2YQMA

Solution structure of the fyve domain in zinc finger fyve domain-containing protein 12
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
GSSGSSGIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the FYVE domain in zinc finger FYVE domain-containing protein 12
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords RUN and FYVE domain-containing protein 1
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yqmA01
1Z2QA 4GNFA 1X4IA 3N9PA 2XB1A 1WIMA 4FK5A 1N87A 5H1UA 4L58A 2FSAA 3KV6A 4LKAA 4NN2A 4N3WA 2QIZA 3U5OA 2ECIA 2YU4A 4YATA 4BHWA 1Z60A 5TRBA 1WEMA 1FBVA 3C6WA 2KYUA 2EA6A 2KGIA 1JM7A 3V43A 1WENA 4AVXA 3KV5A 3ZVZB 1F62A 4WZ0A 2M85A 3M62A 5H9MA 2KREA 4FJCA 1BORA 5B79A 4UP0A 2JRJA 2EODA 2E6SA 2VJFA 4WZ2A 3GV4A 4YBTA 3SHBA 2YHNA 2JMIA 1WEOA 3ZYQA 2LRIC 4CCGX 5DINA 4N4FA 4AUQB 1LDJB 2JMJA 3HCTA 3ZPV1 4V3LC 2CSYA 5B77A 4UP5A 4B86C 3C5KA 4I7DA 2PUYA 5AIUA 2LXPC 2HDPA 1ZBDB 3SOUA 4GNEA 5LKTA 2VNFA 3DQVR 3U5PA 2MNYA 2LGKA 3U5MA 1MM3A 4Q6FA 1MM2A 4IC2A 5C13A 3ASLA 3ZPVE 3I2DA 5D1MB 5D1KB 4A4BA 4LJNA 2IDAA 2MT5A 4LLBA 3N9QA 4L7XA 5KH7A 3L1XA 2Y43A 3SOXA 2MNZA 4AYCA 1HYIA 2Y1MA 3M99A 4A0CD 3LQHA 1WEEA 2YW8A 4LADB 3MHSA 2K4DA 2L75A 2KGGA 3EB6A 3KNVA 3IHPA 2G43A 2QJ0A 2F6NA 1WEVA 2EGPA 3QZVA 2VPBA 2MIQA 2YHOA 4R2YA 2ECVA 2LXHC 2K17A 2LDRA 5EYAF 5B78A 2YSJA 5B8DA 2KWKA 4A49A 1X4UA 3O7AA 4TKPB 2OXQC 5AITA 1DVPA 3LQIA 2G6QA 2ECNA 2VJEA 3GL6A 2KU3A 2VJEB 4F52B 3M63A 4QF3A 1XWHA 2FUUA 1WE9A 2QICA 3HCSA 4MSXA 2ECWA 3RPGB 3O35A 2CSZA 5H1VA 2AN6A 3N9MA 4O64A 4UI9B 3O37A 2MA6A 3T6RA 1K2FA 4IC3A 5C11A 2PNXA 2YQMA 1WEPA 2L43A 3RPGC 2RSDA 3O34A 4R8PK 4A4CA 4YBMA 3SOWA 3PURA 2ECGA 2CKLA 2ZETC 1WEWA 2K16A 5FERA 2KE1A 5FB1A 4ZUXU 2VPEA 4I7CA 2VJFB 3PHDA 3N9OA 2UZGA 1U6GB 4MVTA 4WA6A 1WEQA 2RI7A 2LV9A 3HTKC 2Y1NA 2FUIA 2CKLB 4YAXA 2M6MA 2KWOA 2YSMA 2KWNA 4FO9A 2HYED 2BAYA 4GNGA 4AYCB 1V87A 1VYXA 2KFTA 2KIZA 2LN0A 4WZ3B 5TDRA 2LGVA 1JOCA 1E4UA 4FIPA 1HYJA 4I7BA 3O36A 5D1LB 1WESA 4BBQA 2KR4A 1CHCA 2ECTA 4CA1A 3LQJA 4YADA 3U5NA 4S3OB 1WEUA 1LDKC 3MHHA 2K1JA 5I3LA 3L1ZB 2VPDA 1X4JA 2LQ6A 2M3HA 1JM7B 2E6RA 2ECJA 1T1HA 2I50A 3ZNIA 5DKAA 2F6JA 2MD7B 5LKXA 1WGMA 5TBNA 5LCWB 2YYRA 2YREA 5G0FA 2M1RA 3HCUA 4PTBA 4W4UA 1RMDA 5J3XA 2KWJA 2CT2A 4ZDTA 3ZVYA 5H1TA 2C2LA 4X3GA 1VFYA 4LK9A 2L0BA 4XI1A 2MUMA 4ZQLA 4PPEA 2VPGA 5TDWA 3VK6A 2H0DB 2L80A 2DX8A 2G45A 2H0DA 4S3OC 4YABA 2YT5A 3O33A 