4B86C

Crystal structure of the msl1-msl2 complex (3.5a)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 30
structure length 115
sequence length 115
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b86C00
2DX8A 3LQIA 2YHOA 3EB6A 3FL2A 5TDRA 4IC2A 2FUUA 5EYAF 4AP4A 2C2LA 5I3LA 5DKAA 1HYJA 3ZVYA 3O33A 2G43A 1BORA 2JMDA 5B79A 2M3HA 2AN6A 2KR4A 2MNYA 4TKPB 4YBTA 2Y1MA 1MM2A 1WEQA 1WEUA 2LGGA 2VNFA 5LKXA 1V87A 4NN2A 3I2DA 5H1VA 2QICA 2LGKA 2LGLA 3DQVR 2KIZA 2HDPA 4CA1A 5FB1A 2YW8A 3L1XA 3GV4A 3KQIA 1U6GB 3ZVZB 2MD8C 2JMJA 5B78A 4N3WA 2EA6A 2E6RA 3IHPA 2MD7B 4GNFA 4IC3A 4S3OB 1WE9A 2KWJA 1JM7B 3EB5A 2ECGA 4AUQB 5KH9A 2ZETC 2LXHC 2HYED 1VFYA 2H0DB 4FIPA 3KV6A 1WEOA 3MHHA 3HTKC 4ZQLA 5C11A 2L5UA 2E6SA 1WEPA 1WGMA 2YURA 3SHBA 4UP5A 1FP0A 2VPDA 4B7YC 4BHWA 5D1MB 4YC9A 1X4JA 2KGGA 3N9PA 2YU4A 5B8DA 3C5KA 2ECJA 2L75A 2ECNA 4A4BA 1IYMA 3PURA 5AIUA 2K4DA 5G0FA 2EODA 2VPGA 4R2YA 3N9QA 3QZVA 4C9ZA 3RPGC 2VJFA 2YHNA 4I7BA 3ZPVE 2CKLA 2VJEB 4AVXA 3N9MA 5FERA 3M99A 1X4IA 3M63A 1FBVA 2KYUA 2PNXA 3ZYQA 2LGVA 4UP0A 4Q6FA 3KV5A 3SOWA 5B77A 2MA5A 4PPEA 5C13A 1RMDA 2I50A 2YQMA 2XB1A 1Z6UA 3LQHA 4N4FA 3M62A 1WESA 2VPEA 4L7XA 4AYCA 4GNEA 4X3GA 2JRJA 5DINA 2F42A 1F62A 5FB0A 2ECIA 2PUYA 2OXQC 1WIMA 2QJ0A 4UI9B 4LLBA 2KE1A 4P5OB 5G04B 2KFTA 3GL6A 2M1RA 4YATA 1WFKA 3U5OA 2KWOA 4PTBA 4R7EA 2MT5A 2RI7A 1MM3A 4YADA 4GNDA 2QIZA 2LQ6A 4I7CA 4I7DA 4QF2A 5H9MA 2MIQA 3PUQA 4YBSA 2CT2A 3L1ZB 1LDKC 2BAYA 1DVPA 4F52B 5TBNA 5G05B 4GB0A 2VPBA 1N87A 4BBQA 3O34A 4GNGA 4WA6A 4WZ3B 3RTRB 3V43A 1G25A 2KU3A 3MHSA 2YUCA 2YSMA 2C2VS 3U5MA 4QF3A 1Z2QA 4O64A 3VK6A 2L43A 1WEEA 2Y43A 2KREA 5LKTA 1JM7A 2F6NA 5TDWA 2KWNA 1ZBDB 3KNVA 3O37A 4LADB 2G6QA 4MSXA 2H0DA 4CCGX 2CSYA 2MNZA 2M6MA 2ECTA 2FSAA 2KGIA 3SOXA 2JMIA 1WEWA 2EGPA 2VP7A 2LN0A 1VD4A 4FO9A 5B75A 5LKZA 3T6RA 1XWHA 2K1JA 1E4UA 1LDJB 5KH3A 2LXPC 4A4CA 4V3LC 1HYIA 2ECWA 5J3XA 5H1UA 2YYRA 4MVTA 5TABA 1VYXA 2MA6A 2MUMA 5TRBA 1CHCA 1WENA 2VJEA 5B76A 3ZNIA 5LKUA 4LKAA 2M85A 4YABA 2XEUA 3T7LA 1WEVA 4XI1A 4YAXA 3N9NA 4L58A 5KH7A 2K16A 3HCTA 3NG2A 3O70A 3O35A 5FEYA 3HCUA 3PHDA 4S3OC 3ZPV1 1K2FA 4B86C 2YQLA 1JOCA 5H1TA 1WEMA 3DPLR 5D1LB 4LK9A 4W4UA 3N9OA 1WILA 5AITA 2VJFB 2YT5A 2L0BA 4WZ2A 2CKLB 4V3KC 3SOUA 4ZDTA 3HCSA 1T1HA 2YSJA 2ECVA 3LQJA 3O36A 5LCWB 2G45A 4FJCA 2CSZA 2K17A 2KWKA 4ZUXU 3N9LA 4LJNA 5D1KB 3RPGB 1Z60A 3ASLA 3C6WA 4FK5A 2L80A 2RSDA 2LV9A 2Y1NA 2F6JA 2LRIC 1X4UA 3LRQA 4WZ0A 2D8SA 2IDAA 2UZGA 2FUIA 3U5PA 2LDRA 2NAAA 4A0CD 3L11A 4AYCB 5JG6A 2YREA 3ZTGA 4YBMA 4A49A 4R8PK 3O7AA 3U5NA
