4B86C

Crystal structure of the msl1-msl2 complex (3.5a)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
total genus 30
structure length 115
sequence length 115
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b86C00
3GL6A 5H1TA 4IC2A 3M62A 2RSDA 1E4UA 2G43A 4P5OB 1ZBDB 4GNDA 1K2FA 2BAYA 4NN2A 1WEQA 3ZPVE 2G6QA 3U5NA 2K16A 2ECTA 2F42A 4YC9A 2LGLA 1G25A 2ECNA 3I2DA 1WEOA 3KV6A 3PHDA 4N4FA 5B79A 2D8SA 4B7YC 4R2YA 2KE1A 5TRBA 3V43A 3FL2A 3LQIA 2PNXA 3U5OA 2EGPA 2VPBA 3ASLA 4A4BA 2L80A 2M1RA 2CSYA 2LGKA 1JM7A 3T6RA 2EA6A 4I7CA 5FEYA 5H9MA 2MT5A 5C13A 4YABA 4B86C 4XI1A 2EODA 2YHOA 4UI9B 4FIPA 1Z6UA 5B78A 2LXHC 1JM7B 2L5UA 2VJFA 5D1LB 3O35A 2M85A 5JG6A 4QF3A 4LADB 3O33A 4YAXA 2LXPC 2G45A 3PUQA 4LJNA 4YATA 3LRQA 3N9NA 2XEUA 4L58A 3O34A 1WFKA 3T7LA 3O36A 2KR4A 5G0FA 2H0DA 5FB1A 5TBNA 2CKLB 2HDPA 2LDRA 5DKAA 4C9ZA 4R8PK 5G04B 2YUCA 4LKAA 1MM2A 4W4UA 2KGIA 5KH9A 3N9PA 3HTKC 1N87A 5AITA 4A4CA 1VYXA 2YSJA 4V3LC 5J3XA 4TKPB 5TDRA 3LQJA 3ZPV1 5D1KB 3KQIA 3HCSA 4QF2A 2VJEA 2ECWA 2FSAA 4WZ3B 1F62A 4FO9A 2F6NA 3EB6A 3C6WA 5B77A 3ZVZB 2Y1NA 4S3OC 1X4UA 4AUQB 3M63A 4N3WA 1CHCA 2DX8A 2MD8C 3RTRB 5C11A 4WA6A 1X4JA 5H1VA 5LCWB 1VFYA 4FK5A 2YQMA 2KIZA 4BHWA 1WGMA 1LDJB 2IDAA 4PTBA 3O7AA 1WEPA 2ZETC 5B76A 1WILA 4CA1A 4FJCA 5FERA 2E6SA 2CKLA 3DPLR 3L11A 3N9LA 2AN6A 2L43A 5G05B 4S3OB 4YBMA 1T1HA 3EB5A 3L1ZB 5LKXA 5KH7A 1BORA 3GV4A 2KGGA 2KWJA 4A49A 4PPEA 2QICA 2F6JA 4YADA 5H1UA 2XB1A 3N9OA 2ECIA 2LQ6A 5D1MB 2VNFA 2VPEA 2JRJA 1WEUA 2YSMA 4GNGA 2KWKA 3N9MA 3NG2A 5B8DA 4V3KC 3RPGC 2K1JA 2CSZA 2VPGA 2YQLA 5I3LA 2RI7A 3SOUA 2YURA 5TDWA 1WEMA 1X4IA 2K17A 4R7EA 3RPGB 2K4DA 2H0DB 2KFTA 4LK9A 2QJ0A 2I50A 1RMDA 1JOCA 2YW8A 2MA5A 1IYMA 2E6RA 1Z60A 2KREA 3IHPA 2L0BA 3N9QA 1WE9A 1WEEA 1WEWA 2Y43A 4YBTA 4A0CD 2YYRA 4AYCA 1WIMA 4AP4A 4IC3A 5FB0A 2Y1MA 1LDKC 2MUMA 2UZGA 2VP7A 4MVTA 4UP5A 2C2LA 4GB0A 2LV9A 4CCGX 2NAAA 2LGGA 2MNZA 4F52B 5DINA 4WZ0A 2VJEB 3M99A 1Z2QA 4GNFA 3KNVA 4I7DA 2M6MA 2LGVA 2CT2A 2YHNA 3VK6A 4MSXA 2JMJA 1DVPA 5TABA 4O64A 4WZ2A 1WESA 1WENA 3L1XA 3LQHA 2JMIA 2KWNA 4ZDTA 5LKTA 2YT5A 3U5PA 5AIUA 2FUUA 2L75A 3U5MA 2KYUA 2JMDA 4AYCB 3O37A 3MHHA 3QZVA 4L7XA 4UP0A 3HCTA 1HYIA 3SOXA 2FUIA 2MNYA 3MHSA 4X3GA 2HYED 4LLBA 3ZTGA 3KV5A 4YBSA 1MM3A 2LRIC 1V87A 5B75A 2M3HA 1FBVA 3O70A 1VD4A 4AVXA 2KWOA 1U6GB 3DQVR 2MA6A 3HCUA 3ZNIA 4Q6FA 2QIZA 2VJFB 2OXQC 2MIQA 2LN0A 5EYAF 3PURA 2YU4A 2ECJA 2ECGA 4ZUXU 4BBQA 5KH3A 2VPDA 1FP0A 1XWHA 3SHBA 3C5KA 4GNEA 2YREA 2PUYA 5LKUA 1HYJA 3ZYQA 5LKZA 4I7BA 2C2VS 1WEVA 2ECVA 3SOWA 3ZVYA 4ZQLA 2MD7B 2KU3A
