2F42A

Dimerization and u-box domains of zebrafish c-terminal of hsp70 interacting protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
156
structure length
138
Chain Sequence
AKKKRWNSIEEKRISQENELHAYLSKLILAEKERELDDSKHDKYLMDMDELFSQVDEKRKKREIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQENGWVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIP1 homology and U-box containing protein 1
publication title Structure and Interactions of the Helical and U-Box Domains of CHIP, the C Terminus of HSP70 Interacting Protein.
pubmed doi rcsb
source organism Danio rerio
molecule tags Chaperone
total genus 49
structure length 138
sequence length 156
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
A PF18391 CHIP_TPR_N CHIP N-terminal tetratricopeptide repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f42A02
2LRIC 4WZ3B 4AP4A 3O70A 5FB1A 2YHNA 4C9ZA 2KWJA 2KFTA 1Z2QA 2KREA 4GNFA 4B7YC 1K2FA 1JM7A 4R7EA 2ECJA 4R2YA 2Y1NA 3KV5A 5TRBA 3T7LA 4BBQA 5TABA 3DQVR 2ECVA 2K4DA 3ZPVE 1U6GB 2YT5A 4BHWA 1VFYA 3DPLR 5AIUA 2YQMA 5TDRA 2EA6A 2YUCA 5FERA 1F62A 2QJ0A 2OXQC 3LQHA 3U5MA 2KGIA 5KH7A 3M62A 3EB6A 2NAAA 3ZTGA 1FBVA 4N4FA 4QF3A 1WEQA 3T6RA 4MVTA 3ASLA 5H1VA 3N9LA 2ZETC 3SOXA 4UP5A 4W4UA 3QZVA 2JMDA 4IC2A 3C6WA 4LLBA 5LKXA 2FUIA 4AYCA 3O33A 2LDRA 2MUMA 5LCWB 2L80A 2VJEB 3O34A 4ZQLA 2CKLB 4A0CD 4R8PK 5G05B 5H9MA 2Y43A 3NG2A 4YBMA 5DINA 5B76A 4GNGA 2K17A 4P5OB 1WEPA 4FO9A 4ZUXU 3IHPA 3HTKC 2JMJA 3ZVYA 3O35A 3RTRB 3SOWA 1DVPA 2XB1A 2ECIA 2G45A 4FIPA 1WEUA 4I7DA 2KWKA 2L43A 2VPEA 3HCSA 4GNEA 2VPGA 5KH3A 2YQLA 2VPBA 2HDPA 2KR4A 2YSMA 3N9QA 4L7XA 4PPEA 2VJFA 4V3KC 2D8SA 4MSXA 3O37A 5H1UA 2QICA 2KU3A 5JG6A 3GL6A 2KGGA 4WA6A 1HYIA 2YU4A 1Z60A 2M3HA 3PUQA 1N87A 5FEYA 4IC3A 4B86C 3U5PA 3O36A 2MNZA 3GV4A 4N3WA 2L5UA 5H1TA 1FP0A 5B78A 1X4IA 3V43A 3I2DA 2I50A 2RI7A 2F42A 2XEUA 2JMIA 4CCGX 2BAYA 2M1RA 4YBTA 2VPDA 3ZNIA 1HYJA 4YATA 3N9OA 2ECNA 4LKAA 2L75A 3L11A 1WESA 3U5OA 1WEEA 2M6MA 2MA6A 1WEWA 4QF2A 2K1JA 4F52B 2C2LA 4Q6FA 5G04B 1LDJB 2UZGA 2CSYA 4YABA 2ECGA 1G25A 2MIQA 4YAXA 1E4UA 3HCTA 2MT5A 3O7AA 2Y1MA 4ZDTA 3FL2A 