chains in the Genus database with same CATH superfamily
2DX8A 3FAOA 3LQIA 2YHOA 3EB6A 2CSVA 1MBMA 3FL2A 5TDRA 4Z0RA 4IC2A 2FUUA 2EGMA 5EYAF 4AP4A 2C2LA 5I3LA 5DKAA 1HYJA 3ZVYA 3O33A 2G43A 1BORA 2JMDA 5B79A 2M3HA 2CRRA 5SVYA 2AN6A 2KR4A 2MNYA 4TKPB 4YBTA 2Y1MA 1MM2A 1WEQA 1WEUA 2LGGA 2VNFA 5LKXA 1V87A 4NN2A 3I2DA 5H1VA 2QICA 2LGKA 2LGLA 3DQVR 2KIZA 2HDPA 3KDEC 4CA1A 2YW8A 3L1XA 5FB1A 3GV4A 2EXUA 3KQIA 1U6GB 2OWAA 3ZVZB 2LAUA 2MD8C 2JMJA 5B78A 4N3WA 2EA6A 2E6RA 3IHPA 2MD7B 4GNFA 4IC3A 4S3OB 1WE9A 2KWJA 5SVIA 1JM7B 3EB5A 2ECGA 4AUQB 5KH9A 2ZETC 3H7HA 2LXHC 2M13A 2HYED 1VFYA 2H0DB 4FIPA 3E2DA 3KV6A 4H9DA 3FEHA 1WEOA 3MHHA 3HTKC 4ZQLA 5C11A 2L5UA 2XP0A 2E6SA 4O62A 1WEPA 3Q1DA 1WGMA 2YURA 3SHBA 4UP5A 1FP0A 2VPDA 4B7YC 3LDYA 4BHWA 5D1MB 4YC9A 1X4JA 2KGGA 3N9PA 2YU4A 5B8DA 3C5KA 2ECJA 1DCQA 2L75A 2ECNA 4A4BA 1IYMA 3PURA 5AIUA 2K4DA 5G0FA 2EODA 2VPGA 5K3QA 4R2YA 3N9QA 3QZVA 4C9ZA 2RR4A 3RPGC 2VJFA 2YHNA 4I7BA 3ZPVE 2CKLA 2VJEB 4AVXA 3N9MA 5FERA 3M99A 1X4IA 2D8UA 3M63A 1FBVA 2KYUA 2XOCA 2PNXA 3PLWA 3ZYQA 3DWDA 2LGVA 4UP0A 4Q6FA 3KV5A 3SOWA 5B77A 2MA5A 4PPEA 2CRWA 5C13A 1RMDA 3LJUX 2I50A 2YQMA 2XB1A 1Z6UA 3LQHA 4N4FA 3M62A 1WESA 2VPEA 4L7XA 4AYCA 4GNEA 4X3GA 2JRJA 5DINA 2F42A 1F62A 5FB0A 2ECIA 2PUYA 2OXQC 2KKXA 1WIMA 2QJ0A 4UI9B 4LLBA 2KE1A 5SVXA 4P5OB 5G04B 2KFTA 3GL6A 2M1RA 4YATA 1WFKA 3U5OA 2KWOA 4PTBA 3LVQE 4R7EA 2MT5A 2RI7A 2B0OE 3MDBC 1MM3A 4YADA 4GNDA 2QIZA 2LQ6A 3T9KA 4I7CA 4I7DA 4QF2A 5H9MA 2MIQA 3PUQA 4YBSA 2CT2A 3L1ZB 1LDKC 2BAYA 3SUBA 1DVPA 4F52B 5TBNA 5G05B 4GB0A 2VPBA 1N87A 4BBQA 3O34A 4GNGA 4WA6A 4WZ3B 3RTRB 3V43A 1G25A 2KU3A 3MHSA 2YUCA 2YSMA 2C2VS 3U5MA 4QF3A 1Z2QA 4O64A 3VK6A 2L43A 1WEEA 2Y43A 2KREA 5LKTA 1JM7A 4OGCA 2L7PA 2F6NA 5TDWA 2KWNA 1ZBDB 3KNVA 3O37A 4LADB 2G6QA 4MSXA 2H0DA 2JM3A 2DJAA 4CCGX 2JUNA 2CSYA 2MNZA 2M6MA 2IQJA 2ECTA 2FSAA 2KGIA 3SOXA 2FFWA 2JMIA 1WEWA 2EGPA 2VP7A 2LN0A 1VD4A 4FO9A 5B75A 5LKZA 3T6RA 2KKYA 1XWHA 2K1JA 2P57A 1E4UA 1LDJB 5KH3A 2LXPC 4A4CA 4V3LC 1HYIA 2ECWA 5J3XA 5SVIB 5H1UA 2YYRA 4MVTA 5TABA 1VYXA 2MA6A 2MUMA 5TRBA 3M7KA 2XOZA 1CHCA 1WENA 2VJEA 5B76A 3ZNIA 5LKUA 4LKAA 2M85A 4YABA 2XEUA 4Z0OA 3T7LA 1WEVA 4XI1A 4YAXA 3FANA 3N9NA 4L58A 5KH7A 2K16A 