chains in the Genus database with same CATH superfamily
3GL6A 5H1TA 4IC2A 3M62A 2RSDA 1E4UA 2G43A 2M13A 4P5OB 1ZBDB 4GNDA 1K2FA 2FFWA 3JUEA 2BAYA 4NN2A 1WEQA 3ZPVE 2G6QA 3U5NA 2K16A 2ECTA 2F42A 2MKEA 4OGEA 4YC9A 2LGLA 3H7HA 1G25A 2ECNA 3I2DA 1WEOA 3KV6A 3PHDA 4N4FA 5B79A 2D8SA 4B7YC 2P57A 4R2YA 2KE1A 5TRBA 3V43A 3FL2A 3FAOA 2JUNA 3LQIA 2PNXA 3U5OA 2EGPA 2VPBA 3ASLA 4A4BA 2L80A 2M1RA 2CSYA 2LGKA 1JM7A 3T6RA 2EA6A 4I7CA 5FEYA 5H9MA 2MT5A 5C13A 4YABA 4B86C 4XI1A 2EODA 2YHOA 4UI9B 4FIPA 2CSVA 1Z6UA 5B78A 2LXHC 1JM7B 3FM8C 2L5UA 2VJFA 5D1LB 3O35A 2M85A 5JG6A 4QF3A 4LADB 3O33A 4YAXA 2LXPC 2G45A 3PUQA 4LJNA 4YATA 3LRQA 3N9NA 3O47A 2XEUA 4L58A 3O34A 1WFKA 3T7LA 3O36A 2KR4A 5G0FA 2H0DA 5FB1A 5TBNA 2CKLB 2HDPA 2LDRA 5DKAA 4C9ZA 4R8PK 5G04B 2YUCA 4O62A 4LKAA 1MM2A 5SVIB 4W4UA 2KGIA 5KH9A 2D8UA 3N9PA 3HTKC 2XOYA 1N87A 5AITA 4A4CA 2XOCA 1VYXA 2YSJA 4V3LC 5J3XA 4TKPB 5TDRA 2YVRA 3LQJA 3ZPV1 3DDTA 3SUBA 5D1KB 3KQIA 3HCSA 4QF2A 2VJEA 2ECWA 2FSAA 4WZ3B 1F62A 4FO9A 2F6NA 3EB6A 3C6WA 5B77A 3ZVZB 2Y1NA 4S3OC 1X4UA 3PLWA 4AUQB 3M63A 2DSMA 4N3WA 1CHCA 2DX8A 2MD8C 3RTRB 5C11A 4WA6A 1X4JA 5H1VA 5LCWB 1VFYA 5SVYA 4FK5A 2YQMA 2KIZA 4BHWA 2EXUA 2DJAA 4OGCA 1WGMA 1LDJB 2IDAA 4PTBA 3O7AA 2KKXA 1WEPA 2ZETC 5B76A 1WILA 4CA1A 4FJCA 2IQJA 5FERA 3FEHA 2E6SA 2CKLA 3DPLR 3L11A 5K3QA 3N9LA 2AN6A 2L43A 5G05B 3Q1DA 4S3OB 4YBMA 1T1HA 3EB5A 3L1ZB 3LVRE 5LKXA 5KH7A 1BORA 3GV4A 2KGGA 2KWJA 4A49A 4PPEA 2QICA 4F1PA 2F6JA 4YADA 5H1UA 2XB1A 3N9OA 2ECIA 2LQ6A 4Z0RA 5D1MB 2VNFA 2VPEA 2JRJA 1WEUA 2YSMA 4GNGA 2KWKA 3N9MA 3NG2A 5B8DA 4V3KC 2OWAA 3RPGC 2K1JA 2CSZA 2VPGA 2YQLA 5I3LA 2RI7A 3SOUA 2YURA 1MBMA 5TDWA 3MDBC 1WEMA 3LDYA 1X4IA 2K17A 4R7EA 3RPGB 2K4DA 2H0DB 2KFTA 4LK9A 2QJ0A 2B0OE 2I50A 4QQ4A 1RMDA 1JOCA 2YW8A 2MA5A 3KDEC 1IYMA 2E6RA 1Z60A 2KREA 3LJUX 3IHPA 2L0BA 3N9QA 1WE9A 1WEEA 4H9DA 1WEWA 3FJUB 2Y43A 4YBTA 4A0CD 5SVXA 2L7PA 2YYRA 4AYCA 1WIMA 4AP4A 4IC3A 5FB0A 2Y1MA 3FANA 1LDKC 2MUMA 2UZGA 2VP7A 3M7KA 4MVTA 4UP5A 2C2LA 4GB0A 2LV9A 2NAAA 4CCGX 2LGGA 2MNZA 4F52B 5DINA 4WZ0A 2VJEB 2CRRA 3M99A 1Z2QA 4GNFA 3KNVA 4I7DA 2RR4A 2M6MA 2LGVA 2CT2A 2CRWA 2YHNA 3VK6A 2EGMA 4MSXA 2JMJA 1DVPA 5TABA 4O64A 4WZ2A 1WESA 1WENA 3L1XA 