3O70A 3ZTGA 2LGGA 2D8SA 3RTRB 4B7YC 1IYMA 1Z6UA 3NG2A 2MD8C 2LGLA 2YUCA 2F42A 3EB5A 3KQIA 4V3KC 5G04B 3N9NA 5LKUA 5B76A 2L5UA 3DPLR 5JG6A 2JMDA 5LKZA 4P5OB 2NAAA 3T7LA 5B75A 5FB0A 2XEUA 3N9LA 1WFKA 3LRQA 2C2VS 2MA5A 4R7EA 5TABA 1VD4A 3PUQA 5KH9A 4YBSA 5FEYA 4C9ZA 4QF2A 2YQLA 1G25A 2VP7A 1FP0A 4AP4A 4GB0A 5G05B 4GNDA 1WILA 2YURA 3L11A 3FL2A 4YC9A 5KH3A
chains in the Genus database with same CATH superfamily
1Z2QA 2MKEA 4GNFA 1X4IA 3N9PA 2XB1A 1WIMA 4OGCA 3FAOA 4FK5A 1N87A 5H1UA 4L58A 2FSAA 3KV6A 2FD4A 4LKAA 4NN2A 4N3WA 2QIZA 3U5OA 2ECIA 2YU4A 4YATA 4BHWA 1Z60A 5TRBA 1WEMA 1FBVA 3C6WA 2EGMA 2KYUA 2EA6A 2KGIA 1JM7A 3V43A 2P57A 1WENA 4AVXA 3T9KA 3KV5A 2OWAA 3ZVZB 1F62A 4WZ0A 2M85A 3M62A 5H9MA 2KREA 4FJCA 1BORA 5B79A 4UP0A 2JRJA 2YVRA 2EODA 2L7PA 2E6SA 2VJFA 4WZ2A 3GV4A 4YBTA 3SHBA 2YHNA 3Q1DA 2JMIA 1WEOA 3ZYQA 2LRIC 4CCGX 3E2DA 2JM3A 5DINA 4N4FA 4AUQB 1LDJB 2JMJA 3HCTA 3ZPV1 5SVYA 4V3LC 2CSYA 5B77A 4UP5A 4B86C 4Z0RA 3C5KA 4I7DA 2PUYA 5AIUA 4Z0OA 2LXPC 2HDPA 3DWDA 1ZBDB 3SOUA 4GNEA 5LKTA 5SVXA 2VNFA 3DQVR 3U5PA 2MNYA 2LGKA 3U5MA 1MM3A 4Q6FA 1MM2A 4IC2A 5C13A 3ASLA 3ZPVE 2DSMA 3I2DA 5D1MB 2KKYA 5D1KB 4A4BA 4LJNA 2IDAA 2JUNA 2MT5A 3N9QA 4LLBA 4L7XA 5KH7A 3L1XA 2Y43A 3SOXA 2MNZA 4AYCA 1HYIA 2Y1MA 3M99A 4A0CD 3LQHA 1WEEA 4O62A 2YW8A 4LADB 3MHSA 2K4DA 2L75A 2KGGA 3EB6A 3KNVA 3IHPA 2G43A 2QJ0A 2DJAA 2F6NA 1WEVA 2EGPA 3QZVA 2VPBA 2MIQA 2YHOA 4R2YA 2ECVA 2LXHC 2K17A 2XOCA 2LDRA 5EYAF 5B78A 2YSJA 5B8DA 2KWKA 4A49A 1X4UA 3O7AA 4TKPB 2OXQC 5AITA 1DVPA 3LQIA 2G6QA 2ECNA 2VJEA 3GL6A 2KU3A 2VJEB 4F52B 3M63A 4QF3A 1XWHA 2FUUA 1WE9A 2QICA 3HCSA 4MSXA 2ECWA 3RPGB 3O35A 3SUBA 2CSZA 5H1VA 1DCQA 2AN6A 3N9MA 4O64A 4UI9B 3O37A 2MA6A 3LDYA 2IQJA 3T6RA 1K2FA 4IC3A 2KKXA 5C11A 2PNXA 2YQMA 1WEPA 2L43A 3RPGC 2RSDA 3O34A 4R8PK 4A4CA 4YBMA 3SOWA 3PURA 2ECGA 2CKLA 2ZETC 1WEWA 2K16A 3JUEA 5FERA 2KE1A 3MDBC 5FB1A 4ZUXU 2VPEA 4I7CA 2CRRA 2VJFB 3PHDA 3N9OA 2UZGA 1U6GB 4MVTA 4WA6A 3LVQE 2CRWA 1WEQA 3KDEC 2RI7A 2LV9A 3HTKC 2Y1NA 2FUIA 2CKLB 4YAXA 2M6MA 2KWOA 2XP0A 2YSMA 2KWNA 4FO9A 2HYED 4H9DA 2BAYA 4GNGA 1V87A 4AYCB 1VYXA 2KFTA 2KIZA 2LN0A 4WZ3B 5TDRA 3DDTA 2LGVA 1JOCA 1E4UA 4FIPA 4OGEA 1HYJA 4I7BA 3O36A 5D1LB 1WESA 3M7KA 4BBQA 2KR4A 1CHCA 3FANA 5K3QA 2ECTA 4CA1A 3LQJA 4YADA 3U5NA 4S3OB 1WEUA 1LDKC 3MHHA 2K1JA 5I3LA 3L1ZB 2VPDA 1X4JA 2LQ6A 2M3HA 4F1PA 1JM7B 2E6RA 2ECJA 1T1HA 2I50A 3ZNIA 5DKAA 2F6JA 2MD7B 