4B86C

Crystal structure of the msl1-msl2 complex (3.5a)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
b'MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 30
structure length 115
sequence length 115
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b86C00
4YABA 3ZPVE 2LRIC 4I7CA 2G45A 1U6GB 2VJFB 2QJ0A 4YATA 1WEOA 4N3WA 2Y1NA 3ZNIA 2MD7B 3ZYQA 5AITA 4AYCB 2E6SA 1HYIA 2YHOA 1LDJB 2KYUA 2CSZA 1RMDA 2KGGA 2FUIA 2LV9A 2MA6A 2OXQC 3RPGC 1Z6UA 1N87A 3O36A 2VNFA 3SOXA 3O70A 1VD4A 2KWJA 5LKXA 2LGVA 4YBTA 5DINA 4GNFA 2JMDA 4ZUXU 4YBMA 3U5MA 5KH3A 2I50A 1DVPA 4FJCA 3L1XA 2LGGA 4GNDA 2CSYA 3RTRB 1IYMA 1X4JA 2ECVA 3KV6A 2CT2A 3O35A 4N4FA 3O37A 4MSXA 5TABA 1VFYA 3I2DA 3ASLA 2H0DB 3IHPA 2LXHC 5FB0A 2VP7A 5H1UA 2LXPC 2C2LA 2Y1MA 3NG2A 4FK5A 2LGKA 4WZ0A 2IDAA 4NN2A 2LGLA 2YHNA 5LKTA 4R7EA 2MD8C 4V3KC 5LCWB 4QF3A 5G0FA 1WEUA 4P5OB 2L75A 1WEMA 5I3LA 2ECIA 3LQJA 3ZPV1 4UP0A 3HCSA 2ECJA 2KWOA 3VK6A 3SOWA 1LDKC 2JMJA 3ZTGA 5JG6A 5TDWA 1X4UA 2F6JA 3M63A 3T7LA 1WFKA 5B77A 5J3XA 2MIQA 5C13A 5FERA 4QF2A 2ECGA 4Q6FA 1WE9A 2VPDA 4WZ3B 2LQ6A 4WZ2A 2ZETC 2F42A 2KREA 3L1ZB 4B86C 3N9OA 2YQLA 4FO9A 3KNVA 1VYXA 2YURA 3DQVR 3M62A 2AN6A 2MUMA 4TKPB 4LADB 3LQIA 1X4IA 3GL6A 2BAYA 4LK9A 3HCUA 1FP0A 2RI7A 2FSAA 4CCGX 2PNXA 2Y43A 3N9MA 1WEWA 4YADA 4XI1A 4YBSA 3ZVZB 2YSJA 1MM2A 2E6RA 3GV4A 2LN0A 2G6QA 1Z60A 4YC9A 3ZVYA 1WENA 4S3OB 4B7YC 4BHWA 2M1RA 3U5NA 4AVXA 1JOCA 5B75A 5FB1A 1E4UA 5B76A 1V87A 5LKZA 4AUQB 2C2VS 3U5PA 5D1MB 2KR4A 4YAXA 4I7DA 2VPEA 4I7BA 4R8PK 2RSDA 1Z2QA 4F52B 1K2FA 3LRQA 2UZGA 3O34A 4L58A 3N9PA 3KQIA 2CKLA 2YQMA 2VJEB 2M85A 3N9NA 3O7AA 2YUCA 3T6RA 2EGPA 5TBNA 2L5UA 3C6WA 5H1VA 3PUQA 2VPGA 2PUYA 2MNYA 1WIMA 1WGMA 4AP4A 2VJEA 4PTBA 4IC3A 4FIPA 3HTKC 2MNZA 2ECTA 4LJNA 5B79A 5EYAF 1F62A 1MM3A 2XB1A 5B8DA 2NAAA 2EA6A 3QZVA 5TDRA 5D1LB 4C9ZA 2K4DA 1JM7A 5G05B 3SOUA 2MT5A 2KGIA 3L11A 4A4CA 2KWKA 2KE1A 2L0BA 2QICA 4V3LC 5H1TA 3HCTA 3V43A 2ECWA 4S3OC 5LKUA 2YU4A 4GNGA 5D1KB 2KIZA 2K1JA 2G43A 2VJFA 1WESA 3C5KA 3MHSA 1WEVA 5KH7A 1HYJA 3MHHA 4MVTA 1WEPA 2XEUA 2KFTA 2D8SA 4AYCA 2LDRA 4CA1A 1BORA 4A4BA 2JMIA 2FUUA 5DKAA 5C11A 1ZBDB 2YYRA 3EB5A 3DPLR 2ECNA 4GNEA 4LKAA 5TRBA 2M3HA 3SHBA 4PPEA 2L43A 2F6NA 3RPGB 2CKLB 2EODA 4ZQLA 4L7XA 1T1HA 4O64A 2YW8A 2MA5A 3M99A 5FEYA 5G04B 2HYED 5KH9A 3LQHA 5AIUA 2YSMA 2K17A 3PURA 1WILA 1WEEA 4UI9B 3PHDA 4W4UA 2QIZA 1FBVA 4BBQA 4X3GA 4UP5A 5B78A 1CHCA 2K16A 3O33A 2M6MA 2YREA 3N9QA 2HDPA 2KU3A 2VPBA 4A49A 3KV5A 2H0DA 4WA6A 1G25A 1JM7B 4ZDTA 2JRJA 3FL2A 1XWHA 4R2YA 3U5OA 2L80A 2KWNA 2YT5A 2DX8A 1WEQA 3EB6A 4A0CD 4GB0A 4IC2A 5H9MA 3N9LA 4LLBA