2KKYA 3LQHA 2LAUA 2JMIA 2KWNA 4ZDTA 5LKTA 2YT5A 1DCQA 3U5PA 5AIUA 2FUUA 2L75A 2CONA 3U5MA 2KYUA 2JMDA 4AYCB 3O37A 3MHHA 3QZVA 4L7XA 4UP0A 2XOZA 3HCTA 1HYIA 3SOXA 2FUIA 2MNYA 3MHSA 4X3GA 2HYED 3LVQE 4LLBA 2JM3A 3ZTGA 3KV5A 4YBSA 1MM3A 2LRIC 3T9KA 2E61A 1V87A 4Z0OA 5B75A 2FD4A 2M3HA 1FBVA 3E2DA 2XP0A 3O70A 1VD4A 4AVXA 2KWOA 1U6GB 3DQVR 2MA6A 3HCUA 3ZNIA 4Q6FA 2QIZA 2VJFB 2OXQC 2MIQA 2LN0A 5EYAF 3PURA 2YU4A 2ECJA 2ECGA 4ZUXU 4BBQA 5KH3A 2VPDA 1FP0A 1XWHA 3SHBA 3C5KA 4GNEA 2YREA 3DWDA 2PUYA 5LKUA 1HYJA 3ZYQA 5LKZA 4I7BA 5SVIA 2C2VS 1WEVA 2ECVA 3SOWA 3ZVYA 4ZQLA 2MD7B 2KU3A
chains in the Genus database with same CATH topology
3GL6A 5H1TA 4IC2A 3M62A 2RSDA 1E4UA 2G43A 4P5OB 1ZBDB 4GNDA 1K2FA 2BAYA 4NN2A 1WEQA 3ZPVE 2G6QA 3U5NA 2K16A 2ECTA 2F42A 4YC9A 2LGLA 1G25A 2ECNA 3I2DA 1WEOA 3KV6A 3PHDA 4N4FA 5B79A 2D8SA 4B7YC 4R2YA 2KE1A 5TRBA 3V43A 3FL2A 3LQIA 2PNXA 3U5OA 2EGPA 2VPBA 3ASLA 4A4BA 2L80A 2M1RA 2CSYA 2LGKA 1JM7A 3T6RA 2EA6A 4I7CA 5FEYA 5H9MA 2MT5A 5C13A 4YABA 4B86C 4XI1A 2EODA 2YHOA 4UI9B 4FIPA 1Z6UA 5B78A 2LXHC 1JM7B 2L5UA 2VJFA 5D1LB 3O35A 2M85A 5JG6A 4QF3A 4LADB 3O33A 4YAXA 2LXPC 2G45A 3PUQA 4LJNA 4YATA 3LRQA 3N9NA 2XEUA 4L58A 3O34A 1WFKA 3T7LA 3O36A 2KR4A 5G0FA 2H0DA 5FB1A 5TBNA 2CKLB 2HDPA 2LDRA 5DKAA 4C9ZA 4R8PK 5G04B 2YUCA 4LKAA 1MM2A 4W4UA 2KGIA 5KH9A 3N9PA 3HTKC 1N87A 5AITA 4A4CA 1VYXA 2YSJA 4V3LC 5J3XA 4TKPB 5TDRA 3LQJA 3ZPV1 5D1KB 3KQIA 3HCSA 4QF2A 2VJEA 2ECWA 2FSAA 4WZ3B 1F62A 4FO9A 2F6NA 3EB6A 3C6WA 5B77A 3ZVZB 2Y1NA 4S3OC 1X4UA 4AUQB 3M63A 4N3WA 1CHCA 2DX8A 2MD8C 3RTRB 5C11A 4WA6A 1X4JA 5H1VA 5LCWB 1VFYA 4FK5A 2YQMA 2KIZA 4BHWA 1WGMA 1LDJB 2IDAA 4PTBA 3O7AA 1WEPA 2ZETC 5B76A 1WILA 4CA1A 4FJCA 5FERA 2E6SA 2CKLA 3DPLR 3L11A 3N9LA 2AN6A 2L43A 5G05B 4S3OB 4YBMA 1T1HA 3EB5A 3L1ZB 5LKXA 5KH7A 1BORA 3GV4A 2KGGA 2KWJA 4A49A 4PPEA 2QICA 2F6JA 4YADA 5H1UA 2XB1A 3N9OA 2ECIA 2LQ6A 5D1MB 2VNFA 2VPEA 2JRJA 1WEUA 2YSMA 4GNGA 2KWKA 3N9MA 3NG2A 5B8DA 4V3KC 3RPGC 2K1JA 2CSZA 2VPGA 2YQLA 5I3LA 2RI7A 3SOUA 2YURA 5TDWA 1WEMA 1X4IA 2K17A 4R7EA 3RPGB 2K4DA 2H0DB 2KFTA 4LK9A 2QJ0A 2I50A 1RMDA 1JOCA 2YW8A 2MA5A 1IYMA 2E6RA 1Z60A 2KREA 3IHPA 2L0BA 3N9QA 1WE9A 1WEEA 1WEWA 2Y43A 4YBTA 4A0CD 2YYRA 4AYCA 1WIMA 4AP4A 4IC3A 5FB0A 2Y1MA 1LDKC 2MUMA 2UZGA 2VP7A 4MVTA 4UP5A 2C2LA 4GB0A 2LV9A 4CCGX 2NAAA 2LGGA 2MNZA 4F52B 5DINA 4WZ0A 2VJEB 3M99A 1Z2QA 4GNFA 3KNVA 