4B86C

Crystal structure of the msl1-msl2 complex (3.5a)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
total genus 30
structure length 115
sequence length 115
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b86C00
4Q6FA 3FL2A 4BBQA 2VNFA 4LKAA 5FB1A 2M85A 4C9ZA 1Z6UA 2E6SA 1Z60A 5AITA 5H1VA 2KYUA 1XWHA 2KWOA 4AVXA 2VJFB 4V3KC 2YSMA 4LADB 2KU3A 2VJEA 4QF3A 3N9QA 4YBMA 4PTBA 1JM7A 2C2VS 3ZVZB 2M1RA 2HYED 2YUCA 4CA1A 3ZPV1 4WA6A 3LQIA 2Y1NA 2HDPA 3RPGC 4A0CD 2H0DA 3IHPA 1WEVA 5B75A 5LKZA 2G43A 5C11A 4FO9A 4LLBA 1Z2QA 2JMDA 4YBTA 1WEPA 1K2FA 4N3WA 3M62A 2Y43A 2LQ6A 3RPGB 4IC2A 4V3LC 2MA5A 2ECJA 2F42A 2BAYA 5J3XA 4W4UA 2MD8C 1WEWA 1MM3A 4WZ3B 4TKPB 4R8PK 2G45A 5TDRA 3ZYQA 5B8DA 2K4DA 1F62A 3PHDA 5KH3A 4X3GA 5LKXA 5KH7A 2MA6A 3ZTGA 4A49A 1IYMA 2YQMA 2VPBA 3EB6A 1X4UA 2KWKA 2LGVA 2YSJA 2D8SA 3LRQA 3ZPVE 1WEMA 2L80A 2ECWA 3M63A 3ZVYA 3HCTA 3KV6A 1VD4A 4YATA 2K1JA 2LDRA 2KIZA 1WESA 4I7DA 3KNVA 2F6NA 3SHBA 5D1LB 2YHNA 4IC3A 2EODA 2CT2A 5C13A 4WZ0A 2JRJA 4AYCA 2LXPC 3KQIA 2FUUA 2ECIA 1VFYA 2C2LA 3LQHA 2LN0A 4P5OB 2MT5A 1WENA 5D1MB 4GB0A 3GL6A 5AIUA 5FERA 2JMIA 1FBVA 5H9MA 3PUQA 5JG6A 3C6WA 2LXHC 4S3OC 5TDWA 5TRBA 4XI1A 4GNDA 2KR4A 2YU4A 4O64A 4CCGX 4GNEA 5DKAA 2IDAA 1WEUA 2MNZA 2VPEA 2MUMA 3L1ZB 2CKLA 4UI9B 2KWJA 3RTRB 1ZBDB 2YQLA 5TABA 2M6MA 2UZGA 3O37A 3HCSA 1WILA 2I50A 3N9LA 4ZUXU 1N87A 3M99A 4ZQLA 3HTKC 2YREA 3N9PA 4YAXA 2LGGA 4UP0A 1FP0A 4ZDTA 3O7AA 2CSZA 1RMDA 4MVTA 1WEQA 3C5KA 5LKUA 2CKLB 5H1TA 3V43A 3HCUA 3NG2A 2PNXA 2ECNA 1E4UA 5I3LA 2LGKA 2L5UA 4I7BA 3DQVR 1DVPA 4LK9A 4L7XA 5B78A 5G04B 3LQJA 3PURA 2ECVA 1LDKC 5B77A 2RI7A 2XB1A 1U6GB 4FK5A 5DINA 3N9NA 2L75A 4B86C 4AYCB 2KWNA 2AN6A 3VK6A 2K16A 2KREA 3QZVA 2G6QA 2KGIA 2EA6A 1BORA 4FJCA 3ZNIA 5EYAF 3KV5A 2VPDA 2DX8A 4GNGA 5H1UA 3MHSA 2VJFA 2FSAA 2FUIA 3SOXA 5D1KB 4YBSA 3SOUA 4R7EA 2KFTA 2JMJA 4A4BA 1HYJA 2YHOA 2YYRA 4WZ2A 4AP4A 5G0FA 5G05B 2VPGA 4YADA 1WIMA 2E6RA 4YC9A 2YURA 4S3OB 1WGMA 3N9MA 4L58A 2KGGA 4R2YA 3O35A 3T6RA 2VP7A 4QF2A 2OXQC 3T7LA 4YABA 3O34A 2NAAA 5B76A 4AUQB 1X4JA 1WE9A 2PUYA 2ZETC 3L11A 2RSDA 1HYIA 5B79A 2QIZA 4BHWA 2ECGA 4B7YC 2CSYA 4UP5A 4MSXA 1WEOA 1V87A 3DPLR 2YW8A 4F52B 1CHCA 1JOCA 2LRIC 3O70A 3U5OA 3GV4A 4N4FA 3I2DA 3U5PA 3ASLA 4NN2A 1X4IA 2H0DB 5LKTA 4GNFA 2L0BA 2VJEB 1MM2A 4LJNA 2QJ0A 1JM7B 5FEYA 2KE1A 5KH9A 3U5MA 1WEEA 3MHHA 4FIPA 1VYXA 2YT5A 2ECTA 1WFKA 2K17A 5TBNA 2M3HA 3O33A 2F6JA 2MIQA 3EB5A 2QICA 3O36A 5FB0A 2LV9A 3SOWA 1T1HA 4PPEA 2MD7B 2Y1MA 3N9OA 3L1XA 3U5NA 5LCWB 2L43A 2EGPA 2LGLA 2XEUA 1G25A 4A4CA 4I7CA 2MNYA 1LDJB