chains in the Genus database with same CATH superfamily
4YABA 4QQ4A 3ZPVE 2LRIC 4I7CA 2G45A 1U6GB 2VJFB 5SVXA 4OGCA 2QJ0A 4YATA 1WEOA 4N3WA 2Y1NA 3ZNIA 2MD7B 3ZYQA 5AITA 4AYCB 2E6SA 3DDTA 1HYIA 2YHOA 1LDJB 2KYUA 2CSZA 1RMDA 2KGGA 4H9DA 2FUIA 2LV9A 2MA6A 2OXQC 3RPGC 1Z6UA 1N87A 3O36A 2FD4A 2VNFA 2YVRA 3SOXA 3O70A 1VD4A 2KWJA 5LKXA 2LGVA 4YBTA 5DINA 4GNFA 2JMDA 2EXUA 2DJAA 4ZUXU 4YBMA 3U5MA 5KH3A 2I50A 1DVPA 4FJCA 3L1XA 3O47A 2LGGA 3FEHA 2CSYA 4GNDA 3SUBA 3RTRB 1IYMA 1X4JA 2XP0A 2ECVA 3KV6A 5K3QA 2CT2A 3O35A 4N4FA 3O37A 4MSXA 5TABA 1VFYA 3I2DA 3ASLA 2H0DB 3IHPA 2LXHC 5FB0A 2VP7A 5H1UA 3KDEC 2LXPC 2C2LA 2RR4A 2Y1MA 3NG2A 4FK5A 2LGKA 4WZ0A 2JM3A 2IDAA 4NN2A 2LGLA 2YHNA 5LKTA 4R7EA 2MD8C 4V3KC 5LCWB 4QF3A 3MDBC 5G0FA 1WEUA 4P5OB 2L75A 3LDYA 1WEMA 5I3LA 2ECIA 3LQJA 3ZPV1 4UP0A 3HCSA 2ECJA 2KWOA 3VK6A 3SOWA 2CRWA 1LDKC 5SVYA 2JMJA 3ZTGA 5JG6A 5TDWA 1X4UA 2F6JA 3M63A 3T7LA 1WFKA 5B77A 2L7PA 2KKYA 5J3XA 2MIQA 5C13A 5FERA 3FANA 4QF2A 2ECGA 4Q6FA 2MKEA 1WE9A 2VPDA 4WZ3B 2LQ6A 4WZ2A 2ZETC 2CRRA 2F42A 2KREA 3L1ZB 4B86C 3N9OA 2YQLA 4FO9A 3LVQE 2IQJA 3KNVA 2XOYA 1VYXA 2XOZA 2YURA 2EGMA 3DQVR 3M62A 2AN6A 2MUMA 4TKPB 4LADB 4O62A 3LQIA 1X4IA 3GL6A 2BAYA 4LK9A 3T9KA 3HCUA 1FP0A 2RI7A 2FSAA 4CCGX 2PNXA 2Y43A 3N9MA 1WEWA 4YADA 4XI1A 4YBSA 3ZVZB 2YSJA 1MM2A 2E6RA 3JUEA 3GV4A 5SVIA 3FAOA 2LN0A 3E2DA 2G6QA 1Z60A 4YC9A 3ZVYA 1WENA 4S3OB 4B7YC 4BHWA 2M1RA 3U5NA 4Z0RA 4AVXA 1JOCA 5B75A 5FB1A 1E4UA 5B76A 1V87A 5LKZA 4AUQB 2C2VS 3U5PA 5D1MB 2KR4A 4YAXA 4I7DA 2VPEA 2P57A 4I7BA 2OWAA 4R8PK 2RSDA 1Z2QA 4F52B 1K2FA 3LRQA 2UZGA 2D8UA 3O34A 1DCQA 4L58A 3N9PA 3KQIA 2CKLA 2YQMA 2VJEB 2M85A 3N9NA 3O7AA 2YUCA 3FM8C 3T6RA 2EGPA 5TBNA 2L5UA 3C6WA 5H1VA 3PUQA 2XOCA 2VPGA 2PUYA 2MNYA 1WIMA 1WGMA 4AP4A 2VJEA 4PTBA 4IC3A 4FIPA 3HTKC 2MNZA 2ECTA 4LJNA 5B79A 5EYAF 3Q1DA 1F62A 1MM3A 2XB1A 5B8DA 4OGEA 2NAAA 2EA6A 3QZVA 5TDRA 5D1LB 4C9ZA 2K4DA 1JM7A 5G05B 3SOUA 2MT5A 2KGIA 3L11A 4A4CA 2KWKA 2KE1A 2L0BA 2QICA 4V3LC 5H1TA 3HCTA 3V43A 2ECWA 4S3OC 5LKUA 2YU4A 4GNGA 2M13A 5D1KB 3PLWA 2B0OE 2KIZA 5SVIB 2K1JA 2G43A 2VJFA 1WESA 3DWDA 3C5KA 3MHSA 1WEVA 5KH7A 1HYJA 2KKXA 3MHHA 4MVTA 1WEPA 2XEUA 