4I7DA 2M6MA 2LGVA 2CT2A 2YHNA 3VK6A 4MSXA 2JMJA 1DVPA 5TABA 4O64A 4WZ2A 1WESA 1WENA 3L1XA 3LQHA 2JMIA 2KWNA 4ZDTA 5LKTA 2YT5A 3U5PA 5AIUA 2FUUA 2L75A 3U5MA 2KYUA 2JMDA 4AYCB 3O37A 3MHHA 3QZVA 4L7XA 4UP0A 3HCTA 1HYIA 3SOXA 2FUIA 2MNYA 3MHSA 4X3GA 2HYED 4LLBA 3ZTGA 3KV5A 4YBSA 1MM3A 2LRIC 1V87A 5B75A 2M3HA 1FBVA 3O70A 1VD4A 4AVXA 2KWOA 1U6GB 3DQVR 2MA6A 3HCUA 3ZNIA 4Q6FA 2QIZA 2VJFB 2OXQC 2MIQA 2LN0A 5EYAF 3PURA 2YU4A 2ECJA 2ECGA 4ZUXU 4BBQA 5KH3A 2VPDA 1FP0A 1XWHA 3SHBA 3C5KA 4GNEA 2YREA 2PUYA 5LKUA 1HYJA 3ZYQA 5LKZA 4I7BA 2C2VS 1WEVA 2ECVA 3SOWA 3ZVYA 4ZQLA 2MD7B 2KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL6 A;  5H1T A;  4IC2 A;  3M62 A;  2RSD A;  1E4U A;  2G43 A;  4P5O B;  1ZBD B;  4GND A;  1K2F A;  2BAY A;  4NN2 A;  1WEQ A;  3ZPV E;  2G6Q A;  3U5N A;  2K16 A;  2ECT A;  2F42 A;  4YC9 A;  2LGL A;  1G25 A;  2ECN A;  3I2D A;  1WEO A;  3KV6 A;  3PHD A;  4N4F A;  5B79 A;  2D8S A;  4B7Y C;  4R2Y A;  2KE1 A;  5TRB A;  3V43 A;  3FL2 A;  3LQI A;  2PNX A;  3U5O A;  2EGP A;  2VPB A;  3ASL A;  4A4B A;  2L80 A;  2M1R A;  2CSY A;  2LGK A;  1JM7 A;  3T6R A;  2EA6 A;  4I7C A;  5FEY A;  5H9M A;  2MT5 A;  5C13 A;  4YAB A;  4B86 C;  4XI1 A;  2EOD A;  2YHO A;  4UI9 B;  4FIP A;  1Z6U A;  5B78 A;  2LXH C;  1JM7 B;  2L5U A;  2VJF A;  5D1L B;  3O35 A;  2M85 A;  5JG6 A;  4QF3 A;  4LAD B;  3O33 A;  4YAX A;  2LXP C;  2G45 A;  3PUQ A;  4LJN A;  4YAT A;  3LRQ A;  3N9N A;  2XEU A;  4L58 A;  3O34 A;  1WFK A;  3T7L A;  3O36 A;  2KR4 A;  5G0F A;  2H0D A;  5FB1 A;  5TBN A;  2CKL B;  2HDP A;  2LDR A;  5DKA A;  4C9Z A;  4R8P K;  5G04 B;  2YUC A;  4LKA A;  1MM2 A;  4W4U A;  2KGI A;  5KH9 A;  3N9P A;  3HTK C;  1N87 A;  5AIT A;  4A4C A;  1VYX A;  2YSJ A;  4V3L C;  5J3X A;  4TKP B;  5TDR A;  3LQJ A;  3ZPV 1;  5D1K B;  3KQI A;  3HCS A;  4QF2 A;  2VJE A;  2ECW A;  2FSA A;  4WZ3 B;  1F62 A;  4FO9 A;  2F6N A;  3EB6 A;  3C6W A;  5B77 A;  3ZVZ B;  2Y1N A;  4S3O C;  1X4U A;  4AUQ B;  3M63 A;  4N3W A;  1CHC A;  2DX8 A;  2MD8 C;  3RTR B;  5C11 A;  4WA6 A;  1X4J A;  5H1V A;  5LCW B;  1VFY A;  4FK5 A;  2YQM A;  2KIZ A;  4BHW A;  1WGM A;  1LDJ B;  2IDA A;  4PTB A;  3O7A A;  1WEP A;  2ZET C;  5B76 A;  1WIL A;  4CA1 A;  4FJC A;  5FER A;  2E6S A;  2CKL A;  3DPL R;  3L11 A;  3N9L A;  2AN6 A;  2L43 A;  5G05 B;  4S3O B;  4YBM A;  1T1H A;  3EB5 A;  3L1Z B;  5LKX A;  5KH7 A;  1BOR A;  