5LKXA 1WGMA 5TBNA 5LCWB 4QQ4A 2YYRA 2YREA 2M1RA 3HCUA 5G0FA 4PTBA 2EXUA 4W4UA 1RMDA 5J3XA 3FM8C 2KWJA 2CT2A 4ZDTA 3ZVYA 5H1TA 3FJUB 2C2LA 2XOZA 4X3GA 1VFYA 5SVIA 4LK9A 2L0BA 2M13A 4XI1A 2MUMA 4ZQLA 2RR4A 4PPEA 2VPGA 3FEHA 5TDWA 3VK6A 2CONA 2H0DB 2L80A 2DX8A 1MBMA 2G45A 2H0DA 4S3OC 4YABA 2YT5A 5SVIB 3O33A 3O70A 3LVRE 3ZTGA 2LGGA 2D8SA 3RTRB 4B7YC 1IYMA 1Z6UA 3NG2A 2FFWA 2LGLA 2YUCA 2F42A 3EB5A 3KQIA 2MD8C 4V3KC 3O47A 5G04B 3N9NA 5LKUA 5B76A 2L5UA 3DPLR 5JG6A 2JMDA 5LKZA 2B0OE 4P5OB 3PLWA 2NAAA 3T7LA 5B75A 2E61A 2D8UA 5FB0A 2XEUA 3N9LA 1WFKA 3LJUX 3LRQA 2C2VS 2MA5A 4R7EA 3H7HA 5TABA 1VD4A 2LAUA 3PUQA 5KH9A 4YBSA 5FEYA 4C9ZA 4QF2A 2YQLA 1G25A 2VP7A 1FP0A 2XOYA 2CSVA 4AP4A 4GB0A 5G05B 4GNDA 1WILA 2YURA 3L11A 3FL2A 4YC9A 5KH3A
chains in the Genus database with same CATH topology
1Z2QA 4GNFA 1X4IA 3N9PA 2XB1A 1WIMA 4FK5A 1N87A 5H1UA 4L58A 2FSAA 3KV6A 4LKAA 4NN2A 4N3WA 2QIZA 3U5OA 2ECIA 2YU4A 4YATA 4BHWA 1Z60A 5TRBA 1WEMA 1FBVA 3C6WA 2KYUA 2EA6A 2KGIA 1JM7A 3V43A 1WENA 4AVXA 3KV5A 3ZVZB 1F62A 4WZ0A 2M85A 3M62A 5H9MA 2KREA 4FJCA 1BORA 5B79A 4UP0A 2JRJA 2EODA 2E6SA 2VJFA 4WZ2A 3GV4A 4YBTA 3SHBA 2YHNA 2JMIA 1WEOA 3ZYQA 2LRIC 4CCGX 5DINA 4N4FA 4AUQB 1LDJB 2JMJA 3HCTA 3ZPV1 4V3LC 2CSYA 5B77A 4UP5A 4B86C 3C5KA 4I7DA 2PUYA 5AIUA 2LXPC 2HDPA 1ZBDB 3SOUA 4GNEA 5LKTA 2VNFA 3DQVR 3U5PA 2MNYA 2LGKA 3U5MA 1MM3A 4Q6FA 1MM2A 4IC2A 5C13A 3ASLA 3ZPVE 3I2DA 5D1MB 5D1KB 4A4BA 4LJNA 2IDAA 2MT5A 4LLBA 3N9QA 4L7XA 5KH7A 3L1XA 2Y43A 3SOXA 2MNZA 4AYCA 1HYIA 2Y1MA 3M99A 4A0CD 3LQHA 1WEEA 2YW8A 4LADB 3MHSA 2K4DA 2L75A 2KGGA 3EB6A 3KNVA 3IHPA 2G43A 2QJ0A 2F6NA 1WEVA 2EGPA 3QZVA 2VPBA 2MIQA 2YHOA 4R2YA 2ECVA 2LXHC 2K17A 2LDRA 5EYAF 5B78A 2YSJA 5B8DA 2KWKA 4A49A 1X4UA 3O7AA 4TKPB 2OXQC 5AITA 1DVPA 3LQIA 2G6QA 2ECNA 2VJEA 3GL6A 2KU3A 2VJEB 4F52B 3M63A 4QF3A 1XWHA 2FUUA 1WE9A 2QICA 3HCSA 4MSXA 2ECWA 3RPGB 3O35A 2CSZA 5H1VA 2AN6A 3N9MA 4O64A 4UI9B 3O37A 2MA6A 3T6RA 1K2FA 4IC3A 5C11A 2PNXA 2YQMA 1WEPA 2L43A 3RPGC 2RSDA 3O34A 4R8PK 4A4CA 4YBMA 3SOWA 3PURA 2ECGA 2CKLA 2ZETC 1WEWA 2K16A 5FERA 2KE1A 5FB1A 4ZUXU 2VPEA 4I7CA 2VJFB 3PHDA 3N9OA 2UZGA 1U6GB 4MVTA 4WA6A 1WEQA 2RI7A 2LV9A 3HTKC 2Y1NA 2FUIA 2CKLB 4YAXA 2M6MA 2KWOA 2YSMA 2KWNA 4FO9A 2HYED 2BAYA 4GNGA 4AYCB 1V87A 1VYXA 2KFTA 2KIZA 2LN0A 4WZ3B 5TDRA 2LGVA 1JOCA 1E4UA 4FIPA 1HYJA 4I7BA 3O36A 5D1LB 1WESA 4BBQA 2KR4A 1CHCA 2ECTA 4CA1A 3LQJA 4YADA 3U5NA 4S3OB 