4B86C

Crystal structure of the msl1-msl2 complex (3.5a)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 115
sequence length 115
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b86C00
4GNDA 2E6RA 4FIPA 1ZBDB 5TABA 2H0DA 2LGLA 2YYRA 2YU4A 2LXPC 2QIZA 1U6GB 3LQIA 4MSXA 4AUQB 3ZVYA 2C2LA 1WILA 2M3HA 3HCSA 2CSYA 4GNEA 1X4UA 4LJNA 4X3GA 5LCWB 2YHOA 4R2YA 3ZVZB 5KH7A 2MIQA 5B8DA 5H9MA 3N9LA 2XEUA 5B78A 2HYED 4L7XA 4FO9A 4V3KC 4CCGX 5H1TA 4YADA 2KYUA 3L1ZB 1LDKC 1WIMA 4F52B 1MM2A 2VPEA 2Y1MA 4YBTA 2VPBA 5B79A 5FERA 3O36A 1DVPA 4R8PK 3ASLA 3SOWA 2LGGA 2YW8A 2VJEB 1JM7A 2HDPA 3HTKC 2QJ0A 4AP4A 2KU3A 2EA6A 2K4DA 2G6QA 2VPDA 3DPLR 2IDAA 2ZETC 5I3LA 1WEVA 4PPEA 2RSDA 1XWHA 2F6NA 5FB0A 4B86C 4AYCB 3SOUA 2D8SA 4ZDTA 1JOCA 1E4UA 3IHPA 2E6SA 4LK9A 4QF3A 1VFYA 3MHHA 2QICA 3O33A 4O64A 3O7AA 2KFTA 3U5MA 2KGIA 3U5PA 4UP0A 5JG6A 2FUIA 3ZTGA 2ECJA 2MT5A 2MNZA 4WZ0A 3LQJA 3C5KA 3N9NA 3L11A 3HCTA 2FSAA 5D1LB 1T1HA 5B77A 2OXQC 5TDRA 2KWJA 2H0DB 4XI1A 1WE9A 4S3OC 1WEQA 4N3WA 2CKLA 4UI9B 2JMDA 2CKLB 1K2FA 5TDWA 3FL2A 4YBMA 3RTRB 1WEUA 2K16A 2LRIC 3KV5A 1CHCA 2KIZA 2LN0A 4MVTA 2LV9A 2C2VS 2ECWA 1BORA 4WZ3B 2KE1A 2AN6A 2M1RA 1N87A 2EODA 1WFKA 3HCUA 3EB5A 2BAYA 4YATA 1Z60A 2YHNA 3N9OA 2L80A 3ZNIA 2G43A 2M85A 4YAXA 5FB1A 4ZUXU 5TRBA 4UP5A 4WA6A 3SOXA 1VD4A 2JMIA 4BBQA 4S3OB 2YURA 1F62A 2LGKA 2LGVA 2Y43A 1WEPA 2KWNA 3DQVR 2K17A 3M63A 3PHDA 4PTBA 5EYAF 5G0FA 5J3XA 5D1KB 4W4UA 2YQMA 3O34A 1JM7B 2MNYA 4R7EA 4IC3A 1WENA 3U5NA 2L0BA 2MUMA 4WZ2A 2L43A 2VNFA 3GL6A 1WEEA 2CSZA 3T7LA 4C9ZA 4NN2A 4IC2A 3V43A 2MD8C 3ZPV1 2L75A 2F6JA 2EGPA 1V87A 4CA1A 3NG2A 2PNXA 2YSJA 1HYJA 2MA5A 3VK6A 5H1UA 2YUCA 5LKTA 3GV4A 2ECVA 3M99A 4YABA 2VJFA 4A4BA 2VP7A 2KREA 5B76A 4I7CA 2VJFB 4GNGA 2CT2A 5DINA 2JRJA 5G04B 2Y1NA 3C6WA 5DKAA 3PUQA 3RPGB 1FBVA 4LADB 1IYMA 3O70A 1RMDA 4AVXA 5KH3A 1X4JA 1WESA 2YT5A 2UZGA 2YQLA 2FUUA 5AIUA 4I7BA 5G05B 3U5OA 2K1JA 3KV6A 3EB6A 3N9QA 3I2DA 4YBSA 4LKAA 3N9PA 3M62A 3O35A 2YSMA 5TBNA 3SHBA 2LDRA 4A4CA 1WEOA 3ZPVE 5LKXA 3PURA 3O37A 5FEYA 2LQ6A 1G25A 3T6RA 2I50A 2ECGA 3KNVA 4P5OB 4GB0A 4N4FA 1WGMA 4V3LC 1LDJB 2M6MA 2G45A 4I7DA 2F42A 4GNFA 5KH9A 5LKZA 4L58A 1WEWA 4FJCA 4A0CD 4LLBA 4A49A 3LQHA 2KGGA 2VPGA 5AITA 5LKUA 1HYIA 1WEMA 2VJEA 2MD7B 3QZVA 2L5UA 2NAAA 3RPGC 5C13A 2MA6A 4ZQLA 2KWKA 5D1MB 2LXHC 2ECNA 2XB1A 3N9MA 4AYCA 2ECIA 2PUYA 3KQIA 2DX8A 2KR4A 1Z6UA 4B7YC 3ZYQA 1VYXA 2ECTA 4YC9A 1FP0A 4TKPB 4BHWA 1Z2QA 2YREA 2RI7A 5C11A 2KWOA 4FK5A 4QF2A 3MHSA 5B75A 4Q6FA 3L1XA 1X4IA 2JMJA 3LRQA 1MM3A 5H1VA