3GV4 A;  2KGG A;  2KWJ A;  4A49 A;  4PPE A;  2QIC A;  2F6J A;  4YAD A;  5H1U A;  2XB1 A;  3N9O A;  2ECI A;  2LQ6 A;  5D1M B;  2VNF A;  2VPE A;  2JRJ A;  1WEU A;  2YSM A;  4GNG A;  2KWK A;  3N9M A;  3NG2 A;  5B8D A;  4V3K C;  3RPG C;  2K1J A;  2CSZ A;  2VPG A;  2YQL A;  5I3L A;  2RI7 A;  3SOU A;  2YUR A;  5TDW A;  1WEM A;  1X4I A;  2K17 A;  4R7E A;  3RPG B;  2K4D A;  2H0D B;  2KFT A;  4LK9 A;  2QJ0 A;  2I50 A;  1RMD A;  1JOC A;  2YW8 A;  2MA5 A;  1IYM A;  2E6R A;  1Z60 A;  2KRE A;  3IHP A;  2L0B A;  3N9Q A;  1WE9 A;  1WEE A;  1WEW A;  2Y43 A;  4YBT A;  4A0C D;  2YYR A;  4AYC A;  1WIM A;  4AP4 A;  4IC3 A;  5FB0 A;  2Y1M A;  1LDK C;  2MUM A;  2UZG A;  2VP7 A;  4MVT A;  4UP5 A;  2C2L A;  4GB0 A;  2LV9 A;  4CCG X;  2NAA A;  2LGG A;  2MNZ A;  4F52 B;  5DIN A;  4WZ0 A;  2VJE B;  3M99 A;  1Z2Q A;  4GNF A;  3KNV A;  4I7D A;  2M6M A;  2LGV A;  2CT2 A;  2YHN A;  3VK6 A;  4MSX A;  2JMJ A;  1DVP A;  5TAB A;  4O64 A;  4WZ2 A;  1WES A;  1WEN A;  3L1X A;  3LQH A;  2JMI A;  2KWN A;  4ZDT A;  5LKT A;  2YT5 A;  3U5P A;  5AIU A;  2FUU A;  2L75 A;  3U5M A;  2KYU A;  2JMD A;  4AYC B;  3O37 A;  3MHH A;  3QZV A;  4L7X A;  4UP0 A;  3HCT A;  1HYI A;  3SOX A;  2FUI A;  2MNY A;  3MHS A;  4X3G A;  2HYE D;  4LLB A;  3ZTG A;  3KV5 A;  4YBS A;  1MM3 A;  2LRI C;  1V87 A;  5B75 A;  2M3H A;  1FBV A;  3O70 A;  1VD4 A;  4AVX A;  2KWO A;  1U6G B;  3DQV R;  2MA6 A;  3HCU A;  3ZNI A;  4Q6F A;  2QIZ A;  2VJF B;  2OXQ C;  2MIQ A;  2LN0 A;  5EYA F;  3PUR A;  2YU4 A;  2ECJ A;  2ECG A;  4ZUX U;  4BBQ A;  5KH3 A;  2VPD A;  1FP0 A;  1XWH A;  3SHB A;  3C5K A;  4GNE A;  2YRE A;  2PUY A;  5LKU A;  1HYJ A;  3ZYQ A;  5LKZ A;  4I7B A;  2C2V S;  1WEV A;  2ECV A;  3SOW A;  3ZVY A;  4ZQL A;  2MD7 B;  2KU3 A; 
#chains in the Genus database with same CATH topology
 3GL6 A;  5H1T A;  4IC2 A;  3M62 A;  2RSD A;  1E4U A;  2G43 A;  2M13 A;  4P5O B;  1ZBD B;  4GND A;  1K2F A;  2FFW A;  3JUE A;  2BAY A;  4NN2 A;  1WEQ A;  3ZPV E;  2G6Q A;  3U5N A;  2K16 A;  2ECT A;  2F42 A;  2MKE A;  4OGE A;  4YC9 A;  2LGL A;  3H7H A;  1G25 A;  2ECN A;  3I2D A;  1WEO A;  3KV6 A;  3PHD A;  4N4F A;  5B79 A;  2D8S A;  4B7Y C;  2P57 A;  4R2Y A;  2KE1 A;  5TRB A;  3V43 A;  3FL2 A;  3FAO A;  2JUN A;  3LQI A;  2PNX A;  3U5O A;  2EGP A;  2VPB A;  3ASL A;  4A4B A;  2L80 A;  2M1R A;  2CSY A;  2LGK A;  1JM7 A;  3T6R A;  2EA6 A;  4I7C