1WEUA 1LDKC 3MHHA 2K1JA 5I3LA 3L1ZB 2VPDA 1X4JA 2LQ6A 2M3HA 1JM7B 2E6RA 2ECJA 1T1HA 2I50A 3ZNIA 5DKAA 2F6JA 2MD7B 5LKXA 1WGMA 5TBNA 5LCWB 2YYRA 2YREA 5G0FA 2M1RA 3HCUA 4PTBA 4W4UA 1RMDA 5J3XA 2KWJA 2CT2A 4ZDTA 3ZVYA 5H1TA 2C2LA 4X3GA 1VFYA 4LK9A 2L0BA 4XI1A 2MUMA 4ZQLA 4PPEA 2VPGA 5TDWA 3VK6A 2H0DB 2L80A 2DX8A 2G45A 2H0DA 4S3OC 4YABA 2YT5A 3O33A 3O70A 3ZTGA 2LGGA 2D8SA 3RTRB 4B7YC 1IYMA 1Z6UA 3NG2A 2MD8C 2LGLA 2YUCA 2F42A 3EB5A 3KQIA 4V3KC 5G04B 3N9NA 5LKUA 5B76A 2L5UA 3DPLR 5JG6A 2JMDA 5LKZA 4P5OB 2NAAA 3T7LA 5B75A 5FB0A 2XEUA 3N9LA 1WFKA 3LRQA 2C2VS 2MA5A 4R7EA 5TABA 1VD4A 3PUQA 5KH9A 4YBSA 5FEYA 4C9ZA 4QF2A 2YQLA 1G25A 2VP7A 1FP0A 4AP4A 4GB0A 5G05B 4GNDA 1WILA 2YURA 3L11A 3FL2A 4YC9A 5KH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2Q A;  4GNF A;  1X4I A;  3N9P A;  2XB1 A;  1WIM A;  4FK5 A;  1N87 A;  5H1U A;  4L58 A;  2FSA A;  3KV6 A;  4LKA A;  4NN2 A;  4N3W A;  2QIZ A;  3U5O A;  2ECI A;  2YU4 A;  4YAT A;  4BHW A;  1Z60 A;  5TRB A;  1WEM A;  1FBV A;  3C6W A;  2KYU A;  2EA6 A;  2KGI A;  1JM7 A;  3V43 A;  1WEN A;  4AVX A;  3KV5 A;  3ZVZ B;  1F62 A;  4WZ0 A;  2M85 A;  3M62 A;  5H9M A;  2KRE A;  4FJC A;  1BOR A;  5B79 A;  4UP0 A;  2JRJ A;  2EOD A;  2E6S A;  2VJF A;  4WZ2 A;  3GV4 A;  4YBT A;  3SHB A;  2YHN A;  2JMI A;  1WEO A;  3ZYQ A;  2LRI C;  4CCG X;  5DIN A;  4N4F A;  4AUQ B;  1LDJ B;  2JMJ A;  3HCT A;  3ZPV 1;  4V3L C;  2CSY A;  5B77 A;  4UP5 A;  4B86 C;  3C5K A;  4I7D A;  2PUY A;  5AIU A;  2LXP C;  2HDP A;  1ZBD B;  3SOU A;  4GNE A;  5LKT A;  2VNF A;  3DQV R;  3U5P A;  2MNY A;  2LGK A;  3U5M A;  1MM3 A;  4Q6F A;  1MM2 A;  4IC2 A;  5C13 A;  3ASL A;  3ZPV E;  3I2D A;  5D1M B;  5D1K B;  4A4B A;  4LJN A;  2IDA A;  2MT5 A;  4LLB A;  3N9Q A;  4L7X A;  5KH7 A;  3L1X A;  2Y43 A;  3SOX A;  2MNZ A;  4AYC A;  1HYI A;  2Y1M A;  3M99 A;  4A0C D;  3LQH A;  1WEE A;  2YW8 A;  4LAD B;  3MHS A;  2K4D A;  2L75 A;  2KGG A;  3EB6 A;  3KNV A;  3IHP A;  2G43 A;  2QJ0 A;  2F6N A;  1WEV A;  2EGP A;  3QZV A;  2VPB A;  2MIQ A;  2YHO A;  4R2Y A;  2ECV A;  2LXH C;  2K17 A;  2LDR A;  5EYA F;  5B78 A;  2YSJ A;  5B8D A;  2KWK A;  4A49 A;  1X4U A;  3O7A A;  4TKP B;  2OXQ C;  5AIT A;  1DVP A;  3LQI A;  2G6Q A;  2ECN A;  2VJE A;  3GL6 A;  2KU3 A;  2VJE B;  4F52 B;  3M63 A;  4QF3 A;  1XWH A;  2FUU A;  1WE9 A;  2QIC A;  3HCS A;  4MSX A;  2ECW A;  3RPG B;  3O35 A;  2CSZ A;  5H1V A;  2AN6 