chains in the Genus database with same CATH superfamily
4GNDA 2E6RA 4FIPA 1ZBDB 5TABA 2H0DA 2LGLA 2YYRA 2YU4A 3LVRE 2LXPC 2QIZA 1U6GB 3LQIA 4MSXA 5SVYA 4AUQB 3ZVYA 3SUBA 2C2LA 1WILA 2M3HA 3HCSA 2CSYA 4GNEA 3LJUX 1X4UA 3DWDA 4LJNA 4X3GA 5LCWB 2YHOA 4R2YA 3ZVZB 5KH7A 2MIQA 5B8DA 5H9MA 3N9LA 2XEUA 2XOYA 5B78A 2HYED 4L7XA 2MKEA 4FO9A 4V3KC 2KKXA 4CCGX 5H1TA 4YADA 2KYUA 2EXUA 3L1ZB 1LDKC 1WIMA 4F52B 1MM2A 5SVIB 2VPEA 2Y1MA 3JUEA 4YBTA 2VPBA 5B79A 2IQJA 5FERA 3FAOA 2LAUA 3O36A 1DVPA 4R8PK 3ASLA 3E2DA 3SOWA 2LGGA 2YW8A 2VJEB 1JM7A 2HDPA 3HTKC 2QJ0A 4AP4A 2KU3A 2EA6A 2K4DA 2G6QA 2VPDA 3DPLR 2IDAA 2ZETC 5I3LA 1WEVA 4PPEA 2RSDA 1XWHA 2F6NA 5FB0A 2B0OE 4B86C 4AYCB 3SOUA 2D8SA 4ZDTA 1JOCA 3MDBC 1E4UA 3IHPA 2E6SA 4LK9A 4QF3A 1VFYA 3MHHA 2QICA 3O33A 2D8UA 4O64A 4O62A 3O7AA 2KFTA 3U5MA 2KGIA 3M7KA 3U5PA 4UP0A 5JG6A 2FUIA 3ZTGA 2ECJA 2MT5A 2MNZA 4WZ0A 3LQJA 2FD4A 3C5KA 3N9NA 2E61A 3L11A 3HCTA 2FSAA 5D1LB 1T1HA 5B77A 2OXQC 5TDRA 2KWJA 2H0DB 4XI1A 3FM8C 1WE9A 4S3OC 1WEQA 2L7PA 4N3WA 2CKLA 4UI9B 2YVRA 2JMDA 2CKLB 1K2FA 5TDWA 3FL2A 4YBMA 4H9DA 3RTRB 1WEUA 2K16A 2LRIC 3KV5A 1CHCA 2KIZA 2LN0A 4MVTA 3LVQE 2LV9A 2C2VS 2ECWA 1BORA 4WZ3B 2KE1A 2AN6A 2M1RA 1N87A 2EODA 1WFKA 3HCUA 3EB5A 2BAYA 4YATA 1Z60A 2YHNA 3N9OA 2L80A 3ZNIA 2G43A 2M85A 4YAXA 5FB1A 3DDTA 4ZUXU 5TRBA 4UP5A 3FEHA 4WA6A 3SOXA 1VD4A 2JMIA 2RR4A 4BBQA 4S3OB 2YURA 1F62A 4Z0OA 2LGKA 2LGVA 2Y43A 1WEPA 2KWNA 3DQVR 4OGEA 2K17A 3M63A 3PHDA 4PTBA 2XOZA 5EYAF 5G0FA 5J3XA 5D1KB 3PLWA 3T9KA 4W4UA 2YQMA 2CRRA 3O34A 1JM7B 2MNYA 4R7EA 4IC3A 1WENA 3U5NA 2L0BA 2MUMA 4WZ2A 2L43A 2VNFA 3GL6A 1WEEA 2CSZA 3T7LA 4C9ZA 4NN2A 2CSVA 4QQ4A 4IC2A 3V43A 2MD8C 3ZPV1 2L75A 2F6JA 2EGPA 1V87A 4CA1A 3NG2A 2PNXA 2YSJA 1HYJA 2DJAA 2MA5A 3VK6A 5H1UA 2YUCA 5SVXA 2FFWA 3FJUB 5LKTA 3GV4A 3KDEC 2ECVA 3M99A 4YABA 2VJFA 4A4BA 2VP7A 2KREA 1MBMA 5B76A 4I7CA 2VJFB 4GNGA 2CT2A 5DINA 2JRJA 5G04B 3FANA 2Y1NA 3C6WA 5DKAA 3PUQA 3RPGB 1FBVA 4LADB 1IYMA 2JUNA 2M13A 3O70A 1RMDA 4AVXA 5KH3A 3LDYA 1X4JA 1WESA 2YT5A 2UZGA 2YQLA 2FUUA 5AIUA 4I7BA 5G05B 3U5OA 2K1JA 3KV6A 3EB6A 3N9QA 3I2DA 4YBSA 4LKAA 3N9PA 3M62A 3O35A 2YSMA 5TBNA 3SHBA 2LDRA 4A4CA 1WEOA 3ZPVE 5LKXA 3PURA 3O37A 5FEYA 2LQ6A 1G25A 3T6RA 2I50A 2ECGA 