A;  5FEY A;  5H9M A;  2MT5 A;  5C13 A;  4YAB A;  4B86 C;  4XI1 A;  2EOD A;  2YHO A;  4UI9 B;  4FIP A;  2CSV A;  1Z6U A;  5B78 A;  2LXH C;  1JM7 B;  3FM8 C;  2L5U A;  2VJF A;  5D1L B;  3O35 A;  2M85 A;  5JG6 A;  4QF3 A;  4LAD B;  3O33 A;  4YAX A;  2LXP C;  2G45 A;  3PUQ A;  4LJN A;  4YAT A;  3LRQ A;  3N9N A;  3O47 A;  2XEU A;  4L58 A;  3O34 A;  1WFK A;  3T7L A;  3O36 A;  2KR4 A;  5G0F A;  2H0D A;  5FB1 A;  5TBN A;  2CKL B;  2HDP A;  2LDR A;  5DKA A;  4C9Z A;  4R8P K;  5G04 B;  2YUC A;  4O62 A;  4LKA A;  1MM2 A;  5SVI B;  4W4U A;  2KGI A;  5KH9 A;  2D8U A;  3N9P A;  3HTK C;  2XOY A;  1N87 A;  5AIT A;  4A4C A;  2XOC A;  1VYX A;  2YSJ A;  4V3L C;  5J3X A;  4TKP B;  5TDR A;  2YVR A;  3LQJ A;  3ZPV 1;  3DDT A;  3SUB A;  5D1K B;  3KQI A;  3HCS A;  4QF2 A;  2VJE A;  2ECW A;  2FSA A;  4WZ3 B;  1F62 A;  4FO9 A;  2F6N A;  3EB6 A;  3C6W A;  5B77 A;  3ZVZ B;  2Y1N A;  4S3O C;  1X4U A;  3PLW A;  4AUQ B;  3M63 A;  2DSM A;  4N3W A;  1CHC A;  2DX8 A;  2MD8 C;  3RTR B;  5C11 A;  4WA6 A;  1X4J A;  5H1V A;  5LCW B;  1VFY A;  5SVY A;  4FK5 A;  2YQM A;  2KIZ A;  4BHW A;  2EXU A;  2DJA A;  4OGC A;  1WGM A;  1LDJ B;  2IDA A;  4PTB A;  3O7A A;  2KKX A;  1WEP A;  2ZET C;  5B76 A;  1WIL A;  4CA1 A;  4FJC A;  2IQJ A;  5FER A;  3FEH A;  2E6S A;  2CKL A;  3DPL R;  3L11 A;  5K3Q A;  3N9L A;  2AN6 A;  2L43 A;  5G05 B;  3Q1D A;  4S3O B;  4YBM A;  1T1H A;  3EB5 A;  3L1Z B;  3LVR E;  5LKX A;  5KH7 A;  1BOR A;  3GV4 A;  2KGG A;  2KWJ A;  4A49 A;  4PPE A;  2QIC A;  4F1P A;  2F6J A;  4YAD A;  5H1U A;  2XB1 A;  3N9O A;  2ECI A;  2LQ6 A;  4Z0R A;  5D1M B;  2VNF A;  2VPE A;  2JRJ A;  1WEU A;  2YSM A;  4GNG A;  2KWK A;  3N9M A;  3NG2 A;  5B8D A;  4V3K C;  2OWA A;  3RPG C;  2K1J A;  2CSZ A;  2VPG A;  2YQL A;  5I3L A;  2RI7 A;  3SOU A;  2YUR A;  1MBM A;  5TDW A;  3MDB C;  1WEM A;  3LDY A;  1X4I A;  2K17 A;  4R7E A;  3RPG B;  2K4D A;  2H0D B;  2KFT A;  4LK9 A;  2QJ0 A;  2B0O E;  2I50 A;  4QQ4 A;  1RMD A;  1JOC A;  2YW8 A;  2MA5 A;  3KDE C;  1IYM A;  2E6R A;  1Z60 A;  2KRE A;  3LJU X;  3IHP A;  2L0B A;  3N9Q A;  1WE9 A;  1WEE A;  4H9D A;  1WEW A;  3FJU B;  2Y43 A;  4YBT A;  4A0C D;  5SVX A;  2L7P A;  2YYR A;  4AYC A;  1WIM A;  4AP4 A;  4IC3 A;  5FB0 A;  2Y1M A;  3FAN A;  1LDK C;  2MUM A;  2UZG A;  2VP7 A;  3M7K A;  4MVT A;  4UP5 A;  2C2L A;  4GB0 A;  2LV9 A;  2NAA A;  4CCG X;  2LGG A;  