chains in the Genus database with same CATH superfamily
3Q1DA 4Q6FA 3FL2A 4BBQA 2VNFA 3FM8C 4LKAA 5FB1A 2M85A 4C9ZA 1Z6UA 2E6SA 1Z60A 5AITA 5H1VA 2KYUA 1XWHA 2KWOA 4AVXA 2CSVA 2P57A 2VJFB 4V3KC 2YSMA 3LDYA 4LADB 3SUBA 2KU3A 2VJEA 4QF3A 3N9QA 4YBMA 4PTBA 1JM7A 2FFWA 2C2VS 3ZVZB 2M1RA 2HYED 2YUCA 4CA1A 3ZPV1 4WA6A 3LQIA 2Y1NA 2LAUA 2E61A 2HDPA 3RPGC 4A0CD 3M7KA 2H0DA 3IHPA 1WEVA 5B75A 5LKZA 2G43A 5C11A 4FO9A 4LLBA 1Z2QA 2JMDA 4YBTA 1WEPA 1K2FA 4N3WA 3M62A 2Y43A 2LQ6A 3RPGB 4IC2A 4V3LC 2MA5A 2ECJA 2F42A 2BAYA 5J3XA 4W4UA 2MD8C 1WEWA 1MM3A 4WZ3B 4TKPB 4R8PK 2G45A 5TDRA 3ZYQA 5B8DA 2K4DA 1F62A 5SVXA 3PHDA 5KH3A 4X3GA 3PLWA 5LKXA 5KH7A 2MA6A 3ZTGA 4A49A 1IYMA 2YQMA 2VPBA 3EB6A 1X4UA 2KWKA 2M13A 2LGVA 4QQ4A 2YSJA 2D8SA 3LRQA 3ZPVE 1WEMA 2L80A 2ECWA 3M63A 3ZVYA 3HCTA 3KV6A 1VD4A 4YATA 2K1JA 2LDRA 2KIZA 1WESA 2RR4A 3JUEA 4I7DA 3KNVA 2F6NA 3FJUB 3SHBA 5D1LB 2YHNA 4IC3A 2EODA 2CT2A 3LVRE 5C13A 4WZ0A 2JRJA 4AYCA 2LXPC 3KQIA 2FUUA 2ECIA 2FD4A 1VFYA 2XOYA 2C2LA 3LQHA 2LN0A 4P5OB 2MT5A 2IQJA 2XOZA 1WENA 5D1MB 4GB0A 3GL6A 5AIUA 5FERA 2DSMA 2JMIA 1FBVA 5H9MA 3PUQA 3LJUX 5JG6A 3C6WA 2LXHC 4S3OC 5TDWA 5TRBA 4XI1A 4GNDA 2KR4A 2YU4A 4O62A 4O64A 4CCGX 2JM3A 4GNEA 5DKAA 2IDAA 1WEUA 2MNZA 2VPEA 2MUMA 3L1ZB 2CKLA 4UI9B 2KWJA 2OWAA 3RTRB 2XP0A 1ZBDB 2YQLA 5TABA 3T9KA 2M6MA 2UZGA 3O37A 3HCSA 3MDBC 1WILA 2JUNA 2I50A 3N9LA 4ZUXU 1N87A 3M99A 4ZQLA 3HTKC 2YREA 3N9PA 4YAXA 2LGGA 4UP0A 1FP0A 3KDEC 4ZDTA 3O7AA 2CSZA 5SVYA 1RMDA 4MVTA 1WEQA 3C5KA 3LVQE 4F1PA 5LKUA 2CKLB 3FAOA 5H1TA 3V43A 3HCUA 3NG2A 2PNXA 2ECNA 1E4UA 2D8UA 5I3LA 2LGKA 2L5UA 4I7BA 3DQVR 1DVPA 4LK9A 4L7XA 5B78A 5G04B 3LQJA 3PURA 2ECVA 1LDKC 5B77A 5K3QA 2RI7A 2XB1A 1U6GB 4FK5A 2MKEA 5DINA 3N9NA 2L75A 4B86C 4AYCB 2KWNA 2AN6A 3VK6A 2K16A 2KREA 3QZVA 2G6QA 2KGIA 2KKYA 2EA6A 1BORA 2EXUA 4FJCA 3ZNIA 5EYAF 3KV5A 2VPDA 2DX8A 4GNGA 5H1UA 3MHSA 2VJFA 2FSAA 4Z0RA 2FUIA 3SOXA 5D1KB 4YBSA 2YVRA 3SOUA 4R7EA 2KFTA 2JMJA 4A4BA 1HYJA 3E2DA 2YHOA 2YYRA 4WZ2A 4AP4A 5G0FA 5G05B 2VPGA 4YADA 1WIMA 2E6RA 2XOCA 2DJAA 4YC9A 2YURA 3O47A 4S3OB 1WGMA 3N9MA 2B0OE 4L58A 2KGGA 3DWDA 4R2YA 3O35A 3T6RA 2VP7A 4QF2A 2OXQC 3T7LA 4YABA 3O34A 2NAAA 5B76A 1X4JA 4AUQB 1WE9A 2PUYA 