 A;  4GNG A;  2CON A;  4WZ2 A;  4F1P A;  2LGK A;  4OGC A;  2YHO A;  2B0O E;  2CRR A;  4MSX A;  4S3O B;  4L7X A;  5LKT A;  4TKP B;  2MKE A;  3FM8 C;  1WEQ A;  2MD8 C;  4ZUX U;  2CKL A;  4FJC A;  2XB1 A;  4L58 A;  2YUC A;  2E6S A;  2VP7 A;  2LXP C;  1LDK C;  5LKX A;  2YVR A;  2LDR A;  3RTR B;  4YC9 A;  2YT5 A;  3LQH A;  2M1R A;  2XOC A;  1VD4 A;  2M85 A;  5H1U A;  4YAB A;  2KWJ A;  1Z2Q A;  2G43 A;  4LAD B;  2PUY A;  3ZNI A;  3KDE C;  4B86 C;  4GNF A;  2FFW A;  1WIM A;  1WEN A;  1WEW A;  2KWK A;  4QF2 A;  3M7K A;  4O64 A;  3L1Z B;  4X3G A;  5D1K B;  2KGI A;  3SOW A;  5TRB A;  2C2V S;  2KRE A;  2E6R A;  2RI7 A;  3U5O A;  2HDP A;  1MBM A;  2QJ0 A;  2XOZ A;  3QZV A;  1VYX A;  1WEV A;  2Y43 A;  3SHB A;  3LJU X;  3GL6 A;  1WIL A;  2FUI A;  3LQJ A;  5KH3 A;  1ZBD B;  2OXQ C;  2UZG A;  1LDJ B;  4Z0R A;  4Z0O A;  2YSM A;  3MHS A;  3M62 A;  2VJE A;  5LKU A;  4A49 A;  2C2L A;  1BOR A;  4F52 B;  3EB6 A;  3C6W A;  4A4B A;  4FIP A;  4ZQL A;  5TBN A;  1IYM A;  5B78 A;  2L75 A;  2FUU A;  5AIT A;  2H0D A;  2VPG A;  3LQI A;  5C11 A;  3M63 A;  5FB1 A;  4FO9 A;  2LXH C;  4AVX A;  2ECW A;  2YU4 A;  5SVI A;  2Y1N A;  2K4D A;  2KFT A;  4GB0 A;  4AYC B;  2KGG A;  2M3H A;  4P5O B;  4R7E A;  4CA1 A;  3O34 A;  3LRQ A;  5TDR A;  5SVX A;  1HYI A;  3O36 A;  3ZPV E;  2ECN A;  2KR4 A;  3ZVZ B;  4C9Z A;  2VJF B;  4B7Y C;  3PLW A;  4A4C A;  3RPG B;  5H1T A;  2IDA A;  3N9L A;  3DQV R;  3E2D A;  3L11 A;  3ZPV 1;  2KIZ A;  4IC2 A;  3C5K A;  3Q1D A;  3O70 A;  5C13 A;  1WEP A;  2PNX A;  1JM7 A;  4YBS A;  3FAO A;  2YHN A;  1VFY A;  2LGV A;  3T7L A;  2M6M A;  3HTK C;  4O62 A;  2D8U A;  1XWH A;  2DJA A;  4LK9 A;  3HCS A;  2CKL B;  5KH9 A;  2BAY A;  2L80 A;  3T9K A;  4BBQ A;  3T6R A;  5FEY A;  1JOC A;  2MA6 A;  1U6G B;  3N9N A;  1Z60 A;  2YW8 A;  3DWD A;  2MIQ A;  2RSD A;  1FP0 A;  4S3O C;  4YBT A;  4A0C D;  3SUB A;  1WEE A;  1E4U A;  2KE1 A;  5EYA F;  2LGG A;  1CHC A;  4AP4 A;  4V3K C;  2QIZ A;  2LV9 A;  2Y1M A;  4NN2 A;  3U5N A;  2M13 A;  2KWO A;  4AUQ B;  4N3W A;  2YSJ A;  1WEM A;  2DSM A;  2VPD A;  3PUR A;  3U5M A;  1MM2 A;  5B79 A;  2YUR A;  4GNE A;  4PPE A;  5TDW A;  2E61 A;  5D1M B;  4BHW A;  2MUM A;  3MDB C;  4FK5 A;  4IC3 A;  5H9M A;  2LGL A;  2YQL A;  2CSV A;  4LJN A;  3HCU A;  5B77 A;  2EXU A;  2XP0 A;  1MM3 A;  2VJE B;  3LDY A;  2MNZ A;  1HYJ A;  4CCG X;  1X4I A;  5B76 A;  4W4U A;  2CSZ A;  2P57 A;  2VPB A;  4YAX A;  3LVR E;  2H0D B;  3O47 A;  3KV6 A;  