2MNZ A;  4F52 B;  5DIN A;  4WZ0 A;  2VJE B;  2CRR A;  3M99 A;  1Z2Q A;  4GNF A;  3KNV A;  4I7D A;  2RR4 A;  2M6M A;  2LGV A;  2CT2 A;  2CRW A;  2YHN A;  3VK6 A;  2EGM A;  4MSX A;  2JMJ A;  1DVP A;  5TAB A;  4O64 A;  4WZ2 A;  1WES A;  1WEN A;  3L1X A;  2KKY A;  3LQH A;  2LAU A;  2JMI A;  2KWN A;  4ZDT A;  5LKT A;  2YT5 A;  1DCQ A;  3U5P A;  5AIU A;  2FUU A;  2L75 A;  2CON A;  3U5M A;  2KYU A;  2JMD A;  4AYC B;  3O37 A;  3MHH A;  3QZV A;  4L7X A;  4UP0 A;  2XOZ A;  3HCT A;  1HYI A;  3SOX A;  2FUI A;  2MNY A;  3MHS A;  4X3G A;  2HYE D;  3LVQ E;  4LLB A;  2JM3 A;  3ZTG A;  3KV5 A;  4YBS A;  1MM3 A;  2LRI C;  3T9K A;  2E61 A;  1V87 A;  4Z0O A;  5B75 A;  2FD4 A;  2M3H A;  1FBV A;  3E2D A;  2XP0 A;  3O70 A;  1VD4 A;  4AVX A;  2KWO A;  1U6G B;  3DQV R;  2MA6 A;  3HCU A;  3ZNI A;  4Q6F A;  2QIZ A;  2VJF B;  2OXQ C;  2MIQ A;  2LN0 A;  5EYA F;  3PUR A;  2YU4 A;  2ECJ A;  2ECG A;  4ZUX U;  4BBQ A;  5KH3 A;  2VPD A;  1FP0 A;  1XWH A;  3SHB A;  3C5K A;  4GNE A;  2YRE A;  3DWD A;  2PUY A;  5LKU A;  1HYJ A;  3ZYQ A;  5LKZ A;  4I7B A;  5SVI A;  2C2V S;  1WEV A;  2ECV A;  3SOW A;  3ZVY A;  4ZQL A;  2MD7 B;  2KU3 A; 
#chains in the Genus database with same CATH homology
 3GL6 A;  5H1T A;  4IC2 A;  3M62 A;  2RSD A;  1E4U A;  2G43 A;  4P5O B;  1ZBD B;  4GND A;  1K2F A;  2BAY A;  4NN2 A;  1WEQ A;  3ZPV E;  2G6Q A;  3U5N A;  2K16 A;  2ECT A;  2F42 A;  4YC9 A;  2LGL A;  1G25 A;  2ECN A;  3I2D A;  1WEO A;  3KV6 A;  3PHD A;  4N4F A;  5B79 A;  2D8S A;  4B7Y C;  4R2Y A;  2KE1 A;  5TRB A;  3V43 A;  3FL2 A;  3LQI A;  2PNX A;  3U5O A;  2EGP A;  2VPB A;  3ASL A;  4A4B A;  2L80 A;  2M1R A;  2CSY A;  2LGK A;  1JM7 A;  3T6R A;  2EA6 A;  4I7C A;  5FEY A;  5H9M A;  2MT5 A;  5C13 A;  4YAB A;  4B86 C;  4XI1 A;  2EOD A;  2YHO A;  4UI9 B;  4FIP A;  1Z6U A;  5B78 A;  2LXH C;  1JM7 B;  2L5U A;  2VJF A;  5D1L B;  3O35 A;  2M85 A;  5JG6 A;  4QF3 A;  4LAD B;  3O33 A;  4YAX A;  2LXP C;  2G45 A;  3PUQ A;  4LJN A;  4YAT A;  3LRQ A;  3N9N A;  2XEU A;  4L58 A;  3O34 A;  1WFK A;  3T7L A;  3O36 A;  2KR4 A;  5G0F A;  2H0D A;  5FB1 A;  5TBN A;  2CKL B;  2HDP A;  2LDR A;  5DKA A;  4C9Z A;  4R8P K;  5G04 B;  2YUC A;  4LKA A;  1MM2 A;  4W4U A;  2KGI A;  5KH9 A;  3N9P A;  3HTK C;  1N87 A;  5AIT A;  4A4C A;  1VYX A;  2YSJ A;  4V3L C;  5J3X A;  4TKP B;  5TDR A;  3LQJ A;  3ZPV 1;  5D1K B;  3KQI A;  