3KNVA 4P5OB 2XOCA 2DSMA 4GB0A 4N4FA 1WGMA 4V3LC 1LDJB 2M6MA 2G45A 4I7DA 2F42A 4GNFA 5SVIA 5KH9A 5LKZA 4L58A 1WEWA 4FJCA 5K3QA 3O47A 4A0CD 4LLBA 4A49A 3LQHA 2KGGA 2VPGA 1DCQA 3H7HA 5AITA 5LKUA 4OGCA 1HYIA 1WEMA 2VJEA 2MD7B 3QZVA 2L5UA 2NAAA 3RPGC 5C13A 2MA6A 4ZQLA 2KWKA 5D1MB 2LXHC 2P57A 2ECNA 2XB1A 3N9MA 4Z0RA 4AYCA 2ECIA 2PUYA 3KQIA 2DX8A 2KR4A 1Z6UA 4B7YC 2OWAA 3ZYQA 1VYXA 2ECTA 4YC9A 1FP0A 4TKPB 4BHWA 2XP0A 1Z2QA 2YREA 4F1PA 2KKYA 2RI7A 5C11A 2KWOA 4FK5A 4QF2A 2CRWA 2EGMA 3MHSA 3Q1DA 5B75A 4Q6FA 2CONA 3L1XA 2JM3A 1X4IA 2JMJA 3LRQA 1MM3A 5H1VA
chains in the Genus database with same CATH topology
4GNDA 2E6RA 4FIPA 1ZBDB 5TABA 2H0DA 2LGLA 2YYRA 2YU4A 2LXPC 2QIZA 1U6GB 3LQIA 4MSXA 4AUQB 3ZVYA 2C2LA 1WILA 2M3HA 3HCSA 2CSYA 4GNEA 1X4UA 4LJNA 4X3GA 5LCWB 2YHOA 4R2YA 3ZVZB 5KH7A 2MIQA 5B8DA 5H9MA 3N9LA 2XEUA 5B78A 2HYED 4L7XA 4FO9A 4V3KC 4CCGX 5H1TA 4YADA 2KYUA 3L1ZB 1LDKC 1WIMA 4F52B 1MM2A 2VPEA 2Y1MA 4YBTA 2VPBA 5B79A 5FERA 3O36A 1DVPA 4R8PK 3ASLA 3SOWA 2LGGA 2YW8A 2VJEB 1JM7A 2HDPA 3HTKC 2QJ0A 4AP4A 2KU3A 2EA6A 2K4DA 2G6QA 2VPDA 3DPLR 2IDAA 2ZETC 5I3LA 1WEVA 4PPEA 2RSDA 1XWHA 2F6NA 5FB0A 4B86C 4AYCB 3SOUA 2D8SA 4ZDTA 1JOCA 1E4UA 3IHPA 2E6SA 4LK9A 4QF3A 1VFYA 3MHHA 2QICA 3O33A 4O64A 3O7AA 2KFTA 3U5MA 2KGIA 3U5PA 4UP0A 5JG6A 2FUIA 3ZTGA 2ECJA 2MT5A 2MNZA 4WZ0A 3LQJA 3C5KA 3N9NA 3L11A 3HCTA 2FSAA 5D1LB 1T1HA 5B77A 2OXQC 5TDRA 2KWJA 2H0DB 4XI1A 1WE9A 4S3OC 1WEQA 4N3WA 2CKLA 4UI9B 2JMDA 2CKLB 1K2FA 5TDWA 3FL2A 4YBMA 3RTRB 1WEUA 2K16A 2LRIC 3KV5A 1CHCA 2KIZA 2LN0A 4MVTA 2LV9A 2C2VS 2ECWA 1BORA 4WZ3B 2KE1A 2AN6A 2M1RA 1N87A 2EODA 1WFKA 3HCUA 3EB5A 2BAYA 4YATA 1Z60A 2YHNA 3N9OA 2L80A 3ZNIA 2G43A 2M85A 4YAXA 5FB1A 4ZUXU 5TRBA 4UP5A 4WA6A 3SOXA 1VD4A 2JMIA 4BBQA 4S3OB 2YURA 1F62A 2LGKA 2LGVA 2Y43A 1WEPA 2KWNA 3DQVR 2K17A 3M63A 3PHDA 4PTBA 5EYAF 5G0FA 5J3XA 5D1KB 4W4UA 2YQMA 3O34A 1JM7B 2MNYA 4R7EA 4IC3A 1WENA 3U5NA 2L0BA 2MUMA 4WZ2A 2L43A 2VNFA 3GL6A 1WEEA 2CSZA 3T7LA 4C9ZA 4NN2A 4IC2A 3V43A 2MD8C 3ZPV1 2L75A 2F6JA 2EGPA 1V87A 4CA1A 3NG2A 2PNXA 2YSJA 1HYJA 2MA5A 3VK6A 5H1UA 2YUCA 5LKTA 3GV4A 2ECVA 3M99A 4YABA 2VJFA 4A4BA 2VP7A 2KREA 5B76A 4I7CA 2VJFB 4GNGA 2CT2A 5DINA 2JRJA 5G04B 2Y1NA 3C6WA 5DKAA 3PUQA 3RPGB 1FBVA 4LADB 1IYMA 3O70A 1RMDA 4AVXA 5KH3A 1X4JA 1WESA 2YT5A 2UZGA 2YQLA 2FUUA 5AIUA 4I7BA 5G05B 3U5OA 2K1JA 3KV6A 3EB6A 3N9QA 3I2DA 4YBSA 4LKAA 