2KFTA 2D8SA 4AYCA 2LDRA 4CA1A 1BORA 2CONA 4A4BA 3FJUB 2JMIA 2FUUA 5DKAA 5C11A 1ZBDB 2YYRA 3EB5A 3DPLR 2ECNA 4GNEA 4LKAA 5TRBA 2M3HA 3LVRE 3SHBA 4PPEA 2L43A 2F6NA 3RPGB 2CKLB 2EODA 4ZQLA 4L7XA 4O64A 1T1HA 2YW8A 2MA5A 4Z0OA 3M99A 5FEYA 5G04B 2HYED 5KH9A 3LQHA 5AIUA 2YSMA 2FFWA 2K17A 3PURA 3LJUX 1WILA 1WEEA 1MBMA 4UI9B 3PHDA 4W4UA 3M7KA 2DSMA 2QIZA 1FBVA 4BBQA 4X3GA 4UP5A 5B78A 2LAUA 1CHCA 2K16A 2CSVA 3O33A 3H7HA 2M6MA 2YREA 3N9QA 2HDPA 2KU3A 2VPBA 4F1PA 4A49A 3KV5A 2H0DA 4WA6A 1G25A 1JM7B 4ZDTA 2JRJA 3FL2A 1XWHA 4R2YA 3U5OA 2L80A 2KWNA 2E61A 2YT5A 2DX8A 2JUNA 1WEQA 3EB6A 4A0CD 4GB0A 4IC2A 5H9MA 3N9LA 4LLBA
chains in the Genus database with same CATH topology
4YABA 3ZPVE 2LRIC 4I7CA 2G45A 1U6GB 2VJFB 2QJ0A 4YATA 1WEOA 4N3WA 2Y1NA 3ZNIA 2MD7B 3ZYQA 5AITA 4AYCB 2E6SA 1HYIA 2YHOA 1LDJB 2KYUA 2CSZA 1RMDA 2KGGA 2FUIA 2LV9A 2MA6A 2OXQC 3RPGC 1Z6UA 1N87A 3O36A 2VNFA 3SOXA 3O70A 1VD4A 2KWJA 5LKXA 2LGVA 4YBTA 5DINA 4GNFA 2JMDA 4ZUXU 4YBMA 3U5MA 5KH3A 2I50A 1DVPA 4FJCA 3L1XA 2LGGA 4GNDA 2CSYA 3RTRB 1IYMA 1X4JA 2ECVA 3KV6A 2CT2A 3O35A 4N4FA 3O37A 4MSXA 5TABA 1VFYA 3I2DA 3ASLA 2H0DB 3IHPA 2LXHC 5FB0A 2VP7A 5H1UA 2LXPC 2C2LA 2Y1MA 3NG2A 4FK5A 2LGKA 4WZ0A 2IDAA 4NN2A 2LGLA 2YHNA 5LKTA 4R7EA 2MD8C 4V3KC 5LCWB 4QF3A 5G0FA 1WEUA 4P5OB 2L75A 1WEMA 5I3LA 2ECIA 3LQJA 3ZPV1 4UP0A 3HCSA 2ECJA 2KWOA 3VK6A 3SOWA 1LDKC 2JMJA 3ZTGA 5JG6A 5TDWA 1X4UA 2F6JA 3M63A 3T7LA 1WFKA 5B77A 5J3XA 2MIQA 5C13A 5FERA 4QF2A 2ECGA 4Q6FA 1WE9A 2VPDA 4WZ3B 2LQ6A 4WZ2A 2ZETC 2F42A 2KREA 3L1ZB 4B86C 3N9OA 2YQLA 4FO9A 3KNVA 1VYXA 2YURA 3DQVR 3M62A 2AN6A 2MUMA 4TKPB 4LADB 3LQIA 1X4IA 3GL6A 2BAYA 4LK9A 3HCUA 1FP0A 2RI7A 2FSAA 4CCGX 2PNXA 2Y43A 3N9MA 1WEWA 4YADA 4XI1A 4YBSA 3ZVZB 2YSJA 1MM2A 2E6RA 3GV4A 2LN0A 2G6QA 1Z60A 4YC9A 3ZVYA 1WENA 4S3OB 4B7YC 4BHWA 2M1RA 3U5NA 4AVXA 1JOCA 5B75A 5FB1A 1E4UA 5B76A 1V87A 5LKZA 4AUQB 2C2VS 3U5PA 5D1MB 2KR4A 4YAXA 4I7DA 2VPEA 4I7BA 4R8PK 2RSDA 1Z2QA 4F52B 1K2FA 3LRQA 2UZGA 3O34A 4L58A 3N9PA 3KQIA 2CKLA 2YQMA 2VJEB 2M85A 3N9NA 3O7AA 2YUCA 3T6RA 2EGPA 5TBNA 2L5UA 3C6WA 5H1VA 3PUQA 2VPGA 2PUYA 2MNYA 1WIMA 1WGMA 4AP4A 2VJEA 4PTBA 4IC3A 4FIPA 3HTKC 2MNZA 2ECTA 4LJNA 5B79A 5EYAF 1F62A 1MM3A 2XB1A 5B8DA 2NAAA 2EA6A 3QZVA 5TDRA 5D1LB 4C9ZA 2K4DA 1JM7A 5G05B 3SOUA 2MT5A 2KGIA 3L11A 4A4CA 2KWKA 2KE1A 2L0BA 2QICA 4V3LC 5H1TA 3HCTA 3V43A 2ECWA 4S3OC 5LKUA 2YU4A 4GNGA 5D1KB 2KIZA 