3HCTA 3NG2A 3O70A 2DSMA 2FD4A 3O35A 5FEYA 3HCUA 4QQ4A 3PHDA 4S3OC 2CONA 3ZPV1 1K2FA 4B86C 2YQLA 1JOCA 4OGEA 5H1TA 1WEMA 3DPLR 3LVRE 5D1LB 2YVRA 2E61A 4LK9A 4W4UA 3N9OA 1WILA 5AITA 2VJFB 2YT5A 3JUEA 3O47A 2L0BA 4WZ2A 2CKLB 4V3KC 3SOUA 4ZDTA 3HCSA 1T1HA 2MKEA 2YSJA 2XOYA 2ECVA 3LQJA 3O36A 5LCWB 2G45A 4FJCA 2CSZA 2K17A 2KWKA 4ZUXU 3N9LA 4LJNA 5D1KB 4F1PA 3RPGB 1Z60A 3ASLA 3C6WA 4FK5A 2L80A 2RSDA 2LV9A 2Y1NA 2F6JA 2LRIC 1X4UA 3FM8C 3LRQA 4WZ0A 2D8SA 2IDAA 2UZGA 3DDTA 2FUIA 3U5PA 2LDRA 2NAAA 4A0CD 3L11A 4AYCB 5JG6A 2YREA 3ZTGA 4YBMA 4A49A 4R8PK 3FJUB 3O7AA 3U5NA
chains in the Genus database with same CATH topology
2DX8A 3LQIA 2YHOA 3EB6A 3FL2A 5TDRA 4IC2A 2FUUA 5EYAF 4AP4A 2C2LA 5I3LA 5DKAA 1HYJA 3ZVYA 3O33A 2G43A 1BORA 2JMDA 5B79A 2M3HA 2AN6A 2KR4A 2MNYA 4TKPB 4YBTA 2Y1MA 1MM2A 1WEQA 1WEUA 2LGGA 2VNFA 5LKXA 1V87A 4NN2A 3I2DA 5H1VA 2QICA 2LGKA 2LGLA 3DQVR 2KIZA 2HDPA 4CA1A 5FB1A 2YW8A 3L1XA 3GV4A 3KQIA 1U6GB 3ZVZB 2MD8C 2JMJA 5B78A 4N3WA 2EA6A 2E6RA 3IHPA 2MD7B 4GNFA 4IC3A 4S3OB 1WE9A 2KWJA 1JM7B 3EB5A 2ECGA 4AUQB 5KH9A 2ZETC 2LXHC 2HYED 1VFYA 2H0DB 4FIPA 3KV6A 1WEOA 3MHHA 3HTKC 4ZQLA 5C11A 2L5UA 2E6SA 1WEPA 1WGMA 2YURA 3SHBA 4UP5A 1FP0A 2VPDA 4B7YC 4BHWA 5D1MB 4YC9A 1X4JA 2KGGA 3N9PA 2YU4A 5B8DA 3C5KA 2ECJA 2L75A 2ECNA 4A4BA 1IYMA 3PURA 5AIUA 2K4DA 5G0FA 2EODA 2VPGA 4R2YA 3N9QA 3QZVA 4C9ZA 3RPGC 2VJFA 2YHNA 4I7BA 3ZPVE 2CKLA 2VJEB 4AVXA 3N9MA 5FERA 3M99A 1X4IA 3M63A 1FBVA 2KYUA 2PNXA 3ZYQA 2LGVA 4UP0A 4Q6FA 3KV5A 3SOWA 5B77A 2MA5A 4PPEA 5C13A 1RMDA 2I50A 2YQMA 2XB1A 1Z6UA 3LQHA 4N4FA 3M62A 1WESA 2VPEA 4L7XA 4AYCA 4GNEA 4X3GA 2JRJA 5DINA 2F42A 1F62A 5FB0A 2ECIA 2PUYA 2OXQC 1WIMA 2QJ0A 4UI9B 4LLBA 2KE1A 4P5OB 5G04B 2KFTA 3GL6A 2M1RA 4YATA 1WFKA 3U5OA 2KWOA 4PTBA 4R7EA 2MT5A 2RI7A 1MM3A 4YADA 4GNDA 2QIZA 2LQ6A 4I7CA 4I7DA 4QF2A 5H9MA 2MIQA 3PUQA 4YBSA 2CT2A 3L1ZB 1LDKC 2BAYA 1DVPA 4F52B 5TBNA 5G05B 4GB0A 2VPBA 1N87A 4BBQA 3O34A 4GNGA 4WA6A 4WZ3B 3RTRB 3V43A 1G25A 2KU3A 3MHSA 2YUCA 2YSMA 2C2VS 3U5MA 4QF3A 1Z2QA 4O64A 3VK6A 2L43A 1WEEA 2Y43A 2KREA 5LKTA 1JM7A 2F6NA 5TDWA 2KWNA 1ZBDB 3KNVA 3O37A 4LADB 2G6QA 4MSXA 2H0DA 4CCGX 2CSYA 2MNZA 2M6MA 2ECTA 2FSAA 2KGIA 3SOXA 2JMIA 1WEWA 2EGPA 2VP7A 2LN0A 1VD4A 4FO9A 5B75A 5LKZA 3T6RA 1XWHA 2K1JA 1E4UA 1LDJB 5KH3A 2LXPC 4A4CA 4V3LC 1HYIA 2ECWA 5J3XA 5H1UA 2YYRA 4MVTA 5TABA 1VYXA 2MA6A 2MUMA 5TRBA 1CHCA 1WENA 