A;  3N9M A;  4O64 A;  4UI9 B;  3O37 A;  2MA6 A;  3T6R A;  1K2F A;  4IC3 A;  5C11 A;  2PNX A;  2YQM A;  1WEP A;  2L43 A;  3RPG C;  2RSD A;  3O34 A;  4R8P K;  4A4C A;  4YBM A;  3SOW A;  3PUR A;  2ECG A;  2CKL A;  2ZET C;  1WEW A;  2K16 A;  5FER A;  2KE1 A;  5FB1 A;  4ZUX U;  2VPE A;  4I7C A;  2VJF B;  3PHD A;  3N9O A;  2UZG A;  1U6G B;  4MVT A;  4WA6 A;  1WEQ A;  2RI7 A;  2LV9 A;  3HTK C;  2Y1N A;  2FUI A;  2CKL B;  4YAX A;  2M6M A;  2KWO A;  2YSM A;  2KWN A;  4FO9 A;  2HYE D;  2BAY A;  4GNG A;  4AYC B;  1V87 A;  1VYX A;  2KFT A;  2KIZ A;  2LN0 A;  4WZ3 B;  5TDR A;  2LGV A;  1JOC A;  1E4U A;  4FIP A;  1HYJ A;  4I7B A;  3O36 A;  5D1L B;  1WES A;  4BBQ A;  2KR4 A;  1CHC A;  2ECT A;  4CA1 A;  3LQJ A;  4YAD A;  3U5N A;  4S3O B;  1WEU A;  1LDK C;  3MHH A;  2K1J A;  5I3L A;  3L1Z B;  2VPD A;  1X4J A;  2LQ6 A;  2M3H A;  1JM7 B;  2E6R A;  2ECJ A;  1T1H A;  2I50 A;  3ZNI A;  5DKA A;  2F6J A;  2MD7 B;  5LKX A;  1WGM A;  5TBN A;  5LCW B;  2YYR A;  2YRE A;  5G0F A;  2M1R A;  3HCU A;  4PTB A;  4W4U A;  1RMD A;  5J3X A;  2KWJ A;  2CT2 A;  4ZDT A;  3ZVY A;  5H1T A;  2C2L A;  4X3G A;  1VFY A;  4LK9 A;  2L0B A;  4XI1 A;  2MUM A;  4ZQL A;  4PPE A;  2VPG A;  5TDW A;  3VK6 A;  2H0D B;  2L80 A;  2DX8 A;  2G45 A;  2H0D A;  4S3O C;  4YAB A;  2YT5 A;  3O33 A;  3O70 A;  3ZTG A;  2LGG A;  2D8S A;  3RTR B;  4B7Y C;  1IYM A;  1Z6U A;  3NG2 A;  2MD8 C;  2LGL A;  2YUC A;  2F42 A;  3EB5 A;  3KQI A;  4V3K C;  5G04 B;  3N9N A;  5LKU A;  5B76 A;  2L5U A;  3DPL R;  5JG6 A;  2JMD A;  5LKZ A;  4P5O B;  2NAA A;  3T7L A;  5B75 A;  5FB0 A;  2XEU A;  3N9L A;  1WFK A;  3LRQ A;  2C2V S;  2MA5 A;  4R7E A;  5TAB A;  1VD4 A;  3PUQ A;  5KH9 A;  4YBS A;  5FEY A;  4C9Z A;  4QF2 A;  2YQL A;  1G25 A;  2VP7 A;  1FP0 A;  4AP4 A;  4GB0 A;  5G05 B;  4GND A;  1WIL A;  2YUR A;  3L11 A;  3FL2 A;  4YC9 A;  5KH3 A; 
#chains in the Genus database with same CATH topology
 1Z2Q A;  2MKE A;  4GNF A;  1X4I A;  3N9P A;  2XB1 A;  1WIM A;  4OGC A;  3FAO A;  4FK5 A;  1N87 A;  5H1U A;  4L58 A;  2FSA A;  3KV6 A;  2FD4 A;  4LKA A;  4NN2 A;  4N3W A;  2QIZ A;  3U5O A;  2ECI A;  2YU4 A;  4YAT A;  4BHW A;  1Z60 A;  5TRB A;  1WEM A;  1FBV A;  3C6W A;  2EGM A;  2KYU A;  2EA6 A;  2KGI A;  1JM7 A;  3V43 A;  2P57 A;  1WEN A;  4AVX A;  3T9K A;  3KV5 A;  2OWA A;  3ZVZ B;  1F62 A;  4WZ0 A;  2M85 A;  3M62 A;  5H9M A;  2KRE A;  4FJC A;  1BOR A;  5B79 A;  