2K1JA 2G43A 2VJFA 1WESA 3C5KA 3MHSA 1WEVA 5KH7A 1HYJA 3MHHA 4MVTA 1WEPA 2XEUA 2KFTA 2D8SA 4AYCA 2LDRA 4CA1A 1BORA 4A4BA 2JMIA 2FUUA 5DKAA 5C11A 1ZBDB 2YYRA 3EB5A 3DPLR 2ECNA 4GNEA 4LKAA 5TRBA 2M3HA 3SHBA 4PPEA 2L43A 2F6NA 3RPGB 2CKLB 2EODA 4ZQLA 4L7XA 1T1HA 4O64A 2YW8A 2MA5A 3M99A 5FEYA 5G04B 2HYED 5KH9A 3LQHA 5AIUA 2YSMA 2K17A 3PURA 1WILA 1WEEA 4UI9B 3PHDA 4W4UA 2QIZA 1FBVA 4BBQA 4X3GA 4UP5A 5B78A 1CHCA 2K16A 3O33A 2M6MA 2YREA 3N9QA 2HDPA 2KU3A 2VPBA 4A49A 3KV5A 2H0DA 4WA6A 1G25A 1JM7B 4ZDTA 2JRJA 3FL2A 1XWHA 4R2YA 3U5OA 2L80A 2KWNA 2YT5A 2DX8A 1WEQA 3EB6A 4A0CD 4GB0A 4IC2A 5H9MA 3N9LA 4LLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAB A;  3ZPV E;  2LRI C;  4I7C A;  2G45 A;  1U6G B;  2VJF B;  2QJ0 A;  4YAT A;  1WEO A;  4N3W A;  2Y1N A;  3ZNI A;  2MD7 B;  3ZYQ A;  5AIT A;  4AYC B;  2E6S A;  1HYI A;  2YHO A;  1LDJ B;  2KYU A;  2CSZ A;  1RMD A;  2KGG A;  2FUI A;  2LV9 A;  2MA6 A;  2OXQ C;  3RPG C;  1Z6U A;  1N87 A;  3O36 A;  2VNF A;  3SOX A;  3O70 A;  1VD4 A;  2KWJ A;  5LKX A;  2LGV A;  4YBT A;  5DIN A;  4GNF A;  2JMD A;  4ZUX U;  4YBM A;  3U5M A;  5KH3 A;  2I50 A;  1DVP A;  4FJC A;  3L1X A;  2LGG A;  4GND A;  2CSY A;  3RTR B;  1IYM A;  1X4J A;  2ECV A;  3KV6 A;  2CT2 A;  3O35 A;  4N4F A;  3O37 A;  4MSX A;  5TAB A;  1VFY A;  3I2D A;  3ASL A;  2H0D B;  3IHP A;  2LXH C;  5FB0 A;  2VP7 A;  5H1U A;  2LXP C;  2C2L A;  2Y1M A;  3NG2 A;  4FK5 A;  2LGK A;  4WZ0 A;  2IDA A;  4NN2 A;  2LGL A;  2YHN A;  5LKT A;  4R7E A;  2MD8 C;  4V3K C;  5LCW B;  4QF3 A;  5G0F A;  1WEU A;  4P5O B;  2L75 A;  1WEM A;  5I3L A;  2ECI A;  3LQJ A;  3ZPV 1;  4UP0 A;  3HCS A;  2ECJ A;  2KWO A;  3VK6 A;  3SOW A;  1LDK C;  2JMJ A;  3ZTG A;  5JG6 A;  5TDW A;  1X4U A;  2F6J A;  3M63 A;  3T7L A;  1WFK A;  5B77 A;  5J3X A;  2MIQ A;  5C13 A;  5FER A;  4QF2 A;  2ECG A;  4Q6F A;  1WE9 A;  2VPD A;  4WZ3 B;  2LQ6 A;  4WZ2 A;  2ZET C;  2F42 A;  2KRE A;  3L1Z B;  4B86 C;  3N9O A;  2YQL A;  4FO9 A;  3KNV A;  1VYX A;  2YUR A;  3DQV R;  3M62 A;  2AN6 A;  2MUM A;  4TKP B;  4LAD B;  3LQI A;  1X4I A;  3GL6 A;  2BAY A;  4LK9 A;  3HCU A;  1FP0 A;  2RI7 A;  2FSA A;  4CCG X;  2PNX A;  2Y43 A;  3N9M A;  1WEW A;  4YAD A;  4XI1 A;  4YBS A;  3ZVZ B;  2YSJ A;  1MM2 A;  2E6R A;  3GV4 A;  2LN0 A;  2G6Q A;  1Z60 A;  4YC9 A;  3ZVY A;  1WEN A;  4S3O B;  4B7Y C;  4BHW A;  2M1R A;  3U5N A;  4AVX A;  1JOC