2VJEA 5B76A 3ZNIA 5LKUA 4LKAA 2M85A 4YABA 2XEUA 3T7LA 1WEVA 4XI1A 4YAXA 3N9NA 4L58A 5KH7A 2K16A 3HCTA 3NG2A 3O70A 3O35A 5FEYA 3HCUA 3PHDA 4S3OC 3ZPV1 1K2FA 4B86C 2YQLA 1JOCA 5H1TA 1WEMA 3DPLR 5D1LB 4LK9A 4W4UA 3N9OA 1WILA 5AITA 2VJFB 2YT5A 2L0BA 4WZ2A 2CKLB 4V3KC 3SOUA 4ZDTA 3HCSA 1T1HA 2YSJA 2ECVA 3LQJA 3O36A 5LCWB 2G45A 4FJCA 2CSZA 2K17A 2KWKA 4ZUXU 3N9LA 4LJNA 5D1KB 3RPGB 1Z60A 3ASLA 3C6WA 4FK5A 2L80A 2RSDA 2LV9A 2Y1NA 2F6JA 2LRIC 1X4UA 3LRQA 4WZ0A 2D8SA 2IDAA 2UZGA 2FUIA 3U5PA 2LDRA 2NAAA 4A0CD 3L11A 4AYCB 5JG6A 2YREA 3ZTGA 4YBMA 4A49A 4R8PK 3O7AA 3U5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX8 A;  3LQI A;  2YHO A;  3EB6 A;  3FL2 A;  5TDR A;  4IC2 A;  2FUU A;  5EYA F;  4AP4 A;  2C2L A;  5I3L A;  5DKA A;  1HYJ A;  3ZVY A;  3O33 A;  2G43 A;  1BOR A;  2JMD A;  5B79 A;  2M3H A;  2AN6 A;  2KR4 A;  2MNY A;  4TKP B;  4YBT A;  2Y1M A;  1MM2 A;  1WEQ A;  1WEU A;  2LGG A;  2VNF A;  5LKX A;  1V87 A;  4NN2 A;  3I2D A;  5H1V A;  2QIC A;  2LGK A;  2LGL A;  3DQV R;  2KIZ A;  2HDP A;  4CA1 A;  5FB1 A;  2YW8 A;  3L1X A;  3GV4 A;  3KQI A;  1U6G B;  3ZVZ B;  2MD8 C;  2JMJ A;  5B78 A;  4N3W A;  2EA6 A;  2E6R A;  3IHP A;  2MD7 B;  4GNF A;  4IC3 A;  4S3O B;  1WE9 A;  2KWJ A;  1JM7 B;  3EB5 A;  2ECG A;  4AUQ B;  5KH9 A;  2ZET C;  2LXH C;  2HYE D;  1VFY A;  2H0D B;  4FIP A;  3KV6 A;  1WEO A;  3MHH A;  3HTK C;  4ZQL A;  5C11 A;  2L5U A;  2E6S A;  1WEP A;  1WGM A;  2YUR A;  3SHB A;  4UP5 A;  1FP0 A;  2VPD A;  4B7Y C;  4BHW A;  5D1M B;  4YC9 A;  1X4J A;  2KGG A;  3N9P A;  2YU4 A;  5B8D A;  3C5K A;  2ECJ A;  2L75 A;  2ECN A;  4A4B A;  1IYM A;  3PUR A;  5AIU A;  2K4D A;  5G0F A;  2EOD A;  2VPG A;  4R2Y A;  3N9Q A;  3QZV A;  4C9Z A;  3RPG C;  2VJF A;  2YHN A;  4I7B A;  3ZPV E;  2CKL A;  2VJE B;  4AVX A;  3N9M A;  5FER A;  3M99 A;  1X4I A;  3M63 A;  1FBV A;  2KYU A;  2PNX A;  3ZYQ A;  2LGV A;  4UP0 A;  4Q6F A;  3KV5 A;  3SOW A;  5B77 A;  2MA5 A;  4PPE A;  5C13 A;  1RMD A;  2I50 A;  2YQM A;  2XB1 A;  1Z6U A;  3LQH A;  4N4F A;  3M62 A;  1WES A;  2VPE A;  4L7X A;  4AYC A;  4GNE A;  4X3G A;  2JRJ A;  5DIN A;  2F42 A;  1F62 A;  5FB0 A;  2ECI A;  2PUY A;  2OXQ C;  1WIM A;  2QJ0 A;  4UI9 B;  4LLB A;  2KE1 A;  4P5O B;  5G04 B;  2KFT A;  3GL6 A;  2M1R A;  4YAT A;  1WFK A;  3U5O A;  2KWO A;  4PTB A;  4R7E A;  2MT5 A;  2RI7 A;  1MM3 A;  4YAD A;  4GND A;  2QIZ A;  