3N9PA 3M62A 3O35A 2YSMA 5TBNA 3SHBA 2LDRA 4A4CA 1WEOA 3ZPVE 5LKXA 3PURA 3O37A 5FEYA 2LQ6A 1G25A 3T6RA 2I50A 2ECGA 3KNVA 4P5OB 4GB0A 4N4FA 1WGMA 4V3LC 1LDJB 2M6MA 2G45A 4I7DA 2F42A 4GNFA 5KH9A 5LKZA 4L58A 1WEWA 4FJCA 4A0CD 4LLBA 4A49A 3LQHA 2KGGA 2VPGA 5AITA 5LKUA 1HYIA 1WEMA 2VJEA 2MD7B 3QZVA 2L5UA 2NAAA 3RPGC 5C13A 2MA6A 4ZQLA 2KWKA 5D1MB 2LXHC 2ECNA 2XB1A 3N9MA 4AYCA 2ECIA 2PUYA 3KQIA 2DX8A 2KR4A 1Z6UA 4B7YC 3ZYQA 1VYXA 2ECTA 4YC9A 1FP0A 4TKPB 4BHWA 1Z2QA 2YREA 2RI7A 5C11A 2KWOA 4FK5A 4QF2A 3MHSA 5B75A 4Q6FA 3L1XA 1X4IA 2JMJA 3LRQA 1MM3A 5H1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GND A;  2E6R A;  4FIP A;  1ZBD B;  5TAB A;  2H0D A;  2LGL A;  2YYR A;  2YU4 A;  2LXP C;  2QIZ A;  1U6G B;  3LQI A;  4MSX A;  4AUQ B;  3ZVY A;  2C2L A;  1WIL A;  2M3H A;  3HCS A;  2CSY A;  4GNE A;  1X4U A;  4LJN A;  4X3G A;  5LCW B;  2YHO A;  4R2Y A;  3ZVZ B;  5KH7 A;  2MIQ A;  5B8D A;  5H9M A;  3N9L A;  2XEU A;  5B78 A;  2HYE D;  4L7X A;  4FO9 A;  4V3K C;  4CCG X;  5H1T A;  4YAD A;  2KYU A;  3L1Z B;  1LDK C;  1WIM A;  4F52 B;  1MM2 A;  2VPE A;  2Y1M A;  4YBT A;  2VPB A;  5B79 A;  5FER A;  3O36 A;  1DVP A;  4R8P K;  3ASL A;  3SOW A;  2LGG A;  2YW8 A;  2VJE B;  1JM7 A;  2HDP A;  3HTK C;  2QJ0 A;  4AP4 A;  2KU3 A;  2EA6 A;  2K4D A;  2G6Q A;  2VPD A;  3DPL R;  2IDA A;  2ZET C;  5I3L A;  1WEV A;  4PPE A;  2RSD A;  1XWH A;  2F6N A;  5FB0 A;  4B86 C;  4AYC B;  3SOU A;  2D8S A;  4ZDT A;  1JOC A;  1E4U A;  3IHP A;  2E6S A;  4LK9 A;  4QF3 A;  1VFY A;  3MHH A;  2QIC A;  3O33 A;  4O64 A;  3O7A A;  2KFT A;  3U5M A;  2KGI A;  3U5P A;  4UP0 A;  5JG6 A;  2FUI A;  3ZTG A;  2ECJ A;  2MT5 A;  2MNZ A;  4WZ0 A;  3LQJ A;  3C5K A;  3N9N A;  3L11 A;  3HCT A;  2FSA A;  5D1L B;  1T1H A;  5B77 A;  2OXQ C;  5TDR A;  2KWJ A;  2H0D B;  4XI1 A;  1WE9 A;  4S3O C;  1WEQ A;  4N3W A;  2CKL A;  4UI9 B;  2JMD A;  2CKL B;  1K2F A;  5TDW A;  3FL2 A;  4YBM A;  3RTR B;  1WEU A;  2K16 A;  2LRI C;  3KV5 A;  1CHC A;  2KIZ A;  2LN0 A;  4MVT A;  2LV9 A;  2C2V S;  2ECW A;  1BOR A;  4WZ3 B;  2KE1 A;  2AN6 A;  2M1R A;  1N87 A;  2EOD A;  1WFK A;  3HCU A;  3EB5 A;  2BAY A;  4YAT A;  1Z60 A;  2YHN A;  3N9O A;  2L80 A;  3ZNI A;  2G43 A;  2M85 A;  4YAX A;  5FB1 A;  4ZUX U;  5TRB A;  4UP5 A;  4WA6 A;  3SOX A;  1VD4 A;  2JMI A;  4BBQ A;  4S3O B;  2YUR A;  1F62 A;  2LGK A;  2LGV A;  2Y43 A;  1WEP A;  