2ZETC 4H9DA 3L11A 4OGEA 2RSDA 1HYIA 2CONA 5B79A 2QIZA 4BHWA 2ECGA 4B7YC 2CSYA 4UP5A 1DCQA 4Z0OA 4MSXA 1WEOA 1V87A 3DPLR 2YW8A 4F52B 1CHCA 1JOCA 2LRIC 2EGMA 3O70A 3U5OA 3GV4A 4N4FA 3I2DA 3U5PA 3ASLA 4NN2A 1X4IA 2H0DB 5LKTA 4GNFA 2L0BA 2VJEB 1MM2A 4LJNA 2QJ0A 1JM7B 2KKXA 5FEYA 2KE1A 3FEHA 5KH9A 3U5MA 5SVIA 1WEEA 3MHHA 4FIPA 1VYXA 2YT5A 2ECTA 1WFKA 2K17A 5TBNA 2M3HA 3O33A 2F6JA 2MIQA 3EB5A 2QICA 3O36A 5FB0A 2LV9A 2L7PA 1MBMA 2CRRA 3FANA 3SOWA 1T1HA 4PPEA 4OGCA 2MD7B 2Y1MA 3N9OA 3L1XA 2CRWA 3U5NA 5SVIB 5LCWB 3DDTA 3H7HA 2L43A 2EGPA 2LGLA 2XEUA 1G25A 4A4CA 4I7CA 2MNYA 1LDJB
chains in the Genus database with same CATH topology
4Q6FA 3FL2A 4BBQA 2VNFA 4LKAA 5FB1A 2M85A 4C9ZA 1Z6UA 2E6SA 1Z60A 5AITA 5H1VA 2KYUA 1XWHA 2KWOA 4AVXA 2VJFB 4V3KC 2YSMA 4LADB 2KU3A 2VJEA 4QF3A 3N9QA 4YBMA 4PTBA 1JM7A 2C2VS 3ZVZB 2M1RA 2HYED 2YUCA 4CA1A 3ZPV1 4WA6A 3LQIA 2Y1NA 2HDPA 3RPGC 4A0CD 2H0DA 3IHPA 1WEVA 5B75A 5LKZA 2G43A 5C11A 4FO9A 4LLBA 1Z2QA 2JMDA 4YBTA 1WEPA 1K2FA 4N3WA 3M62A 2Y43A 2LQ6A 3RPGB 4IC2A 4V3LC 2MA5A 2ECJA 2F42A 2BAYA 5J3XA 4W4UA 2MD8C 1WEWA 1MM3A 4WZ3B 4TKPB 4R8PK 2G45A 5TDRA 3ZYQA 5B8DA 2K4DA 1F62A 3PHDA 5KH3A 4X3GA 5LKXA 5KH7A 2MA6A 3ZTGA 4A49A 1IYMA 2YQMA 2VPBA 3EB6A 1X4UA 2KWKA 2LGVA 2YSJA 2D8SA 3LRQA 3ZPVE 1WEMA 2L80A 2ECWA 3M63A 3ZVYA 3HCTA 3KV6A 1VD4A 4YATA 2K1JA 2LDRA 2KIZA 1WESA 4I7DA 3KNVA 2F6NA 3SHBA 5D1LB 2YHNA 4IC3A 2EODA 2CT2A 5C13A 4WZ0A 2JRJA 4AYCA 2LXPC 3KQIA 2FUUA 2ECIA 1VFYA 2C2LA 3LQHA 2LN0A 4P5OB 2MT5A 1WENA 5D1MB 4GB0A 3GL6A 5AIUA 5FERA 2JMIA 1FBVA 5H9MA 3PUQA 5JG6A 3C6WA 2LXHC 4S3OC 5TDWA 5TRBA 4XI1A 4GNDA 2KR4A 2YU4A 4O64A 4CCGX 4GNEA 5DKAA 2IDAA 1WEUA 2MNZA 2VPEA 2MUMA 3L1ZB 2CKLA 4UI9B 2KWJA 3RTRB 1ZBDB 2YQLA 5TABA 2M6MA 2UZGA 3O37A 3HCSA 1WILA 2I50A 3N9LA 4ZUXU 1N87A 3M99A 4ZQLA 3HTKC 2YREA 3N9PA 4YAXA 2LGGA 4UP0A 1FP0A 4ZDTA 3O7AA 2CSZA 1RMDA 4MVTA 1WEQA 3C5KA 5LKUA 2CKLB 5H1TA 3V43A 3HCUA 3NG2A 2PNXA 2ECNA 1E4UA 5I3LA 2LGKA 2L5UA 4I7BA 3DQVR 1DVPA 4LK9A 4L7XA 5B78A 5G04B 3LQJA 3PURA 2ECVA 1LDKC 5B77A 2RI7A 2XB1A 1U6GB 4FK5A 5DINA 3N9NA 2L75A 4B86C 4AYCB 2KWNA 2AN6A 3VK6A 2K16A 2KREA 3QZVA 2G6QA 2KGIA 2EA6A 1BORA 4FJCA 3ZNIA 5EYAF 3KV5A 2VPDA 2DX8A 4GNGA 5H1UA 3MHSA 2VJFA 2FSAA 2FUIA 3SOXA 5D1KB 4YBSA 3SOUA 4R7EA 2KFTA 2JMJA 4A4BA 1HYJA 2YHOA 2YYRA 4WZ2A 4AP4A 5G0FA 5G05B 2VPGA 4YADA 1WIMA 2E6RA 4YC9A 2YURA 4S3OB 1WGMA 3N9MA 