2LQ6 A;  4I7C A;  4I7D A;  4QF2 A;  5H9M A;  2MIQ A;  3PUQ A;  4YBS A;  2CT2 A;  3L1Z B;  1LDK C;  2BAY A;  1DVP A;  4F52 B;  5TBN A;  5G05 B;  4GB0 A;  2VPB A;  1N87 A;  4BBQ A;  3O34 A;  4GNG A;  4WA6 A;  4WZ3 B;  3RTR B;  3V43 A;  1G25 A;  2KU3 A;  3MHS A;  2YUC A;  2YSM A;  2C2V S;  3U5M A;  4QF3 A;  1Z2Q A;  4O64 A;  3VK6 A;  2L43 A;  1WEE A;  2Y43 A;  2KRE A;  5LKT A;  1JM7 A;  2F6N A;  5TDW A;  2KWN A;  1ZBD B;  3KNV A;  3O37 A;  4LAD B;  2G6Q A;  4MSX A;  2H0D A;  4CCG X;  2CSY A;  2MNZ A;  2M6M A;  2ECT A;  2FSA A;  2KGI A;  3SOX A;  2JMI A;  1WEW A;  2EGP A;  2VP7 A;  2LN0 A;  1VD4 A;  4FO9 A;  5B75 A;  5LKZ A;  3T6R A;  1XWH A;  2K1J A;  1E4U A;  1LDJ B;  5KH3 A;  2LXP C;  4A4C A;  4V3L C;  1HYI A;  2ECW A;  5J3X A;  5H1U A;  2YYR A;  4MVT A;  5TAB A;  1VYX A;  2MA6 A;  2MUM A;  5TRB A;  1CHC A;  1WEN A;  2VJE A;  5B76 A;  3ZNI A;  5LKU A;  4LKA A;  2M85 A;  4YAB A;  2XEU A;  3T7L A;  1WEV A;  4XI1 A;  4YAX A;  3N9N A;  4L58 A;  5KH7 A;  2K16 A;  3HCT A;  3NG2 A;  3O70 A;  3O35 A;  5FEY A;  3HCU A;  3PHD A;  4S3O C;  3ZPV 1;  1K2F A;  4B86 C;  2YQL A;  1JOC A;  5H1T A;  1WEM A;  3DPL R;  5D1L B;  4LK9 A;  4W4U A;  3N9O A;  1WIL A;  5AIT A;  2VJF B;  2YT5 A;  2L0B A;  4WZ2 A;  2CKL B;  4V3K C;  3SOU A;  4ZDT A;  3HCS A;  1T1H A;  2YSJ A;  2ECV A;  3LQJ A;  3O36 A;  5LCW B;  2G45 A;  4FJC A;  2CSZ A;  2K17 A;  2KWK A;  4ZUX U;  3N9L A;  4LJN A;  5D1K B;  3RPG B;  1Z60 A;  3ASL A;  3C6W A;  4FK5 A;  2L80 A;  2RSD A;  2LV9 A;  2Y1N A;  2F6J A;  2LRI C;  1X4U A;  3LRQ A;  4WZ0 A;  2D8S A;  2IDA A;  2UZG A;  2FUI A;  3U5P A;  2LDR A;  2NAA A;  4A0C D;  3L11 A;  4AYC B;  5JG6 A;  2YRE A;  3ZTG A;  4YBM A;  4A49 A;  4R8P K;  3O7A A;  3U5N A; 
#chains in the Genus database with same CATH topology
 2DX8 A;  3FAO A;  3LQI A;  2YHO A;  3EB6 A;  2CSV A;  1MBM A;  3FL2 A;  5TDR A;  4Z0R A;  4IC2 A;  2FUU A;  2EGM A;  5EYA F;  4AP4 A;  2C2L A;  5I3L A;  5DKA A;  1HYJ A;  3ZVY A;  3O33 A;  2G43 A;  1BOR A;  2JMD A;  5B79 A;  2M3H A;  2CRR A;  5SVY A;  2AN6 A;  2KR4 A;  2MNY A;  4TKP B;  4YBT A;  2Y1M A;  1MM2 A;  1WEQ A;  1WEU A;  2LGG A;  2VNF A;  5LKX A;  1V87 A;  4NN2 A;  3I2D A;  5H1V A;  2QIC A;  2LGK A;  2LGL A;  3DQV R;  2KIZ A;  2HDP A;  3KDE C;  4CA1 A;  2YW8 A;  3L1X A;  5FB1 A;  3GV4 A;  2EXU A;  3KQI A;  1U6G B;  2OWA A;  3ZVZ B;  