A;  5B75 A;  5FB1 A;  1E4U A;  5B76 A;  1V87 A;  5LKZ A;  4AUQ B;  2C2V S;  3U5P A;  5D1M B;  2KR4 A;  4YAX A;  4I7D A;  2VPE A;  4I7B A;  4R8P K;  2RSD A;  1Z2Q A;  4F52 B;  1K2F A;  3LRQ A;  2UZG A;  3O34 A;  4L58 A;  3N9P A;  3KQI A;  2CKL A;  2YQM A;  2VJE B;  2M85 A;  3N9N A;  3O7A A;  2YUC A;  3T6R A;  2EGP A;  5TBN A;  2L5U A;  3C6W A;  5H1V A;  3PUQ A;  2VPG A;  2PUY A;  2MNY A;  1WIM A;  1WGM A;  4AP4 A;  2VJE A;  4PTB A;  4IC3 A;  4FIP A;  3HTK C;  2MNZ A;  2ECT A;  4LJN A;  5B79 A;  5EYA F;  1F62 A;  1MM3 A;  2XB1 A;  5B8D A;  2NAA A;  2EA6 A;  3QZV A;  5TDR A;  5D1L B;  4C9Z A;  2K4D A;  1JM7 A;  5G05 B;  3SOU A;  2MT5 A;  2KGI A;  3L11 A;  4A4C A;  2KWK A;  2KE1 A;  2L0B A;  2QIC A;  4V3L C;  5H1T A;  3HCT A;  3V43 A;  2ECW A;  4S3O C;  5LKU A;  2YU4 A;  4GNG A;  5D1K B;  2KIZ A;  2K1J A;  2G43 A;  2VJF A;  1WES A;  3C5K A;  3MHS A;  1WEV A;  5KH7 A;  1HYJ A;  3MHH A;  4MVT A;  1WEP A;  2XEU A;  2KFT A;  2D8S A;  4AYC A;  2LDR A;  4CA1 A;  1BOR A;  4A4B A;  2JMI A;  2FUU A;  5DKA A;  5C11 A;  1ZBD B;  2YYR A;  3EB5 A;  3DPL R;  2ECN A;  4GNE A;  4LKA A;  5TRB A;  2M3H A;  3SHB A;  4PPE A;  2L43 A;  2F6N A;  3RPG B;  2CKL B;  2EOD A;  4ZQL A;  4L7X A;  1T1H A;  4O64 A;  2YW8 A;  2MA5 A;  3M99 A;  5FEY A;  5G04 B;  2HYE D;  5KH9 A;  3LQH A;  5AIU A;  2YSM A;  2K17 A;  3PUR A;  1WIL A;  1WEE A;  4UI9 B;  3PHD A;  4W4U A;  2QIZ A;  1FBV A;  4BBQ A;  4X3G A;  4UP5 A;  5B78 A;  1CHC A;  2K16 A;  3O33 A;  2M6M A;  2YRE A;  3N9Q A;  2HDP A;  2KU3 A;  2VPB A;  4A49 A;  3KV5 A;  2H0D A;  4WA6 A;  1G25 A;  1JM7 B;  4ZDT A;  2JRJ A;  3FL2 A;  1XWH A;  4R2Y A;  3U5O A;  2L80 A;  2KWN A;  2YT5 A;  2DX8 A;  1WEQ A;  3EB6 A;  4A0C D;  4GB0 A;  4IC2 A;  5H9M A;  3N9L A;  4LLB A; 
#chains in the Genus database with same CATH topology
 4YAB A;  4QQ4 A;  3ZPV E;  2LRI C;  4I7C A;  2G45 A;  1U6G B;  2VJF B;  5SVX A;  4OGC A;  2QJ0 A;  4YAT A;  1WEO A;  4N3W A;  2Y1N A;  3ZNI A;  2MD7 B;  3ZYQ A;  5AIT A;  4AYC B;  2E6S A;  3DDT A;  1HYI A;  2YHO A;  1LDJ B;  2KYU A;  2CSZ A;  1RMD A;  2KGG A;  4H9D A;  2FUI A;  2LV9 A;  2MA6 A;  2OXQ C;  3RPG C;  1Z6U A;  1N87 A;  3O36 A;  2FD4 A;  2VNF A;  2YVR A;  3SOX A;  3O70 A;  1VD4 A;  2KWJ A;  5LKX A;  2LGV A;  4YBT A;  5DIN A;  4GNF A;  2JMD A;  2EXU A;  2DJA A;  4ZUX U;  4YBM A;  3U5M A;  5KH3 A;  2I50 A;  1DVP