2KWN A;  3DQV R;  2K17 A;  3M63 A;  3PHD A;  4PTB A;  5EYA F;  5G0F A;  5J3X A;  5D1K B;  4W4U A;  2YQM A;  3O34 A;  1JM7 B;  2MNY A;  4R7E A;  4IC3 A;  1WEN A;  3U5N A;  2L0B A;  2MUM A;  4WZ2 A;  2L43 A;  2VNF A;  3GL6 A;  1WEE A;  2CSZ A;  3T7L A;  4C9Z A;  4NN2 A;  4IC2 A;  3V43 A;  2MD8 C;  3ZPV 1;  2L75 A;  2F6J A;  2EGP A;  1V87 A;  4CA1 A;  3NG2 A;  2PNX A;  2YSJ A;  1HYJ A;  2MA5 A;  3VK6 A;  5H1U A;  2YUC A;  5LKT A;  3GV4 A;  2ECV A;  3M99 A;  4YAB A;  2VJF A;  4A4B A;  2VP7 A;  2KRE A;  5B76 A;  4I7C A;  2VJF B;  4GNG A;  2CT2 A;  5DIN A;  2JRJ A;  5G04 B;  2Y1N A;  3C6W A;  5DKA A;  3PUQ A;  3RPG B;  1FBV A;  4LAD B;  1IYM A;  3O70 A;  1RMD A;  4AVX A;  5KH3 A;  1X4J A;  1WES A;  2YT5 A;  2UZG A;  2YQL A;  2FUU A;  5AIU A;  4I7B A;  5G05 B;  3U5O A;  2K1J A;  3KV6 A;  3EB6 A;  3N9Q A;  3I2D A;  4YBS A;  4LKA A;  3N9P A;  3M62 A;  3O35 A;  2YSM A;  5TBN A;  3SHB A;  2LDR A;  4A4C A;  1WEO A;  3ZPV E;  5LKX A;  3PUR A;  3O37 A;  5FEY A;  2LQ6 A;  1G25 A;  3T6R A;  2I50 A;  2ECG A;  3KNV A;  4P5O B;  4GB0 A;  4N4F A;  1WGM A;  4V3L C;  1LDJ B;  2M6M A;  2G45 A;  4I7D A;  2F42 A;  4GNF A;  5KH9 A;  5LKZ A;  4L58 A;  1WEW A;  4FJC A;  4A0C D;  4LLB A;  4A49 A;  3LQH A;  2KGG A;  2VPG A;  5AIT A;  5LKU A;  1HYI A;  1WEM A;  2VJE A;  2MD7 B;  3QZV A;  2L5U A;  2NAA A;  3RPG C;  5C13 A;  2MA6 A;  4ZQL A;  2KWK A;  5D1M B;  2LXH C;  2ECN A;  2XB1 A;  3N9M A;  4AYC A;  2ECI A;  2PUY A;  3KQI A;  2DX8 A;  2KR4 A;  1Z6U A;  4B7Y C;  3ZYQ A;  1VYX A;  2ECT A;  4YC9 A;  1FP0 A;  4TKP B;  4BHW A;  1Z2Q A;  2YRE A;  2RI7 A;  5C11 A;  2KWO A;  4FK5 A;  4QF2 A;  3MHS A;  5B75 A;  4Q6F A;  3L1X A;  1X4I A;  2JMJ A;  3LRQ A;  1MM3 A;  5H1V A; 
#chains in the Genus database with same CATH topology
 4GND A;  2E6R A;  4FIP A;  1ZBD B;  5TAB A;  2H0D A;  2LGL A;  2YYR A;  2YU4 A;  3LVR E;  2LXP C;  2QIZ A;  1U6G B;  3LQI A;  4MSX A;  5SVY A;  4AUQ B;  3ZVY A;  3SUB A;  2C2L A;  1WIL A;  2M3H A;  3HCS A;  2CSY A;  4GNE A;  3LJU X;  1X4U A;  3DWD A;  4LJN A;  4X3G A;  5LCW B;  2YHO A;  4R2Y A;  3ZVZ B;  5KH7 A;  2MIQ A;  5B8D A;  5H9M A;  3N9L A;  2XEU A;  2XOY A;  5B78 A;  2HYE D;  4L7X A;  2MKE A;  4FO9 A;  4V3K C;  2KKX A;  4CCG X;  5H1T A;  4YAD A;  2KYU A;  2EXU A;  3L1Z B;  1LDK C;  1WIM A;  4F52 B;  1MM2 A;  5SVI B;  2VPE A;  2Y1M A;  3JUE A;  