2LAU A;  2MD8 C;  2JMJ A;  5B78 A;  4N3W A;  2EA6 A;  2E6R A;  3IHP A;  2MD7 B;  4GNF A;  4IC3 A;  4S3O B;  1WE9 A;  2KWJ A;  5SVI A;  1JM7 B;  3EB5 A;  2ECG A;  4AUQ B;  5KH9 A;  2ZET C;  3H7H A;  2LXH C;  2M13 A;  2HYE D;  1VFY A;  2H0D B;  4FIP A;  3E2D A;  3KV6 A;  4H9D A;  3FEH A;  1WEO A;  3MHH A;  3HTK C;  4ZQL A;  5C11 A;  2L5U A;  2XP0 A;  2E6S A;  4O62 A;  1WEP A;  3Q1D A;  1WGM A;  2YUR A;  3SHB A;  4UP5 A;  1FP0 A;  2VPD A;  4B7Y C;  3LDY A;  4BHW A;  5D1M B;  4YC9 A;  1X4J A;  2KGG A;  3N9P A;  2YU4 A;  5B8D A;  3C5K A;  2ECJ A;  1DCQ A;  2L75 A;  2ECN A;  4A4B A;  1IYM A;  3PUR A;  5AIU A;  2K4D A;  5G0F A;  2EOD A;  2VPG A;  5K3Q A;  4R2Y A;  3N9Q A;  3QZV A;  4C9Z A;  2RR4 A;  3RPG C;  2VJF A;  2YHN A;  4I7B A;  3ZPV E;  2CKL A;  2VJE B;  4AVX A;  3N9M A;  5FER A;  3M99 A;  1X4I A;  2D8U A;  3M63 A;  1FBV A;  2KYU A;  2XOC A;  2PNX A;  3PLW A;  3ZYQ A;  3DWD A;  2LGV A;  4UP0 A;  4Q6F A;  3KV5 A;  3SOW A;  5B77 A;  2MA5 A;  4PPE A;  2CRW A;  5C13 A;  1RMD A;  3LJU X;  2I50 A;  2YQM A;  2XB1 A;  1Z6U A;  3LQH A;  4N4F A;  3M62 A;  1WES A;  2VPE A;  4L7X A;  4AYC A;  4GNE A;  4X3G A;  2JRJ A;  5DIN A;  2F42 A;  1F62 A;  5FB0 A;  2ECI A;  2PUY A;  2OXQ C;  2KKX A;  1WIM A;  2QJ0 A;  4UI9 B;  4LLB A;  2KE1 A;  5SVX A;  4P5O B;  5G04 B;  2KFT A;  3GL6 A;  2M1R A;  4YAT A;  1WFK A;  3U5O A;  2KWO A;  4PTB A;  3LVQ E;  4R7E A;  2MT5 A;  2RI7 A;  2B0O E;  3MDB C;  1MM3 A;  4YAD A;  4GND A;  2QIZ A;  2LQ6 A;  3T9K A;  4I7C A;  4I7D A;  4QF2 A;  5H9M A;  2MIQ A;  3PUQ A;  4YBS A;  2CT2 A;  3L1Z B;  1LDK C;  2BAY A;  3SUB A;  1DVP A;  4F52 B;  5TBN A;  5G05 B;  4GB0 A;  2VPB A;  1N87 A;  4BBQ A;  3O34 A;  4GNG A;  4WA6 A;  4WZ3 B;  3RTR B;  3V43 A;  1G25 A;  2KU3 A;  3MHS A;  2YUC A;  2YSM A;  2C2V S;  3U5M A;  4QF3 A;  1Z2Q A;  4O64 A;  3VK6 A;  2L43 A;  1WEE A;  2Y43 A;  2KRE A;  5LKT A;  1JM7 A;  4OGC A;  2L7P A;  2F6N A;  5TDW A;  2KWN A;  1ZBD B;  3KNV A;  3O37 A;  4LAD B;  2G6Q A;  4MSX A;  2H0D A;  2JM3 A;  2DJA A;  4CCG X;  2JUN A;  2CSY A;  2MNZ A;  2M6M A;  2IQJ A;  2ECT A;  2FSA A;  2KGI A;  3SOX A;  2FFW A;  2JMI A;  1WEW A;  2EGP A;  2VP7 A;  2LN0 A;  1VD4 A;  4FO9 A;  5B75 A;  5LKZ A;  3T6R A;  2KKY A;  1XWH A;  2K1J A;  2P57 A;  1E4U A;  1LDJ B;  5KH3 A;  2LXP C;  4A4C A;  4V3L C;  1HYI A;  2ECW A;  5J3X A;  5SVI B;  