4L58A 2KGGA 4R2YA 3O35A 3T6RA 2VP7A 4QF2A 2OXQC 3T7LA 4YABA 3O34A 2NAAA 5B76A 4AUQB 1X4JA 1WE9A 2PUYA 2ZETC 3L11A 2RSDA 1HYIA 5B79A 2QIZA 4BHWA 2ECGA 4B7YC 2CSYA 4UP5A 4MSXA 1WEOA 1V87A 3DPLR 2YW8A 4F52B 1CHCA 1JOCA 2LRIC 3O70A 3U5OA 3GV4A 4N4FA 3I2DA 3U5PA 3ASLA 4NN2A 1X4IA 2H0DB 5LKTA 4GNFA 2L0BA 2VJEB 1MM2A 4LJNA 2QJ0A 1JM7B 5FEYA 2KE1A 5KH9A 3U5MA 1WEEA 3MHHA 4FIPA 1VYXA 2YT5A 2ECTA 1WFKA 2K17A 5TBNA 2M3HA 3O33A 2F6JA 2MIQA 3EB5A 2QICA 3O36A 5FB0A 2LV9A 3SOWA 1T1HA 4PPEA 2MD7B 2Y1MA 3N9OA 3L1XA 3U5NA 5LCWB 2L43A 2EGPA 2LGLA 2XEUA 1G25A 4A4CA 4I7CA 2MNYA 1LDJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q6F A;  3FL2 A;  4BBQ A;  2VNF A;  4LKA A;  5FB1 A;  2M85 A;  4C9Z A;  1Z6U A;  2E6S A;  1Z60 A;  5AIT A;  5H1V A;  2KYU A;  1XWH A;  2KWO A;  4AVX A;  2VJF B;  4V3K C;  2YSM A;  4LAD B;  2KU3 A;  2VJE A;  4QF3 A;  3N9Q A;  4YBM A;  4PTB A;  1JM7 A;  2C2V S;  3ZVZ B;  2M1R A;  2HYE D;  2YUC A;  4CA1 A;  3ZPV 1;  4WA6 A;  3LQI A;  2Y1N A;  2HDP A;  3RPG C;  4A0C D;  2H0D A;  3IHP A;  1WEV A;  5B75 A;  5LKZ A;  2G43 A;  5C11 A;  4FO9 A;  4LLB A;  1Z2Q A;  2JMD A;  4YBT A;  1WEP A;  1K2F A;  4N3W A;  3M62 A;  2Y43 A;  2LQ6 A;  3RPG B;  4IC2 A;  4V3L C;  2MA5 A;  2ECJ A;  2F42 A;  2BAY A;  5J3X A;  4W4U A;  2MD8 C;  1WEW A;  1MM3 A;  4WZ3 B;  4TKP B;  4R8P K;  2G45 A;  5TDR A;  3ZYQ A;  5B8D A;  2K4D A;  1F62 A;  3PHD A;  5KH3 A;  4X3G A;  5LKX A;  5KH7 A;  2MA6 A;  3ZTG A;  4A49 A;  1IYM A;  2YQM A;  2VPB A;  3EB6 A;  1X4U A;  2KWK A;  2LGV A;  2YSJ A;  2D8S A;  3LRQ A;  3ZPV E;  1WEM A;  2L80 A;  2ECW A;  3M63 A;  3ZVY A;  3HCT A;  3KV6 A;  1VD4 A;  4YAT A;  2K1J A;  2LDR A;  2KIZ A;  1WES A;  4I7D A;  3KNV A;  2F6N A;  3SHB A;  5D1L B;  2YHN A;  4IC3 A;  2EOD A;  2CT2 A;  5C13 A;  4WZ0 A;  2JRJ A;  4AYC A;  2LXP C;  3KQI A;  2FUU A;  2ECI A;  1VFY A;  2C2L A;  3LQH A;  2LN0 A;  4P5O B;  2MT5 A;  1WEN A;  5D1M B;  4GB0 A;  3GL6 A;  5AIU A;  5FER A;  2JMI A;  1FBV A;  5H9M A;  3PUQ A;  5JG6 A;  3C6W A;  2LXH C;  4S3O C;  5TDW A;  5TRB A;  4XI1 A;  4GND A;  2KR4 A;  2YU4 A;  4O64 A;  4CCG X;  4GNE A;  5DKA A;  2IDA A;  1WEU A;  2MNZ A;  2VPE A;  2MUM A;  3L1Z B;  2CKL A;  4UI9 B;  2KWJ A;  3RTR B;  1ZBD B;  2YQL A;  5TAB A;  2M6M A;  2UZG A;  3O37 A;  3HCS A;  1WIL A;  2I50 A;  3N9L A;  4ZUX U;  1N87 A;  3M99 A;  4ZQL A;  3HTK C;  