A;  4FJC A;  3L1X A;  3O47 A;  2LGG A;  3FEH A;  2CSY A;  4GND A;  3SUB A;  3RTR B;  1IYM A;  1X4J A;  2XP0 A;  2ECV A;  3KV6 A;  5K3Q A;  2CT2 A;  3O35 A;  4N4F A;  3O37 A;  4MSX A;  5TAB A;  1VFY A;  3I2D A;  3ASL A;  2H0D B;  3IHP A;  2LXH C;  5FB0 A;  2VP7 A;  5H1U A;  3KDE C;  2LXP C;  2C2L A;  2RR4 A;  2Y1M A;  3NG2 A;  4FK5 A;  2LGK A;  4WZ0 A;  2JM3 A;  2IDA A;  4NN2 A;  2LGL A;  2YHN A;  5LKT A;  4R7E A;  2MD8 C;  4V3K C;  5LCW B;  4QF3 A;  3MDB C;  5G0F A;  1WEU A;  4P5O B;  2L75 A;  3LDY A;  1WEM A;  5I3L A;  2ECI A;  3LQJ A;  3ZPV 1;  4UP0 A;  3HCS A;  2ECJ A;  2KWO A;  3VK6 A;  3SOW A;  2CRW A;  1LDK C;  5SVY A;  2JMJ A;  3ZTG A;  5JG6 A;  5TDW A;  1X4U A;  2F6J A;  3M63 A;  3T7L A;  1WFK A;  5B77 A;  2L7P A;  2KKY A;  5J3X A;  2MIQ A;  5C13 A;  5FER A;  3FAN A;  4QF2 A;  2ECG A;  4Q6F A;  2MKE A;  1WE9 A;  2VPD A;  4WZ3 B;  2LQ6 A;  4WZ2 A;  2ZET C;  2CRR A;  2F42 A;  2KRE A;  3L1Z B;  4B86 C;  3N9O A;  2YQL A;  4FO9 A;  3LVQ E;  2IQJ A;  3KNV A;  2XOY A;  1VYX A;  2XOZ A;  2YUR A;  2EGM A;  3DQV R;  3M62 A;  2AN6 A;  2MUM A;  4TKP B;  4LAD B;  4O62 A;  3LQI A;  1X4I A;  3GL6 A;  2BAY A;  4LK9 A;  3T9K A;  3HCU A;  1FP0 A;  2RI7 A;  2FSA A;  4CCG X;  2PNX A;  2Y43 A;  3N9M A;  1WEW A;  4YAD A;  4XI1 A;  4YBS A;  3ZVZ B;  2YSJ A;  1MM2 A;  2E6R A;  3JUE A;  3GV4 A;  5SVI A;  3FAO A;  2LN0 A;  3E2D A;  2G6Q A;  1Z60 A;  4YC9 A;  3ZVY A;  1WEN A;  4S3O B;  4B7Y C;  4BHW A;  2M1R A;  3U5N A;  4Z0R A;  4AVX A;  1JOC A;  5B75 A;  5FB1 A;  1E4U A;  5B76 A;  1V87 A;  5LKZ A;  4AUQ B;  2C2V S;  3U5P A;  5D1M B;  2KR4 A;  4YAX A;  4I7D A;  2VPE A;  2P57 A;  4I7B A;  2OWA A;  4R8P K;  2RSD A;  1Z2Q A;  4F52 B;  1K2F A;  3LRQ A;  2UZG A;  2D8U A;  3O34 A;  1DCQ A;  4L58 A;  3N9P A;  3KQI A;  2CKL A;  2YQM A;  2VJE B;  2M85 A;  3N9N A;  3O7A A;  2YUC A;  3FM8 C;  3T6R A;  2EGP A;  5TBN A;  2L5U A;  3C6W A;  5H1V A;  3PUQ A;  2XOC A;  2VPG A;  2PUY A;  2MNY A;  1WIM A;  1WGM A;  4AP4 A;  2VJE A;  4PTB A;  4IC3 A;  4FIP A;  3HTK C;  2MNZ A;  2ECT A;  4LJN A;  5B79 A;  5EYA F;  3Q1D A;  1F62 A;  1MM3 A;  2XB1 A;  5B8D A;  4OGE A;  2NAA A;  2EA6 A;  3QZV A;  5TDR A;  5D1L B;  4C9Z A;  2K4D A;  1JM7 A;  5G05 B;  3SOU A;  2MT5 A;  2KGI A;  3L11 A;  4A4C A;  2KWK A;  2KE1 A;  2L0B A;  2QIC A;  4V3L C;  5H1T A;  3HCT A;  3V43 A;  2ECW A;  4S3O C;  5LKU