1WEO A;  1N87 A;  4I7D A;  1DCQ A;  4MVT A;  4WZ3 B;  2ECG A;  2JRJ A;  3FAN A;  1Z6U A;  1WE9 A;  5SVI B;  2VNF A;  2JM3 A;  1RMD A;  2L5U A;  2KU3 A;  2KYU A;  3HCT A;  2G6Q A;  4UI9 B;  2KWN A;  2CSY A;  5KH7 A;  2EOD A;  3ZYQ A;  2NAA A;  2OWA A;  4YAD A;  2F6N A;  3V43 A;  4LLB A;  5I3L A;  3N9M A;  3MHH A;  3KQI A;  3H7H A;  2I50 A;  4QQ4 A;  1FBV A;  2MA5 A;  5SVY A;  5TAB A;  2JMI A;  2ECJ A;  4N4F A;  2YYR A;  3SOU A;  3FJU B;  2EA6 A;  3L1X A;  2RR4 A;  4ZDT A;  5J3X A;  3O7A A;  3N9P A;  3N9Q A;  1F62 A;  2KKY A;  4QF3 A;  2CT2 A;  2EGM A;  2LAU A;  2HYE D;  4I7C A;  5H1V A;  2CRW A;  2ECI A;  4V3L C;  5G05 B;  5D1L B;  2L43 A;  1X4U A;  1JM7 B;  4XI1 A;  4WZ0 A;  4R2Y A;  5LKZ A;  2MD7 B;  5AIU A;  3EB5 A;  3RPG C;  3ASL A;  2KKX A;  2DX8 A;  2QIC A;  4I7B A;  3PHD A;  1WFK A;  1G25 A;  2JUN A;  3O35 A;  2EGP A;  3ZTG A;  3O33 A;  2IQJ A;  4UP0 A;  2XEU A;  2L7P A;  2K1J A;  2JMJ A;  2D8S A;  1K2F A;  5DIN A;  3FL2 A;  5G0F A;  3FEH A;  1WES A;  4WA6 A;  1WGM A;  4LKA A;  2MNY A;  2YRE A;  3JUE A;  5B8D A;  1DVP A;  3M99 A;  5LCW B;  5FER A;  4R8P K;  3GV4 A;  4H9D A;  5FB0 A;  1T1H A;  3KNV A;  2FD4 A;  5B75 A;  2XOY A;  3VK6 A;  1WEU A;  2FSA A;  3DDT A;  3NG2 A;  3ZVY A;  4YAT A;  3PUQ A;  4UP5 A;  4GND A;  2ECV A;  1X4J A;  2F6J A;  2JMD A;  4OGE A; 
#chains in the Genus database with same CATH homology
 5DKA A;  3O37 A;  3IHP A;  4YBM A;  4AYC A;  2LN0 A;  1V87 A;  2G45 A;  2LRI C;  4PTB A;  3DPL R;  2AN6 A;  2VJF A;  2VPE A;  2K17 A;  3U5P A;  2ZET C;  2YQM A;  2L0B A;  5G04 B;  3I2D A;  3SOX A;  3N9O A;  2F42 A;  5JG6 A;  4Q6F A;  2ECT A;  2LQ6 A;  3KV5 A;  2K16 A;  2MT5 A;  4GNG A;  4WZ2 A;  2LGK A;  2YHO A;  4MSX A;  4S3O B;  4L7X A;  5LKT A;  4TKP B;  1WEQ A;  2MD8 C;  4ZUX U;  2CKL A;  4FJC A;  2XB1 A;  4L58 A;  2YUC A;  2E6S A;  2VP7 A;  2LXP C;  1LDK C;  5LKX A;  2LDR A;  3RTR B;  4YC9 A;  2YT5 A;  3LQH A;  2M1R A;  1VD4 A;  2M85 A;  5H1U A;  4YAB A;  2KWJ A;  1Z2Q A;  2G43 A;  4LAD B;  2PUY A;  3ZNI A;  4B86 C;  4GNF A;  1WIM A;  1WEN A;  1WEW A;  2KWK A;  4QF2 A;  4O64 A;  3L1Z B;  4X3G A;  5D1K B;  2KGI A;  3SOW A;  5TRB A;  2C2V S;  2KRE A;  2E6R A;  2RI7 A;  3U5O A;  2HDP A;  2QJ0 A;  3QZV A;  1VYX A;  1WEV A;  2Y43 A;  3SHB A;  3GL6 A;  1WIL A;  2FUI A;  3LQJ A;  5KH3 A;  1ZBD B;  2OXQ C;  2UZG A;  1LDJ B;  2YSM A;  3MHS A;  3M62 A;  2VJE A;  5LKU A;  4A49 A;  2C2L A;  1BOR A;  4F52 B;  3EB6 A;  