2YRE A;  3N9P A;  4YAX A;  2LGG A;  4UP0 A;  1FP0 A;  4ZDT A;  3O7A A;  2CSZ A;  1RMD A;  4MVT A;  1WEQ A;  3C5K A;  5LKU A;  2CKL B;  5H1T A;  3V43 A;  3HCU A;  3NG2 A;  2PNX A;  2ECN A;  1E4U A;  5I3L A;  2LGK A;  2L5U A;  4I7B A;  3DQV R;  1DVP A;  4LK9 A;  4L7X A;  5B78 A;  5G04 B;  3LQJ A;  3PUR A;  2ECV A;  1LDK C;  5B77 A;  2RI7 A;  2XB1 A;  1U6G B;  4FK5 A;  5DIN A;  3N9N A;  2L75 A;  4B86 C;  4AYC B;  2KWN A;  2AN6 A;  3VK6 A;  2K16 A;  2KRE A;  3QZV A;  2G6Q A;  2KGI A;  2EA6 A;  1BOR A;  4FJC A;  3ZNI A;  5EYA F;  3KV5 A;  2VPD A;  2DX8 A;  4GNG A;  5H1U A;  3MHS A;  2VJF A;  2FSA A;  2FUI A;  3SOX A;  5D1K B;  4YBS A;  3SOU A;  4R7E A;  2KFT A;  2JMJ A;  4A4B A;  1HYJ A;  2YHO A;  2YYR A;  4WZ2 A;  4AP4 A;  5G0F A;  5G05 B;  2VPG A;  4YAD A;  1WIM A;  2E6R A;  4YC9 A;  2YUR A;  4S3O B;  1WGM A;  3N9M A;  4L58 A;  2KGG A;  4R2Y A;  3O35 A;  3T6R A;  2VP7 A;  4QF2 A;  2OXQ C;  3T7L A;  4YAB A;  3O34 A;  2NAA A;  5B76 A;  4AUQ B;  1X4J A;  1WE9 A;  2PUY A;  2ZET C;  3L11 A;  2RSD A;  1HYI A;  5B79 A;  2QIZ A;  4BHW A;  2ECG A;  4B7Y C;  2CSY A;  4UP5 A;  4MSX A;  1WEO A;  1V87 A;  3DPL R;  2YW8 A;  4F52 B;  1CHC A;  1JOC A;  2LRI C;  3O70 A;  3U5O A;  3GV4 A;  4N4F A;  3I2D A;  3U5P A;  3ASL A;  4NN2 A;  1X4I A;  2H0D B;  5LKT A;  4GNF A;  2L0B A;  2VJE B;  1MM2 A;  4LJN A;  2QJ0 A;  1JM7 B;  5FEY A;  2KE1 A;  5KH9 A;  3U5M A;  1WEE A;  3MHH A;  4FIP A;  1VYX A;  2YT5 A;  2ECT A;  1WFK A;  2K17 A;  5TBN A;  2M3H A;  3O33 A;  2F6J A;  2MIQ A;  3EB5 A;  2QIC A;  3O36 A;  5FB0 A;  2LV9 A;  3SOW A;  1T1H A;  4PPE A;  2MD7 B;  2Y1M A;  3N9O A;  3L1X A;  3U5N A;  5LCW B;  2L43 A;  2EGP A;  2LGL A;  2XEU A;  1G25 A;  4A4C A;  4I7C A;  2MNY A;  1LDJ B; 
#chains in the Genus database with same CATH topology
 3Q1D A;  4Q6F A;  3FL2 A;  4BBQ A;  2VNF A;  3FM8 C;  4LKA A;  5FB1 A;  2M85 A;  4C9Z A;  1Z6U A;  2E6S A;  1Z60 A;  5AIT A;  5H1V A;  2KYU A;  1XWH A;  2KWO A;  4AVX A;  2CSV A;  2P57 A;  2VJF B;  4V3K C;  2YSM A;  3LDY A;  4LAD B;  3SUB A;  2KU3 A;  2VJE A;  4QF3 A;  3N9Q A;  4YBM A;  4PTB A;  1JM7 A;  2FFW A;  2C2V S;  3ZVZ B;  2M1R A;  2HYE D;  2YUC A;  4CA1 A;  3ZPV 1;  4WA6 A;  3LQI A;  2Y1N A;  2LAU A;  2E61 A;  2HDP A;  3RPG C;  4A0C D;  3M7K A;  2H0D A;  3IHP A;  1WEV A;  5B75 A;  5LKZ A;  2G43 A;  5C11 A;  4FO9 A;  4LLB A;  1Z2Q