5H1U A;  2YYR A;  4MVT A;  5TAB A;  1VYX A;  2MA6 A;  2MUM A;  5TRB A;  3M7K A;  2XOZ A;  1CHC A;  1WEN A;  2VJE A;  5B76 A;  3ZNI A;  5LKU A;  4LKA A;  2M85 A;  4YAB A;  2XEU A;  4Z0O A;  3T7L A;  1WEV A;  4XI1 A;  4YAX A;  3FAN A;  3N9N A;  4L58 A;  5KH7 A;  2K16 A;  3HCT A;  3NG2 A;  3O70 A;  2DSM A;  2FD4 A;  3O35 A;  5FEY A;  3HCU A;  4QQ4 A;  3PHD A;  4S3O C;  2CON A;  3ZPV 1;  1K2F A;  4B86 C;  2YQL A;  1JOC A;  4OGE A;  5H1T A;  1WEM A;  3DPL R;  3LVR E;  5D1L B;  2YVR A;  2E61 A;  4LK9 A;  4W4U A;  3N9O A;  1WIL A;  5AIT A;  2VJF B;  2YT5 A;  3JUE A;  3O47 A;  2L0B A;  4WZ2 A;  2CKL B;  4V3K C;  3SOU A;  4ZDT A;  3HCS A;  1T1H A;  2MKE A;  2YSJ A;  2XOY A;  2ECV A;  3LQJ A;  3O36 A;  5LCW B;  2G45 A;  4FJC A;  2CSZ A;  2K17 A;  2KWK A;  4ZUX U;  3N9L A;  4LJN A;  5D1K B;  4F1P A;  3RPG B;  1Z60 A;  3ASL A;  3C6W A;  4FK5 A;  2L80 A;  2RSD A;  2LV9 A;  2Y1N A;  2F6J A;  2LRI C;  1X4U A;  3FM8 C;  3LRQ A;  4WZ0 A;  2D8S A;  2IDA A;  2UZG A;  3DDT A;  2FUI A;  3U5P A;  2LDR A;  2NAA A;  4A0C D;  3L11 A;  4AYC B;  5JG6 A;  2YRE A;  3ZTG A;  4YBM A;  4A49 A;  4R8P K;  3FJU B;  3O7A A;  3U5N A; 
#chains in the Genus database with same CATH homology
 2DX8 A;  3LQI A;  2YHO A;  3EB6 A;  3FL2 A;  5TDR A;  4IC2 A;  2FUU A;  5EYA F;  4AP4 A;  2C2L A;  5I3L A;  5DKA A;  1HYJ A;  3ZVY A;  3O33 A;  2G43 A;  1BOR A;  2JMD A;  5B79 A;  2M3H A;  2AN6 A;  2KR4 A;  2MNY A;  4TKP B;  4YBT A;  2Y1M A;  1MM2 A;  1WEQ A;  1WEU A;  2LGG A;  2VNF A;  5LKX A;  1V87 A;  4NN2 A;  3I2D A;  5H1V A;  2QIC A;  2LGK A;  2LGL A;  3DQV R;  2KIZ A;  2HDP A;  4CA1 A;  5FB1 A;  2YW8 A;  3L1X A;  3GV4 A;  3KQI A;  1U6G B;  3ZVZ B;  2MD8 C;  2JMJ A;  5B78 A;  4N3W A;  2EA6 A;  2E6R A;  3IHP A;  2MD7 B;  4GNF A;  4IC3 A;  4S3O B;  1WE9 A;  2KWJ A;  1JM7 B;  3EB5 A;  2ECG A;  4AUQ B;  5KH9 A;  2ZET C;  2LXH C;  2HYE D;  1VFY A;  2H0D B;  4FIP A;  3KV6 A;  1WEO A;  3MHH A;  3HTK C;  4ZQL A;  5C11 A;  2L5U A;  2E6S A;  1WEP A;  1WGM A;  2YUR A;  3SHB A;  4UP5 A;  1FP0 A;  2VPD A;  4B7Y C;  4BHW A;  5D1M B;  4YC9 A;  1X4J A;  2KGG A;  3N9P A;  2YU4 A;  5B8D A;  3C5K A;  2ECJ A;  2L75 A;  2ECN A;  4A4B A;  1IYM A;  3PUR A;  5AIU A;  2K4D A;  5G0F A;  2EOD A;  2VPG A;  4R2Y A;  3N9Q A;  3QZV A;  4C9Z A;  3RPG C;  2VJF A;  2YHN A;  4I7B A;  3ZPV E;  2CKL A;  2VJE B;  4AVX A;  3N9M