A;  2YU4 A;  4GNG A;  2M13 A;  5D1K B;  3PLW A;  2B0O E;  2KIZ A;  5SVI B;  2K1J A;  2G43 A;  2VJF A;  1WES A;  3DWD A;  3C5K A;  3MHS A;  1WEV A;  5KH7 A;  1HYJ A;  2KKX A;  3MHH A;  4MVT A;  1WEP A;  2XEU A;  2KFT A;  2D8S A;  4AYC A;  2LDR A;  4CA1 A;  1BOR A;  2CON A;  4A4B A;  3FJU B;  2JMI A;  2FUU A;  5DKA A;  5C11 A;  1ZBD B;  2YYR A;  3EB5 A;  3DPL R;  2ECN A;  4GNE A;  4LKA A;  5TRB A;  2M3H A;  3LVR E;  3SHB A;  4PPE A;  2L43 A;  2F6N A;  3RPG B;  2CKL B;  2EOD A;  4ZQL A;  4L7X A;  4O64 A;  1T1H A;  2YW8 A;  2MA5 A;  4Z0O A;  3M99 A;  5FEY A;  5G04 B;  2HYE D;  5KH9 A;  3LQH A;  5AIU A;  2YSM A;  2FFW A;  2K17 A;  3PUR A;  3LJU X;  1WIL A;  1WEE A;  1MBM A;  4UI9 B;  3PHD A;  4W4U A;  3M7K A;  2DSM A;  2QIZ A;  1FBV A;  4BBQ A;  4X3G A;  4UP5 A;  5B78 A;  2LAU A;  1CHC A;  2K16 A;  2CSV A;  3O33 A;  3H7H A;  2M6M A;  2YRE A;  3N9Q A;  2HDP A;  2KU3 A;  2VPB A;  4F1P A;  4A49 A;  3KV5 A;  2H0D A;  4WA6 A;  1G25 A;  1JM7 B;  4ZDT A;  2JRJ A;  3FL2 A;  1XWH A;  4R2Y A;  3U5O A;  2L80 A;  2KWN A;  2E61 A;  2YT5 A;  2DX8 A;  2JUN A;  1WEQ A;  3EB6 A;  4A0C D;  4GB0 A;  4IC2 A;  5H9M A;  3N9L A;  4LLB A; 
#chains in the Genus database with same CATH homology
 4YAB A;  3ZPV E;  2LRI C;  4I7C A;  2G45 A;  1U6G B;  2VJF B;  2QJ0 A;  4YAT A;  1WEO A;  4N3W A;  2Y1N A;  3ZNI A;  2MD7 B;  3ZYQ A;  5AIT A;  4AYC B;  2E6S A;  1HYI A;  2YHO A;  1LDJ B;  2KYU A;  2CSZ A;  1RMD A;  2KGG A;  2FUI A;  2LV9 A;  2MA6 A;  2OXQ C;  3RPG C;  1Z6U A;  1N87 A;  3O36 A;  2VNF A;  3SOX A;  3O70 A;  1VD4 A;  2KWJ A;  5LKX A;  2LGV A;  4YBT A;  5DIN A;  4GNF A;  2JMD A;  4ZUX U;  4YBM A;  3U5M A;  5KH3 A;  2I50 A;  1DVP A;  4FJC A;  3L1X A;  2LGG A;  4GND A;  2CSY A;  3RTR B;  1IYM A;  1X4J A;  2ECV A;  3KV6 A;  2CT2 A;  3O35 A;  4N4F A;  3O37 A;  4MSX A;  5TAB A;  1VFY A;  3I2D A;  3ASL A;  2H0D B;  3IHP A;  2LXH C;  5FB0 A;  2VP7 A;  5H1U A;  2LXP C;  2C2L A;  2Y1M A;  3NG2 A;  4FK5 A;  2LGK A;  4WZ0 A;  2IDA A;  4NN2 A;  2LGL A;  2YHN A;  5LKT A;  4R7E A;  2MD8 C;  4V3K C;  5LCW B;  4QF3 A;  5G0F A;  1WEU A;  4P5O B;  2L75 A;  1WEM A;  5I3L A;  2ECI A;  3LQJ A;  3ZPV 1;  4UP0 A;  3HCS A;  2ECJ A;  2KWO A;  3VK6 A;  3SOW A;  1LDK C;  2JMJ A;  3ZTG A;  5JG6 A;  5TDW A;  1X4U A;  2F6J A;  3M63 A;  3T7L A;  1WFK A;  5B77 A;  5J3X A;  2MIQ A;  5C13 A;  5FER A;  4QF2 