4YBT A;  2VPB A;  5B79 A;  2IQJ A;  5FER A;  3FAO A;  2LAU A;  3O36 A;  1DVP A;  4R8P K;  3ASL A;  3E2D A;  3SOW A;  2LGG A;  2YW8 A;  2VJE B;  1JM7 A;  2HDP A;  3HTK C;  2QJ0 A;  4AP4 A;  2KU3 A;  2EA6 A;  2K4D A;  2G6Q A;  2VPD A;  3DPL R;  2IDA A;  2ZET C;  5I3L A;  1WEV A;  4PPE A;  2RSD A;  1XWH A;  2F6N A;  5FB0 A;  2B0O E;  4B86 C;  4AYC B;  3SOU A;  2D8S A;  4ZDT A;  1JOC A;  3MDB C;  1E4U A;  3IHP A;  2E6S A;  4LK9 A;  4QF3 A;  1VFY A;  3MHH A;  2QIC A;  3O33 A;  2D8U A;  4O64 A;  4O62 A;  3O7A A;  2KFT A;  3U5M A;  2KGI A;  3M7K A;  3U5P A;  4UP0 A;  5JG6 A;  2FUI A;  3ZTG A;  2ECJ A;  2MT5 A;  2MNZ A;  4WZ0 A;  3LQJ A;  2FD4 A;  3C5K A;  3N9N A;  2E61 A;  3L11 A;  3HCT A;  2FSA A;  5D1L B;  1T1H A;  5B77 A;  2OXQ C;  5TDR A;  2KWJ A;  2H0D B;  4XI1 A;  3FM8 C;  1WE9 A;  4S3O C;  1WEQ A;  2L7P A;  4N3W A;  2CKL A;  4UI9 B;  2YVR A;  2JMD A;  2CKL B;  1K2F A;  5TDW A;  3FL2 A;  4YBM A;  4H9D A;  3RTR B;  1WEU A;  2K16 A;  2LRI C;  3KV5 A;  1CHC A;  2KIZ A;  2LN0 A;  4MVT A;  3LVQ E;  2LV9 A;  2C2V S;  2ECW A;  1BOR A;  4WZ3 B;  2KE1 A;  2AN6 A;  2M1R A;  1N87 A;  2EOD A;  1WFK A;  3HCU A;  3EB5 A;  2BAY A;  4YAT A;  1Z60 A;  2YHN A;  3N9O A;  2L80 A;  3ZNI A;  2G43 A;  2M85 A;  4YAX A;  5FB1 A;  3DDT A;  4ZUX U;  5TRB A;  4UP5 A;  3FEH A;  4WA6 A;  3SOX A;  1VD4 A;  2JMI A;  2RR4 A;  4BBQ A;  4S3O B;  2YUR A;  1F62 A;  4Z0O A;  2LGK A;  2LGV A;  2Y43 A;  1WEP A;  2KWN A;  3DQV R;  4OGE A;  2K17 A;  3M63 A;  3PHD A;  4PTB A;  2XOZ A;  5EYA F;  5G0F A;  5J3X A;  5D1K B;  3PLW A;  3T9K A;  4W4U A;  2YQM A;  2CRR A;  3O34 A;  1JM7 B;  2MNY A;  4R7E A;  4IC3 A;  1WEN A;  3U5N A;  2L0B A;  2MUM A;  4WZ2 A;  2L43 A;  2VNF A;  3GL6 A;  1WEE A;  2CSZ A;  3T7L A;  4C9Z A;  4NN2 A;  2CSV A;  4QQ4 A;  4IC2 A;  3V43 A;  2MD8 C;  3ZPV 1;  2L75 A;  2F6J A;  2EGP A;  1V87 A;  4CA1 A;  3NG2 A;  2PNX A;  2YSJ A;  1HYJ A;  2DJA A;  2MA5 A;  3VK6 A;  5H1U A;  2YUC A;  5SVX A;  2FFW A;  3FJU B;  5LKT A;  3GV4 A;  3KDE C;  2ECV A;  3M99 A;  4YAB A;  2VJF A;  4A4B A;  2VP7 A;  2KRE A;  1MBM A;  5B76 A;  4I7C A;  2VJF B;  4GNG A;  2CT2 A;  5DIN A;  2JRJ A;  5G04 B;  3FAN A;  2Y1N A;  3C6W A;  5DKA A;  3PUQ A;  3RPG B;  1FBV A;  4LAD B;  1IYM A;  2JUN A;  2M13 A;  3O70 A;  1RMD A;  4AVX A;  5KH3 A;  3LDY A;  1X4J A;  1WES A;  2YT5 A;  2UZG A;  2YQL