A;  2JMD A;  4YBT A;  1WEP A;  1K2F A;  4N3W A;  3M62 A;  2Y43 A;  2LQ6 A;  3RPG B;  4IC2 A;  4V3L C;  2MA5 A;  2ECJ A;  2F42 A;  2BAY A;  5J3X A;  4W4U A;  2MD8 C;  1WEW A;  1MM3 A;  4WZ3 B;  4TKP B;  4R8P K;  2G45 A;  5TDR A;  3ZYQ A;  5B8D A;  2K4D A;  1F62 A;  5SVX A;  3PHD A;  5KH3 A;  4X3G A;  3PLW A;  5LKX A;  5KH7 A;  2MA6 A;  3ZTG A;  4A49 A;  1IYM A;  2YQM A;  2VPB A;  3EB6 A;  1X4U A;  2KWK A;  2M13 A;  2LGV A;  4QQ4 A;  2YSJ A;  2D8S A;  3LRQ A;  3ZPV E;  1WEM A;  2L80 A;  2ECW A;  3M63 A;  3ZVY A;  3HCT A;  3KV6 A;  1VD4 A;  4YAT A;  2K1J A;  2LDR A;  2KIZ A;  1WES A;  2RR4 A;  3JUE A;  4I7D A;  3KNV A;  2F6N A;  3FJU B;  3SHB A;  5D1L B;  2YHN A;  4IC3 A;  2EOD A;  2CT2 A;  3LVR E;  5C13 A;  4WZ0 A;  2JRJ A;  4AYC A;  2LXP C;  3KQI A;  2FUU A;  2ECI A;  2FD4 A;  1VFY A;  2XOY A;  2C2L A;  3LQH A;  2LN0 A;  4P5O B;  2MT5 A;  2IQJ A;  2XOZ A;  1WEN A;  5D1M B;  4GB0 A;  3GL6 A;  5AIU A;  5FER A;  2DSM A;  2JMI A;  1FBV A;  5H9M A;  3PUQ A;  3LJU X;  5JG6 A;  3C6W A;  2LXH C;  4S3O C;  5TDW A;  5TRB A;  4XI1 A;  4GND A;  2KR4 A;  2YU4 A;  4O62 A;  4O64 A;  4CCG X;  2JM3 A;  4GNE A;  5DKA A;  2IDA A;  1WEU A;  2MNZ A;  2VPE A;  2MUM A;  3L1Z B;  2CKL A;  4UI9 B;  2KWJ A;  2OWA A;  3RTR B;  2XP0 A;  1ZBD B;  2YQL A;  5TAB A;  3T9K A;  2M6M A;  2UZG A;  3O37 A;  3HCS A;  3MDB C;  1WIL A;  2JUN A;  2I50 A;  3N9L A;  4ZUX U;  1N87 A;  3M99 A;  4ZQL A;  3HTK C;  2YRE A;  3N9P A;  4YAX A;  2LGG A;  4UP0 A;  1FP0 A;  3KDE C;  4ZDT A;  3O7A A;  2CSZ A;  5SVY A;  1RMD A;  4MVT A;  1WEQ A;  3C5K A;  3LVQ E;  4F1P A;  5LKU A;  2CKL B;  3FAO A;  5H1T A;  3V43 A;  3HCU A;  3NG2 A;  2PNX A;  2ECN A;  1E4U A;  2D8U A;  5I3L A;  2LGK A;  2L5U A;  4I7B A;  3DQV R;  1DVP A;  4LK9 A;  4L7X A;  5B78 A;  5G04 B;  3LQJ A;  3PUR A;  2ECV A;  1LDK C;  5B77 A;  5K3Q A;  2RI7 A;  2XB1 A;  1U6G B;  4FK5 A;  2MKE A;  5DIN A;  3N9N A;  2L75 A;  4B86 C;  4AYC B;  2KWN A;  2AN6 A;  3VK6 A;  2K16 A;  2KRE A;  3QZV A;  2G6Q A;  2KGI A;  2KKY A;  2EA6 A;  1BOR A;  2EXU A;  4FJC A;  3ZNI A;  5EYA F;  3KV5 A;  2VPD A;  2DX8 A;  4GNG A;  5H1U A;  3MHS A;  2VJF A;  2FSA A;  4Z0R A;  2FUI A;  3SOX A;  5D1K B;  4YBS A;  2YVR A;  3SOU A;  4R7E A;  2KFT A;  2JMJ A;  4A4B A;  1HYJ A;  3E2D A;  2YHO A;  2YYR A;  4WZ2 A;  4AP4 A;  5G0F A;  5G05 B;  2VPG A;  4YAD A;  1WIM A;  