A;  2ECG A;  4Q6F A;  1WE9 A;  2VPD A;  4WZ3 B;  2LQ6 A;  4WZ2 A;  2ZET C;  2F42 A;  2KRE A;  3L1Z B;  4B86 C;  3N9O A;  2YQL A;  4FO9 A;  3KNV A;  1VYX A;  2YUR A;  3DQV R;  3M62 A;  2AN6 A;  2MUM A;  4TKP B;  4LAD B;  3LQI A;  1X4I A;  3GL6 A;  2BAY A;  4LK9 A;  3HCU A;  1FP0 A;  2RI7 A;  2FSA A;  4CCG X;  2PNX A;  2Y43 A;  3N9M A;  1WEW A;  4YAD A;  4XI1 A;  4YBS A;  3ZVZ B;  2YSJ A;  1MM2 A;  2E6R A;  3GV4 A;  2LN0 A;  2G6Q A;  1Z60 A;  4YC9 A;  3ZVY A;  1WEN A;  4S3O B;  4B7Y C;  4BHW A;  2M1R A;  3U5N A;  4AVX A;  1JOC A;  5B75 A;  5FB1 A;  1E4U A;  5B76 A;  1V87 A;  5LKZ A;  4AUQ B;  2C2V S;  3U5P A;  5D1M B;  2KR4 A;  4YAX A;  4I7D A;  2VPE A;  4I7B A;  4R8P K;  2RSD A;  1Z2Q A;  4F52 B;  1K2F A;  3LRQ A;  2UZG A;  3O34 A;  4L58 A;  3N9P A;  3KQI A;  2CKL A;  2YQM A;  2VJE B;  2M85 A;  3N9N A;  3O7A A;  2YUC A;  3T6R A;  2EGP A;  5TBN A;  2L5U A;  3C6W A;  5H1V A;  3PUQ A;  2VPG A;  2PUY A;  2MNY A;  1WIM A;  1WGM A;  4AP4 A;  2VJE A;  4PTB A;  4IC3 A;  4FIP A;  3HTK C;  2MNZ A;  2ECT A;  4LJN A;  5B79 A;  5EYA F;  1F62 A;  1MM3 A;  2XB1 A;  5B8D A;  2NAA A;  2EA6 A;  3QZV A;  5TDR A;  5D1L B;  4C9Z A;  2K4D A;  1JM7 A;  5G05 B;  3SOU A;  2MT5 A;  2KGI A;  3L11 A;  4A4C A;  2KWK A;  2KE1 A;  2L0B A;  2QIC A;  4V3L C;  5H1T A;  3HCT A;  3V43 A;  2ECW A;  4S3O C;  5LKU A;  2YU4 A;  4GNG A;  5D1K B;  2KIZ A;  2K1J A;  2G43 A;  2VJF A;  1WES A;  3C5K A;  3MHS A;  1WEV A;  5KH7 A;  1HYJ A;  3MHH A;  4MVT A;  1WEP A;  2XEU A;  2KFT A;  2D8S A;  4AYC A;  2LDR A;  4CA1 A;  1BOR A;  4A4B A;  2JMI A;  2FUU A;  5DKA A;  5C11 A;  1ZBD B;  2YYR A;  3EB5 A;  3DPL R;  2ECN A;  4GNE A;  4LKA A;  5TRB A;  2M3H A;  3SHB A;  4PPE A;  2L43 A;  2F6N A;  3RPG B;  2CKL B;  2EOD A;  4ZQL A;  4L7X A;  1T1H A;  4O64 A;  2YW8 A;  2MA5 A;  3M99 A;  5FEY A;  5G04 B;  2HYE D;  5KH9 A;  3LQH A;  5AIU A;  2YSM A;  2K17 A;  3PUR A;  1WIL A;  1WEE A;  4UI9 B;  3PHD A;  4W4U A;  2QIZ A;  1FBV A;  4BBQ A;  4X3G A;  4UP5 A;  5B78 A;  1CHC A;  2K16 A;  3O33 A;  2M6M A;  2YRE A;  3N9Q A;  2HDP A;  2KU3 A;  2VPB A;  4A49 A;  3KV5 A;  2H0D A;  4WA6 A;  1G25 A;  1JM7 B;  4ZDT A;  2JRJ A;  3FL2 A;  1XWH A;  4R2Y A;  3U5O A;  2L80 A;  2KWN A;  2YT5 A;  2DX8 A;  1WEQ A;  3EB6 A;  4A0C D;  4GB0 A;  4IC2 A;  5H9M A;  3N9L A;  4LLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...