3HCS A;  4QF2 A;  2VJE A;  2ECW A;  2FSA A;  4WZ3 B;  1F62 A;  4FO9 A;  2F6N A;  3EB6 A;  3C6W A;  5B77 A;  3ZVZ B;  2Y1N A;  4S3O C;  1X4U A;  4AUQ B;  3M63 A;  4N3W A;  1CHC A;  2DX8 A;  2MD8 C;  3RTR B;  5C11 A;  4WA6 A;  1X4J A;  5H1V A;  5LCW B;  1VFY A;  4FK5 A;  2YQM A;  2KIZ A;  4BHW A;  1WGM A;  1LDJ B;  2IDA A;  4PTB A;  3O7A A;  1WEP A;  2ZET C;  5B76 A;  1WIL A;  4CA1 A;  4FJC A;  5FER A;  2E6S A;  2CKL A;  3DPL R;  3L11 A;  3N9L A;  2AN6 A;  2L43 A;  5G05 B;  4S3O B;  4YBM A;  1T1H A;  3EB5 A;  3L1Z B;  5LKX A;  5KH7 A;  1BOR A;  3GV4 A;  2KGG A;  2KWJ A;  4A49 A;  4PPE A;  2QIC A;  2F6J A;  4YAD A;  5H1U A;  2XB1 A;  3N9O A;  2ECI A;  2LQ6 A;  5D1M B;  2VNF A;  2VPE A;  2JRJ A;  1WEU A;  2YSM A;  4GNG A;  2KWK A;  3N9M A;  3NG2 A;  5B8D A;  4V3K C;  3RPG C;  2K1J A;  2CSZ A;  2VPG A;  2YQL A;  5I3L A;  2RI7 A;  3SOU A;  2YUR A;  5TDW A;  1WEM A;  1X4I A;  2K17 A;  4R7E A;  3RPG B;  2K4D A;  2H0D B;  2KFT A;  4LK9 A;  2QJ0 A;  2I50 A;  1RMD A;  1JOC A;  2YW8 A;  2MA5 A;  1IYM A;  2E6R A;  1Z60 A;  2KRE A;  3IHP A;  2L0B A;  3N9Q A;  1WE9 A;  1WEE A;  1WEW A;  2Y43 A;  4YBT A;  4A0C D;  2YYR A;  4AYC A;  1WIM A;  4AP4 A;  4IC3 A;  5FB0 A;  2Y1M A;  1LDK C;  2MUM A;  2UZG A;  2VP7 A;  4MVT A;  4UP5 A;  2C2L A;  4GB0 A;  2LV9 A;  4CCG X;  2NAA A;  2LGG A;  2MNZ A;  4F52 B;  5DIN A;  4WZ0 A;  2VJE B;  3M99 A;  1Z2Q A;  4GNF A;  3KNV A;  4I7D A;  2M6M A;  2LGV A;  2CT2 A;  2YHN A;  3VK6 A;  4MSX A;  2JMJ A;  1DVP A;  5TAB A;  4O64 A;  4WZ2 A;  1WES A;  1WEN A;  3L1X A;  3LQH A;  2JMI A;  2KWN A;  4ZDT A;  5LKT A;  2YT5 A;  3U5P A;  5AIU A;  2FUU A;  2L75 A;  3U5M A;  2KYU A;  2JMD A;  4AYC B;  3O37 A;  3MHH A;  3QZV A;  4L7X A;  4UP0 A;  3HCT A;  1HYI A;  3SOX A;  2FUI A;  2MNY A;  3MHS A;  4X3G A;  2HYE D;  4LLB A;  3ZTG A;  3KV5 A;  4YBS A;  1MM3 A;  2LRI C;  1V87 A;  5B75 A;  2M3H A;  1FBV A;  3O70 A;  1VD4 A;  4AVX A;  2KWO A;  1U6G B;  3DQV R;  2MA6 A;  3HCU A;  3ZNI A;  4Q6F A;  2QIZ A;  2VJF B;  2OXQ C;  2MIQ A;  2LN0 A;  5EYA F;  3PUR A;  2YU4 A;  2ECJ A;  2ECG A;  4ZUX U;  4BBQ A;  5KH3 A;  2VPD A;  1FP0 A;  1XWH A;  3SHB A;  3C5K A;  4GNE A;  2YRE A;  2PUY A;  5LKU A;  1HYJ A;  3ZYQ A;  5LKZ A;  4I7B A;  2C2V S;  1WEV A;  2ECV A;  3SOW A;  3ZVY A;  4ZQL A;  2MD7 B;  2KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...