2E6R A;  2XOC A;  2DJA A;  4YC9 A;  2YUR A;  3O47 A;  4S3O B;  1WGM A;  3N9M A;  2B0O E;  4L58 A;  2KGG A;  3DWD A;  4R2Y A;  3O35 A;  3T6R A;  2VP7 A;  4QF2 A;  2OXQ C;  3T7L A;  4YAB A;  3O34 A;  2NAA A;  5B76 A;  1X4J A;  4AUQ B;  1WE9 A;  2PUY A;  2ZET C;  4H9D A;  3L11 A;  4OGE A;  2RSD A;  1HYI A;  2CON A;  5B79 A;  2QIZ A;  4BHW A;  2ECG A;  4B7Y C;  2CSY A;  4UP5 A;  1DCQ A;  4Z0O A;  4MSX A;  1WEO A;  1V87 A;  3DPL R;  2YW8 A;  4F52 B;  1CHC A;  1JOC A;  2LRI C;  2EGM A;  3O70 A;  3U5O A;  3GV4 A;  4N4F A;  3I2D A;  3U5P A;  3ASL A;  4NN2 A;  1X4I A;  2H0D B;  5LKT A;  4GNF A;  2L0B A;  2VJE B;  1MM2 A;  4LJN A;  2QJ0 A;  1JM7 B;  2KKX A;  5FEY A;  2KE1 A;  3FEH A;  5KH9 A;  3U5M A;  5SVI A;  1WEE A;  3MHH A;  4FIP A;  1VYX A;  2YT5 A;  2ECT A;  1WFK A;  2K17 A;  5TBN A;  2M3H A;  3O33 A;  2F6J A;  2MIQ A;  3EB5 A;  2QIC A;  3O36 A;  5FB0 A;  2LV9 A;  2L7P A;  1MBM A;  2CRR A;  3FAN A;  3SOW A;  1T1H A;  4PPE A;  4OGC A;  2MD7 B;  2Y1M A;  3N9O A;  3L1X A;  2CRW A;  3U5N A;  5SVI B;  5LCW B;  3DDT A;  3H7H A;  2L43 A;  2EGP A;  2LGL A;  2XEU A;  1G25 A;  4A4C A;  4I7C A;  2MNY A;  1LDJ B; 
#chains in the Genus database with same CATH homology
 4Q6F A;  3FL2 A;  4BBQ A;  2VNF A;  4LKA A;  5FB1 A;  2M85 A;  4C9Z A;  1Z6U A;  2E6S A;  1Z60 A;  5AIT A;  5H1V A;  2KYU A;  1XWH A;  2KWO A;  4AVX A;  2VJF B;  4V3K C;  2YSM A;  4LAD B;  2KU3 A;  2VJE A;  4QF3 A;  3N9Q A;  4YBM A;  4PTB A;  1JM7 A;  2C2V S;  3ZVZ B;  2M1R A;  2HYE D;  2YUC A;  4CA1 A;  3ZPV 1;  4WA6 A;  3LQI A;  2Y1N A;  2HDP A;  3RPG C;  4A0C D;  2H0D A;  3IHP A;  1WEV A;  5B75 A;  5LKZ A;  2G43 A;  5C11 A;  4FO9 A;  4LLB A;  1Z2Q A;  2JMD A;  4YBT A;  1WEP A;  1K2F A;  4N3W A;  3M62 A;  2Y43 A;  2LQ6 A;  3RPG B;  4IC2 A;  4V3L C;  2MA5 A;  2ECJ A;  2F42 A;  2BAY A;  5J3X A;  4W4U A;  2MD8 C;  1WEW A;  1MM3 A;  4WZ3 B;  4TKP B;  4R8P K;  2G45 A;  5TDR A;  3ZYQ A;  5B8D A;  2K4D A;  1F62 A;  3PHD A;  5KH3 A;  4X3G A;  5LKX A;  5KH7 A;  2MA6 A;  3ZTG A;  4A49 A;  1IYM A;  2YQM A;  2VPB A;  3EB6 A;  1X4U A;  2KWK A;  2LGV A;  2YSJ A;  2D8S A;  3LRQ A;  3ZPV E;  1WEM A;  2L80 A;  2ECW A;  3M63 A;  3ZVY A;  3HCT A;  3KV6 A;  1VD4 A;  4YAT A;  2K1J A;  2LDR A;  2KIZ A;  1WES A;  4I7D A;  3KNV A;  2F6N A;  3SHB A;  5D1L B;  2YHN A;  4IC3 A;  2EOD A;  2CT2 A;  5C13 A;  4WZ0 A;  