3C6W A;  4A4B A;  4FIP A;  4ZQL A;  5TBN A;  1IYM A;  5B78 A;  2L75 A;  2FUU A;  5AIT A;  2H0D A;  2VPG A;  3LQI A;  5C11 A;  3M63 A;  5FB1 A;  4FO9 A;  2LXH C;  4AVX A;  2ECW A;  2YU4 A;  2Y1N A;  2K4D A;  2KFT A;  4GB0 A;  4AYC B;  2KGG A;  2M3H A;  4P5O B;  4R7E A;  4CA1 A;  3O34 A;  3LRQ A;  5TDR A;  1HYI A;  3O36 A;  3ZPV E;  2ECN A;  2KR4 A;  3ZVZ B;  4C9Z A;  2VJF B;  4B7Y C;  4A4C A;  3RPG B;  5H1T A;  2IDA A;  3N9L A;  3DQV R;  3L11 A;  3ZPV 1;  2KIZ A;  4IC2 A;  3C5K A;  3O70 A;  5C13 A;  1WEP A;  2PNX A;  1JM7 A;  4YBS A;  2YHN A;  1VFY A;  2LGV A;  3T7L A;  2M6M A;  3HTK C;  1XWH A;  4LK9 A;  3HCS A;  5KH9 A;  2CKL B;  2BAY A;  2L80 A;  4BBQ A;  3T6R A;  5FEY A;  1JOC A;  2MA6 A;  1U6G B;  3N9N A;  1Z60 A;  2YW8 A;  2MIQ A;  2RSD A;  1FP0 A;  4S3O C;  4YBT A;  4A0C D;  1WEE A;  1E4U A;  2KE1 A;  5EYA F;  2LGG A;  1CHC A;  4AP4 A;  4V3K C;  2QIZ A;  2LV9 A;  2Y1M A;  4NN2 A;  3U5N A;  2KWO A;  4AUQ B;  4N3W A;  2YSJ A;  1WEM A;  2VPD A;  3PUR A;  5B79 A;  3U5M A;  1MM2 A;  2YUR A;  4GNE A;  4PPE A;  5TDW A;  5D1M B;  4BHW A;  2MUM A;  4FK5 A;  4IC3 A;  5H9M A;  2LGL A;  2YQL A;  4LJN A;  3HCU A;  5B77 A;  1MM3 A;  2VJE B;  2MNZ A;  1HYJ A;  4CCG X;  1X4I A;  5B76 A;  4W4U A;  2CSZ A;  2VPB A;  4YAX A;  2H0D B;  3KV6 A;  1WEO A;  1N87 A;  4I7D A;  4MVT A;  4WZ3 B;  2ECG A;  2JRJ A;  1Z6U A;  1WE9 A;  2VNF A;  1RMD A;  2L5U A;  2KU3 A;  2KYU A;  3HCT A;  2G6Q A;  4UI9 B;  2KWN A;  2CSY A;  5KH7 A;  2EOD A;  3ZYQ A;  2NAA A;  4YAD A;  2F6N A;  3V43 A;  4LLB A;  5I3L A;  3N9M A;  3MHH A;  3KQI A;  2I50 A;  1FBV A;  2MA5 A;  5TAB A;  2JMI A;  2ECJ A;  4N4F A;  2YYR A;  3SOU A;  2EA6 A;  3L1X A;  4ZDT A;  5J3X A;  3O7A A;  3N9P A;  3N9Q A;  1F62 A;  4QF3 A;  2CT2 A;  2HYE D;  4I7C A;  5H1V A;  2ECI A;  4V3L C;  5G05 B;  5D1L B;  2L43 A;  1X4U A;  1JM7 B;  4XI1 A;  4WZ0 A;  4R2Y A;  5LKZ A;  2MD7 B;  5AIU A;  3EB5 A;  3RPG C;  3ASL A;  2DX8 A;  2QIC A;  4I7B A;  3PHD A;  1WFK A;  1G25 A;  3O35 A;  2EGP A;  3ZTG A;  3O33 A;  4UP0 A;  2XEU A;  2K1J A;  2JMJ A;  2D8S A;  1K2F A;  5DIN A;  3FL2 A;  5G0F A;  1WES A;  4WA6 A;  1WGM A;  4LKA A;  2MNY A;  2YRE A;  5B8D A;  1DVP A;  3M99 A;  5LCW B;  5FER A;  4R8P K;  3GV4 A;  5FB0 A;  1T1H A;  3KNV A;  5B75 A;  3VK6 A;  1WEU A;  2FSA A;  3NG2 A;  3ZVY A;  4YAT A;  3PUQ A;  4UP5 A;  4GND A;  2ECV A;  1X4J A;  2JMD A;  2F6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...