4UP0 A;  2JRJ A;  2YVR A;  2EOD A;  2L7P A;  2E6S A;  2VJF A;  4WZ2 A;  3GV4 A;  4YBT A;  3SHB A;  2YHN A;  3Q1D A;  2JMI A;  1WEO A;  3ZYQ A;  2LRI C;  4CCG X;  3E2D A;  2JM3 A;  5DIN A;  4N4F A;  4AUQ B;  1LDJ B;  2JMJ A;  3HCT A;  3ZPV 1;  5SVY A;  4V3L C;  2CSY A;  5B77 A;  4UP5 A;  4B86 C;  4Z0R A;  3C5K A;  4I7D A;  2PUY A;  5AIU A;  4Z0O A;  2LXP C;  2HDP A;  3DWD A;  1ZBD B;  3SOU A;  4GNE A;  5LKT A;  5SVX A;  2VNF A;  3DQV R;  3U5P A;  2MNY A;  2LGK A;  3U5M A;  1MM3 A;  4Q6F A;  1MM2 A;  4IC2 A;  5C13 A;  3ASL A;  3ZPV E;  2DSM A;  3I2D A;  5D1M B;  2KKY A;  5D1K B;  4A4B A;  4LJN A;  2IDA A;  2JUN A;  2MT5 A;  3N9Q A;  4LLB A;  4L7X A;  5KH7 A;  3L1X A;  2Y43 A;  3SOX A;  2MNZ A;  4AYC A;  1HYI A;  2Y1M A;  3M99 A;  4A0C D;  3LQH A;  1WEE A;  4O62 A;  2YW8 A;  4LAD B;  3MHS A;  2K4D A;  2L75 A;  2KGG A;  3EB6 A;  3KNV A;  3IHP A;  2G43 A;  2QJ0 A;  2DJA A;  2F6N A;  1WEV A;  2EGP A;  3QZV A;  2VPB A;  2MIQ A;  2YHO A;  4R2Y A;  2ECV A;  2LXH C;  2K17 A;  2XOC A;  2LDR A;  5EYA F;  5B78 A;  2YSJ A;  5B8D A;  2KWK A;  4A49 A;  1X4U A;  3O7A A;  4TKP B;  2OXQ C;  5AIT A;  1DVP A;  3LQI A;  2G6Q A;  2ECN A;  2VJE A;  3GL6 A;  2KU3 A;  2VJE B;  4F52 B;  3M63 A;  4QF3 A;  1XWH A;  2FUU A;  1WE9 A;  2QIC A;  3HCS A;  4MSX A;  2ECW A;  3RPG B;  3O35 A;  3SUB A;  2CSZ A;  5H1V A;  1DCQ A;  2AN6 A;  3N9M A;  4O64 A;  4UI9 B;  3O37 A;  2MA6 A;  3LDY A;  2IQJ A;  3T6R A;  1K2F A;  4IC3 A;  2KKX A;  5C11 A;  2PNX A;  2YQM A;  1WEP A;  2L43 A;  3RPG C;  2RSD A;  3O34 A;  4R8P K;  4A4C A;  4YBM A;  3SOW A;  3PUR A;  2ECG A;  2CKL A;  2ZET C;  1WEW A;  2K16 A;  3JUE A;  5FER A;  2KE1 A;  3MDB C;  5FB1 A;  4ZUX U;  2VPE A;  4I7C A;  2CRR A;  2VJF B;  3PHD A;  3N9O A;  2UZG A;  1U6G B;  4MVT A;  4WA6 A;  3LVQ E;  2CRW A;  1WEQ A;  3KDE C;  2RI7 A;  2LV9 A;  3HTK C;  2Y1N A;  2FUI A;  2CKL B;  4YAX A;  2M6M A;  2KWO A;  2XP0 A;  2YSM A;  2KWN A;  4FO9 A;  2HYE D;  4H9D A;  2BAY A;  4GNG A;  1V87 A;  4AYC B;  1VYX A;  2KFT A;  2KIZ A;  2LN0 A;  4WZ3 B;  5TDR A;  3DDT A;  2LGV A;  1JOC A;  1E4U A;  4FIP A;  4OGE A;  1HYJ A;  4I7B A;  3O36 A;  5D1L B;  1WES A;  3M7K A;  4BBQ A;  2KR4 A;  1CHC A;  3FAN A;  5K3Q A;  2ECT A;  4CA1 A;  3LQJ A;  4YAD A;  3U5N A;  4S3O B;  1WEU A;  1LDK C;  3MHH A;  2K1J A;  5I3L A;  3L1Z B;  2VPD A;  1X4J A;  2LQ6 A;  2M3H A;  4F1P A;  1JM7 B;  