A;  2FUU A;  5AIU A;  4I7B A;  5G05 B;  3U5O A;  2K1J A;  3KV6 A;  3EB6 A;  3N9Q A;  3I2D A;  4YBS A;  4LKA A;  3N9P A;  3M62 A;  3O35 A;  2YSM A;  5TBN A;  3SHB A;  2LDR A;  4A4C A;  1WEO A;  3ZPV E;  5LKX A;  3PUR A;  3O37 A;  5FEY A;  2LQ6 A;  1G25 A;  3T6R A;  2I50 A;  2ECG A;  3KNV A;  4P5O B;  2XOC A;  2DSM A;  4GB0 A;  4N4F A;  1WGM A;  4V3L C;  1LDJ B;  2M6M A;  2G45 A;  4I7D A;  2F42 A;  4GNF A;  5SVI A;  5KH9 A;  5LKZ A;  4L58 A;  1WEW A;  4FJC A;  5K3Q A;  3O47 A;  4A0C D;  4LLB A;  4A49 A;  3LQH A;  2KGG A;  2VPG A;  1DCQ A;  3H7H A;  5AIT A;  5LKU A;  4OGC A;  1HYI A;  1WEM A;  2VJE A;  2MD7 B;  3QZV A;  2L5U A;  2NAA A;  3RPG C;  5C13 A;  2MA6 A;  4ZQL A;  2KWK A;  5D1M B;  2LXH C;  2P57 A;  2ECN A;  2XB1 A;  3N9M A;  4Z0R A;  4AYC A;  2ECI A;  2PUY A;  3KQI A;  2DX8 A;  2KR4 A;  1Z6U A;  4B7Y C;  2OWA A;  3ZYQ A;  1VYX A;  2ECT A;  4YC9 A;  1FP0 A;  4TKP B;  4BHW A;  2XP0 A;  1Z2Q A;  2YRE A;  4F1P A;  2KKY A;  2RI7 A;  5C11 A;  2KWO A;  4FK5 A;  4QF2 A;  2CRW A;  2EGM A;  3MHS A;  3Q1D A;  5B75 A;  4Q6F A;  2CON A;  3L1X A;  2JM3 A;  1X4I A;  2JMJ A;  3LRQ A;  1MM3 A;  5H1V A; 
#chains in the Genus database with same CATH homology
 4GND A;  2E6R A;  4FIP A;  1ZBD B;  5TAB A;  2H0D A;  2LGL A;  2YYR A;  2YU4 A;  2LXP C;  2QIZ A;  1U6G B;  3LQI A;  4MSX A;  4AUQ B;  3ZVY A;  2C2L A;  1WIL A;  2M3H A;  3HCS A;  2CSY A;  4GNE A;  1X4U A;  4LJN A;  4X3G A;  5LCW B;  2YHO A;  4R2Y A;  3ZVZ B;  5KH7 A;  2MIQ A;  5B8D A;  5H9M A;  3N9L A;  2XEU A;  5B78 A;  2HYE D;  4L7X A;  4FO9 A;  4V3K C;  4CCG X;  5H1T A;  4YAD A;  2KYU A;  3L1Z B;  1LDK C;  1WIM A;  4F52 B;  1MM2 A;  2VPE A;  2Y1M A;  4YBT A;  2VPB A;  5B79 A;  5FER A;  3O36 A;  1DVP A;  4R8P K;  3ASL A;  3SOW A;  2LGG A;  2YW8 A;  2VJE B;  1JM7 A;  2HDP A;  3HTK C;  2QJ0 A;  4AP4 A;  2KU3 A;  2EA6 A;  2K4D A;  2G6Q A;  2VPD A;  3DPL R;  2IDA A;  2ZET C;  5I3L A;  1WEV A;  4PPE A;  2RSD A;  1XWH A;  2F6N A;  5FB0 A;  4B86 C;  4AYC B;  3SOU A;  2D8S A;  4ZDT A;  1JOC A;  1E4U A;  3IHP A;  2E6S A;  4LK9 A;  4QF3 A;  1VFY A;  3MHH A;  2QIC A;  3O33 A;  4O64 A;  3O7A A;  2KFT A;  3U5M A;  2KGI A;  3U5P A;  4UP0 A;  5JG6 A;  2FUI A;  3ZTG A;  2ECJ A;  2MT5 A;  2MNZ A;  4WZ0 A;  3LQJ A;  3C5K A;  3N9N A;  3L11 A;  3HCT A;  2FSA A;  5D1L B;  1T1H A;  5B77 A;  2OXQ C;  5TDR A;  2KWJ A;  2H0D B;  4XI1 A;  1WE9 A;  4S3O C;  1WEQ A;  4N3W A;  2CKL A;  4UI9 B;  2JMD A;  2CKL B;  1K2F A;  5TDW A;  3FL2 A;  4YBM A;  3RTR B;  1WEU A;  2K16 A;  2LRI C;  3KV5 A;  1CHC A;  2KIZ A;  2LN0 A;  4MVT A;  2LV9 A;  2C2V S;  2ECW A;  1BOR A;  4WZ3 B;  2KE1 A;  2AN6 A;  2M1R A;  1N87 A;  2EOD A;  1WFK A;  3HCU A;  3EB5 A;  2BAY A;  4YAT A;  1Z60 A;  2YHN A;  3N9O A;  2L80 A;  3ZNI A;  2G43 A;  2M85 A;  4YAX A;  5FB1 A;  4ZUX U;  5TRB A;  4UP5 A;  4WA6 A;  3SOX A;  1VD4 A;  2JMI A;  4BBQ A;  4S3O B;  2YUR A;  1F62 A;  2LGK A;  2LGV A;  2Y43 A;  1WEP A;  2KWN A;  3DQV R;  2K17 A;  3M63 A;  3PHD A;  4PTB A;  5EYA F;  5G0F A;  5J3X A;  5D1K B;  4W4U A;  2YQM A;  3O34 A;  1JM7 B;  2MNY A;  4R7E A;  4IC3 A;  1WEN A;  3U5N A;  2L0B A;  2MUM A;  4WZ2 A;  2L43 A;  2VNF A;  3GL6 A;  1WEE A;  2CSZ A;  3T7L A;  4C9Z A;  4NN2 A;  4IC2 A;  3V43 A;  2MD8 C;  3ZPV 1;  2L75 A;  2F6J A;  2EGP A;  1V87 A;  4CA1 A;  3NG2 A;  2PNX A;  2YSJ A;  1HYJ A;  2MA5 A;  3VK6 A;  5H1U A;  2YUC A;  5LKT A;  3GV4 A;  2ECV A;  3M99 A;  4YAB A;  2VJF A;  4A4B A;  2VP7 A;  2KRE A;  5B76 A;  4I7C A;  2VJF B;  4GNG A;  2CT2 A;  5DIN A;  2JRJ A;  5G04 B;  2Y1N A;  3C6W A;  5DKA A;  3PUQ A;  3RPG B;  1FBV A;  4LAD B;  1IYM A;  3O70 A;  1RMD A;  4AVX A;  5KH3 A;  1X4J A;  1WES A;  2YT5 A;  2UZG A;  2YQL A;  2FUU A;  5AIU A;  4I7B A;  5G05 B;  3U5O A;  2K1J A;  3KV6 A;  3EB6 A;  3N9Q A;  3I2D A;  4YBS A;  4LKA A;  3N9P A;  3M62 A;  3O35 A;  2YSM A;  5TBN A;  3SHB A;  2LDR A;  4A4C A;  1WEO A;  3ZPV E;  5LKX A;  3PUR A;  3O37 A;  5FEY A;  2LQ6 A;  1G25 A;  3T6R A;  2I50 A;  2ECG A;  3KNV A;  4P5O B;  4GB0 A;  4N4F A;  1WGM A;  4V3L C;  1LDJ B;  2M6M A;  2G45 A;  4I7D A;  2F42 A;  4GNF A;  5KH9 A;  5LKZ A;  4L58 A;  1WEW A;  4FJC A;  4A0C D;  4LLB A;  4A49 A;  3LQH A;  2KGG A;  2VPG A;  5AIT A;  5LKU A;  1HYI A;  1WEM A;  2VJE A;  2MD7 B;  3QZV A;  2L5U A;  2NAA A;  3RPG C;  5C13 A;  2MA6 A;  4ZQL A;  2KWK A;  5D1M B;  2LXH C;  2ECN A;  2XB1 A;  3N9M A;  4AYC A;  2ECI A;  2PUY A;  3KQI A;  2DX8 A;  2KR4 A;  1Z6U A;  4B7Y C;  3ZYQ A;  1VYX A;  2ECT A;  4YC9 A;  1FP0 A;  4TKP B;  4BHW A;  1Z2Q A;  2YRE A;  2RI7 A;  5C11 A;  2KWO A;  4FK5 A;  4QF2 A;  3MHS A;  5B75 A;  4Q6F A;  3L1X A;  1X4I A;  2JMJ A;  3LRQ A;  1MM3 A;  5H1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...