2JRJ A;  4AYC A;  2LXP C;  3KQI A;  2FUU A;  2ECI A;  1VFY A;  2C2L A;  3LQH A;  2LN0 A;  4P5O B;  2MT5 A;  1WEN A;  5D1M B;  4GB0 A;  3GL6 A;  5AIU A;  5FER A;  2JMI A;  1FBV A;  5H9M A;  3PUQ A;  5JG6 A;  3C6W A;  2LXH C;  4S3O C;  5TDW A;  5TRB A;  4XI1 A;  4GND A;  2KR4 A;  2YU4 A;  4O64 A;  4CCG X;  4GNE A;  5DKA A;  2IDA A;  1WEU A;  2MNZ A;  2VPE A;  2MUM A;  3L1Z B;  2CKL A;  4UI9 B;  2KWJ A;  3RTR B;  1ZBD B;  2YQL A;  5TAB A;  2M6M A;  2UZG A;  3O37 A;  3HCS A;  1WIL A;  2I50 A;  3N9L A;  4ZUX U;  1N87 A;  3M99 A;  4ZQL A;  3HTK C;  2YRE A;  3N9P A;  4YAX A;  2LGG A;  4UP0 A;  1FP0 A;  4ZDT A;  3O7A A;  2CSZ A;  1RMD A;  4MVT A;  1WEQ A;  3C5K A;  5LKU A;  2CKL B;  5H1T A;  3V43 A;  3HCU A;  3NG2 A;  2PNX A;  2ECN A;  1E4U A;  5I3L A;  2LGK A;  2L5U A;  4I7B A;  3DQV R;  1DVP A;  4LK9 A;  4L7X A;  5B78 A;  5G04 B;  3LQJ A;  3PUR A;  2ECV A;  1LDK C;  5B77 A;  2RI7 A;  2XB1 A;  1U6G B;  4FK5 A;  5DIN A;  3N9N A;  2L75 A;  4B86 C;  4AYC B;  2KWN A;  2AN6 A;  3VK6 A;  2K16 A;  2KRE A;  3QZV A;  2G6Q A;  2KGI A;  2EA6 A;  1BOR A;  4FJC A;  3ZNI A;  5EYA F;  3KV5 A;  2VPD A;  2DX8 A;  4GNG A;  5H1U A;  3MHS A;  2VJF A;  2FSA A;  2FUI A;  3SOX A;  5D1K B;  4YBS A;  3SOU A;  4R7E A;  2KFT A;  2JMJ A;  4A4B A;  1HYJ A;  2YHO A;  2YYR A;  4WZ2 A;  4AP4 A;  5G0F A;  5G05 B;  2VPG A;  4YAD A;  1WIM A;  2E6R A;  4YC9 A;  2YUR A;  4S3O B;  1WGM A;  3N9M A;  4L58 A;  2KGG A;  4R2Y A;  3O35 A;  3T6R A;  2VP7 A;  4QF2 A;  2OXQ C;  3T7L A;  4YAB A;  3O34 A;  2NAA A;  5B76 A;  4AUQ B;  1X4J A;  1WE9 A;  2PUY A;  2ZET C;  3L11 A;  2RSD A;  1HYI A;  5B79 A;  2QIZ A;  4BHW A;  2ECG A;  4B7Y C;  2CSY A;  4UP5 A;  4MSX A;  1WEO A;  1V87 A;  3DPL R;  2YW8 A;  4F52 B;  1CHC A;  1JOC A;  2LRI C;  3O70 A;  3U5O A;  3GV4 A;  4N4F A;  3I2D A;  3U5P A;  3ASL A;  4NN2 A;  1X4I A;  2H0D B;  5LKT A;  4GNF A;  2L0B A;  2VJE B;  1MM2 A;  4LJN A;  2QJ0 A;  1JM7 B;  5FEY A;  2KE1 A;  5KH9 A;  3U5M A;  1WEE A;  3MHH A;  4FIP A;  1VYX A;  2YT5 A;  2ECT A;  1WFK A;  2K17 A;  5TBN A;  2M3H A;  3O33 A;  2F6J A;  2MIQ A;  3EB5 A;  2QIC A;  3O36 A;  5FB0 A;  2LV9 A;  3SOW A;  1T1H A;  4PPE A;  2MD7 B;  2Y1M A;  3N9O A;  3L1X A;  3U5N A;  5LCW B;  2L43 A;  2EGP A;  2LGL A;  2XEU A;  1G25 A;  4A4C A;  4I7C A;  2MNY A;  1LDJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...