2E6R A;  2ECJ A;  1T1H A;  2I50 A;  3ZNI A;  5DKA A;  2F6J A;  2MD7 B;  5LKX A;  1WGM A;  5TBN A;  5LCW B;  4QQ4 A;  2YYR A;  2YRE A;  2M1R A;  3HCU A;  5G0F A;  4PTB A;  2EXU A;  4W4U A;  1RMD A;  5J3X A;  3FM8 C;  2KWJ A;  2CT2 A;  4ZDT A;  3ZVY A;  5H1T A;  3FJU B;  2C2L A;  2XOZ A;  4X3G A;  1VFY A;  5SVI A;  4LK9 A;  2L0B A;  2M13 A;  4XI1 A;  2MUM A;  4ZQL A;  2RR4 A;  4PPE A;  2VPG A;  3FEH A;  5TDW A;  3VK6 A;  2CON A;  2H0D B;  2L80 A;  2DX8 A;  1MBM A;  2G45 A;  2H0D A;  4S3O C;  4YAB A;  2YT5 A;  5SVI B;  3O33 A;  3O70 A;  3LVR E;  3ZTG A;  2LGG A;  2D8S A;  3RTR B;  4B7Y C;  1IYM A;  1Z6U A;  3NG2 A;  2FFW A;  2LGL A;  2YUC A;  2F42 A;  3EB5 A;  3KQI A;  2MD8 C;  4V3K C;  3O47 A;  5G04 B;  3N9N A;  5LKU A;  5B76 A;  2L5U A;  3DPL R;  5JG6 A;  2JMD A;  5LKZ A;  2B0O E;  4P5O B;  3PLW A;  2NAA A;  3T7L A;  5B75 A;  2E61 A;  2D8U A;  5FB0 A;  2XEU A;  3N9L A;  1WFK A;  3LJU X;  3LRQ A;  2C2V S;  2MA5 A;  4R7E A;  3H7H A;  5TAB A;  1VD4 A;  2LAU A;  3PUQ A;  5KH9 A;  4YBS A;  5FEY A;  4C9Z A;  4QF2 A;  2YQL A;  1G25 A;  2VP7 A;  1FP0 A;  2XOY A;  2CSV A;  4AP4 A;  4GB0 A;  5G05 B;  4GND A;  1WIL A;  2YUR A;  3L11 A;  3FL2 A;  4YC9 A;  5KH3 A; 
#chains in the Genus database with same CATH homology
 1Z2Q A;  4GNF A;  1X4I A;  3N9P A;  2XB1 A;  1WIM A;  4FK5 A;  1N87 A;  5H1U A;  4L58 A;  2FSA A;  3KV6 A;  4LKA A;  4NN2 A;  4N3W A;  2QIZ A;  3U5O A;  2ECI A;  2YU4 A;  4YAT A;  4BHW A;  1Z60 A;  5TRB A;  1WEM A;  1FBV A;  3C6W A;  2KYU A;  2EA6 A;  2KGI A;  1JM7 A;  3V43 A;  1WEN A;  4AVX A;  3KV5 A;  3ZVZ B;  1F62 A;  4WZ0 A;  2M85 A;  3M62 A;  5H9M A;  2KRE A;  4FJC A;  1BOR A;  5B79 A;  4UP0 A;  2JRJ A;  2EOD A;  2E6S A;  2VJF A;  4WZ2 A;  3GV4 A;  4YBT A;  3SHB A;  2YHN A;  2JMI A;  1WEO A;  3ZYQ A;  2LRI C;  4CCG X;  5DIN A;  4N4F A;  4AUQ B;  1LDJ B;  2JMJ A;  3HCT A;  3ZPV 1;  4V3L C;  2CSY A;  5B77 A;  4UP5 A;  4B86 C;  3C5K A;  4I7D A;  2PUY A;  5AIU A;  2LXP C;  2HDP A;  1ZBD B;  3SOU A;  4GNE A;  5LKT A;  2VNF A;  3DQV R;  3U5P A;  2MNY A;  2LGK A;  3U5M A;  1MM3 A;  4Q6F A;  1MM2 A;  4IC2 A;  5C13 A;  3ASL A;  3ZPV E;  3I2D A;  5D1M B;  5D1K B;  4A4B A;  4LJN A;  2IDA A;  2MT5 A;  4LLB A;  3N9Q A;  4L7X A;  5KH7 A;  3L1X A;  2Y43 A;  3SOX A;  2MNZ A;  4AYC A;  1HYI A;  2Y1M A;  3M99 A;  4A0C D;  3LQH A;  1WEE A;  2YW8 A;  4LAD B;  3MHS A;  2K4D A;  2L75 A;  2KGG A;  3EB6 A;  3KNV A;  3IHP A;  2G43 A;  2QJ0 A;  2F6N A;  1WEV A;  2EGP A;  3QZV A;  2VPB A;  2MIQ A;  2YHO A;  4R2Y A;  2ECV A;  2LXH C;  2K17 A;  2LDR A;  5EYA F;  5B78 A;  2YSJ A;  5B8D A;  2KWK A;  4A49 A;  1X4U A;  3O7A A;  4TKP B;  2OXQ C;  5AIT A;  1DVP A;  3LQI A;  2G6Q A;  2ECN A;  2VJE A;  3GL6 A;  2KU3 A;  2VJE B;  4F52 B;  3M63 A;  4QF3 A;  1XWH A;  2FUU A;  1WE9 A;  2QIC A;  3HCS A;  4MSX A;  2ECW A;  3RPG B;  3O35 A;  2CSZ A;  5H1V A;  2AN6 A;  3N9M A;  4O64 A;  4UI9 B;  3O37 A;  2MA6 A;  3T6R A;  1K2F A;  4IC3 A;  5C11 A;  2PNX A;  2YQM A;  1WEP A;  2L43 A;  3RPG C;  2RSD A;  3O34 A;  4R8P K;  4A4C A;  4YBM A;  3SOW A;  3PUR A;  2ECG A;  2CKL A;  2ZET C;  1WEW A;  2K16 A;  5FER A;  2KE1 A;  5FB1 A;  4ZUX U;  2VPE A;  4I7C A;  2VJF B;  3PHD A;  3N9O A;  2UZG A;  1U6G B;  4MVT A;  4WA6 A;  1WEQ A;  2RI7 A;  2LV9 A;  3HTK C;  2Y1N A;  2FUI A;  2CKL B;  4YAX A;  2M6M A;  2KWO A;  2YSM A;  2KWN A;  4FO9 A;  2HYE D;  2BAY A;  4GNG A;  4AYC B;  1V87 A;  1VYX A;  2KFT A;  2KIZ A;  2LN0 A;  4WZ3 B;  5TDR A;  2LGV A;  1JOC A;  1E4U A;  4FIP A;  1HYJ A;  4I7B A;  3O36 A;  5D1L B;  1WES A;  4BBQ A;  2KR4 A;  1CHC A;  2ECT A;  4CA1 A;  3LQJ A;  4YAD A;  3U5N A;  4S3O B;  1WEU A;  1LDK C;  3MHH A;  2K1J A;  5I3L A;  3L1Z B;  2VPD A;  1X4J A;  2LQ6 A;  2M3H A;  1JM7 B;  2E6R A;  2ECJ A;  1T1H A;  2I50 A;  3ZNI A;  5DKA A;  2F6J A;  2MD7 B;  5LKX A;  1WGM A;  5TBN A;  5LCW B;  2YYR A;  2YRE A;  5G0F A;  2M1R A;  3HCU A;  4PTB A;  4W4U A;  1RMD A;  5J3X A;  2KWJ A;  2CT2 A;  4ZDT A;  3ZVY A;  5H1T A;  2C2L A;  4X3G A;  1VFY A;  4LK9 A;  2L0B A;  4XI1 A;  2MUM A;  4ZQL A;  4PPE A;  2VPG A;  5TDW A;  3VK6 A;  2H0D B;  2L80 A;  2DX8 A;  2G45 A;  2H0D A;  4S3O C;  4YAB A;  2YT5 A;  3O33 A;  3O70 A;  3ZTG A;  2LGG A;  2D8S A;  3RTR B;  4B7Y C;  1IYM A;  1Z6U A;  3NG2 A;  2MD8 C;  2LGL A;  2YUC A;  2F42 A;  3EB5 A;  3KQI A;  4V3K C;  5G04 B;  3N9N A;  5LKU A;  5B76 A;  2L5U A;  3DPL R;  5JG6 A;  2JMD A;  5LKZ A;  4P5O B;  2NAA A;  3T7L A;  5B75 A;  5FB0 A;  2XEU A;  3N9L A;  1WFK A;  3LRQ A;  2C2V S;  2MA5 A;  4R7E A;  5TAB A;  1VD4 A;  3PUQ A;  5KH9 A;  4YBS A;  5FEY A;  4C9Z A;  4QF2 A;  2YQL A;  1G25 A;  2VP7 A;  1FP0 A;  4AP4 A;  4GB0 A;  5G05 B;  4GND A;  1WIL A;  2YUR A;  3L11 A;  3FL2 A;  4YC9 A;  5KH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...