A;  5FER A;  3M99 A;  1X4I A;  3M63 A;  1FBV A;  2KYU A;  2PNX A;  3ZYQ A;  2LGV A;  4UP0 A;  4Q6F A;  3KV5 A;  3SOW A;  5B77 A;  2MA5 A;  4PPE A;  5C13 A;  1RMD A;  2I50 A;  2YQM A;  2XB1 A;  1Z6U A;  3LQH A;  4N4F A;  3M62 A;  1WES A;  2VPE A;  4L7X A;  4AYC A;  4GNE A;  4X3G A;  2JRJ A;  5DIN A;  2F42 A;  1F62 A;  5FB0 A;  2ECI A;  2PUY A;  2OXQ C;  1WIM A;  2QJ0 A;  4UI9 B;  4LLB A;  2KE1 A;  4P5O B;  5G04 B;  2KFT A;  3GL6 A;  2M1R A;  4YAT A;  1WFK A;  3U5O A;  2KWO A;  4PTB A;  4R7E A;  2MT5 A;  2RI7 A;  1MM3 A;  4YAD A;  4GND A;  2QIZ A;  2LQ6 A;  4I7C A;  4I7D A;  4QF2 A;  5H9M A;  2MIQ A;  3PUQ A;  4YBS A;  2CT2 A;  3L1Z B;  1LDK C;  2BAY A;  1DVP A;  4F52 B;  5TBN A;  5G05 B;  4GB0 A;  2VPB A;  1N87 A;  4BBQ A;  3O34 A;  4GNG A;  4WA6 A;  4WZ3 B;  3RTR B;  3V43 A;  1G25 A;  2KU3 A;  3MHS A;  2YUC A;  2YSM A;  2C2V S;  3U5M A;  4QF3 A;  1Z2Q A;  4O64 A;  3VK6 A;  2L43 A;  1WEE A;  2Y43 A;  2KRE A;  5LKT A;  1JM7 A;  2F6N A;  5TDW A;  2KWN A;  1ZBD B;  3KNV A;  3O37 A;  4LAD B;  2G6Q A;  4MSX A;  2H0D A;  4CCG X;  2CSY A;  2MNZ A;  2M6M A;  2ECT A;  2FSA A;  2KGI A;  3SOX A;  2JMI A;  1WEW A;  2EGP A;  2VP7 A;  2LN0 A;  1VD4 A;  4FO9 A;  5B75 A;  5LKZ A;  3T6R A;  1XWH A;  2K1J A;  1E4U A;  1LDJ B;  5KH3 A;  2LXP C;  4A4C A;  4V3L C;  1HYI A;  2ECW A;  5J3X A;  5H1U A;  2YYR A;  4MVT A;  5TAB A;  1VYX A;  2MA6 A;  2MUM A;  5TRB A;  1CHC A;  1WEN A;  2VJE A;  5B76 A;  3ZNI A;  5LKU A;  4LKA A;  2M85 A;  4YAB A;  2XEU A;  3T7L A;  1WEV A;  4XI1 A;  4YAX A;  3N9N A;  4L58 A;  5KH7 A;  2K16 A;  3HCT A;  3NG2 A;  3O70 A;  3O35 A;  5FEY A;  3HCU A;  3PHD A;  4S3O C;  3ZPV 1;  1K2F A;  4B86 C;  2YQL A;  1JOC A;  5H1T A;  1WEM A;  3DPL R;  5D1L B;  4LK9 A;  4W4U A;  3N9O A;  1WIL A;  5AIT A;  2VJF B;  2YT5 A;  2L0B A;  4WZ2 A;  2CKL B;  4V3K C;  3SOU A;  4ZDT A;  3HCS A;  1T1H A;  2YSJ A;  2ECV A;  3LQJ A;  3O36 A;  5LCW B;  2G45 A;  4FJC A;  2CSZ A;  2K17 A;  2KWK A;  4ZUX U;  3N9L A;  4LJN A;  5D1K B;  3RPG B;  1Z60 A;  3ASL A;  3C6W A;  4FK5 A;  2L80 A;  2RSD A;  2LV9 A;  2Y1N A;  2F6J A;  2LRI C;  1X4U A;  3LRQ A;  4WZ0 A;  2D8S A;  2IDA A;  2UZG A;  2FUI A;  3U5P A;  2LDR A;  2NAA A;  4A0C D;  3L11 A;  4AYC B;  5JG6 A;  2YRE A;  3ZTG A;  4YBM A;  4A49 A;  4R8P K;  3O7A A;  3U5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...