2VJEA 2YW8A 2CKLA 2G6QA 4YC9A 4S3OB 2LGGA 2F6JA 5DKAA 1CHCA 1WEVA 3N9NA 3M63A 5C11A 2PNXA 5B79A 2RSDA 2H0DB 2FSAA 2M85A 2MA5A 4AUQB 2E6SA 2LGKA 4FJCA 5TBNA 3PHDA 4NN2A 4O64A 3ZPV1 2QIZA 4AVXA 2LGLA 1VYXA 3PURA 3SOUA 1MM2A 4YBSA 1V87A 2YREA 3LQIA 2YURA 2F6NA 4GNDA 1JM7B 1JOCA 2PUYA 1ZBDB 2E6RA 3KV6A 1Z6UA 5KH9A 5D1KB 4LADB 1IYMA 1WEMA 5LKUA 2VNFA 2IDAA 2K16A 2ECWA 4UP0A 2KYUA 1WENA 2KWOA 4S3OC 5D1LB 3KQIA 2YHOA 2EGPA 5G0FA 3U5NA 2LN0A 1WFKA 5B77A 3ZYQA 4I7BA 1LDKC 4YADA 2KE1A 2CSZA 2AN6A 3HCUA 4CA1A 4WZ0A 3RPGB 2LQ6A 4PTBA 4I7CA 2L0BA 2YYRA 2MD8C 2EODA 3C5KA 3M99A 4AYCB 2LXHC 1WEOA 1XWHA 2JRJA 1WILA 1WGMA 5J3XA 3EB5A 1WE9A 3SHBA 4L58A 4UI9B 5TDWA 3L1ZB 2KWNA 5LKTA 4A49A 3MHHA 3N9MA 5D1MB 2MNYA 5B8DA 1BORA 5C13A 2CT2A 4A4BA 3N9PA 2LXPC 1MM3A 5LKZA 3L1XA 4WZ2A 3KNVA 1WIMA 2YSJA 1X4UA 4LK9A 2G43A 3ZVZB 1T1HA 5B75A 2H0DA 3VK6A 2VJFB 2ECTA 2MD7B 3RPGC 4TKPB 5I3LA 4X3GA 4A4CA 2C2VS 4GB0A 4XI1A 3LRQA 4V3LC 2HYED 2FUUA 2KIZA 1VD4A 5AITA 5FB0A 4LJNA 2LV9A 3LQJA 3MHSA 2LGVA 1RMDA 2VP7A 1X4JA 4FK5A 5EYAF 2DX8A
chains in the Genus database with same CATH superfamily
2LRIC 4OGEA 4WZ3B 4AP4A 3O70A 5FB1A 3LDYA 2EGMA 2YHNA 4C9ZA 2KWJA 2KFTA 1Z2QA 2KREA 4GNFA 4B7YC 1K2FA 1JM7A 4R7EA 2ECJA 4QQ4A 4R2YA 2Y1NA 3KV5A 5TRBA 3T7LA 4BBQA 5TABA 3DQVR 2OWAA 2ECVA 2K4DA 3ZPVE 1U6GB 2YT5A 4BHWA 1VFYA 3DPLR 5AIUA 2YQMA 2JUNA 5TDRA 2EA6A 2YUCA 5FERA 1F62A 2QJ0A 2OXQC 3MDBC 5SVIB 3LQHA 3U5MA 2FD4A 2KGIA 5KH7A 3M62A 3EB6A 2NAAA 3ZTGA 1FBVA 4N4FA 4QF3A 1WEQA 3T6RA 4MVTA 3ASLA 5H1VA 3N9LA 2ZETC 4O62A 3SOXA 4UP5A 4W4UA 3QZVA 2JMDA 4IC2A 3C6WA 4LLBA 5LKXA 2FUIA 4AYCA 3O33A 2LDRA 2MUMA 5LCWB 2L80A 2VJEB 3O34A 4ZQLA 2CKLB 2IQJA 4A0CD 4R8PK 5G05B 2Y43A 3NG2A 5H9MA 4YBMA 5DINA 5B76A 3M7KA 4GNGA 2K17A 4P5OB 1WEPA 2FFWA 4FO9A 4ZUXU 3IHPA 3HTKC 2JMJA 2KKXA 3ZVYA 3O35A 3RTRB 3SOWA 1DVPA 2XB1A 2ECIA 2G45A 4FIPA 1WEUA 4H9DA 4I7DA 2KWKA 2L43A 2VPEA 3HCSA 4GNEA 2VPGA 5KH3A 2YQLA 2VPBA 2HDPA 2KR4A 2YSMA 3N9QA 4L7XA 4PPEA 2VJFA 4V3KC 2D8SA 4MSXA 3O37A 5H1UA 2QICA 2KU3A 5JG6A 3LJUX 3GL6A 2KGGA 4WA6A 2CSVA 1HYIA 2YU4A 1Z60A 2M3HA 3PUQA 1N87A 5FEYA 4IC3A 4B86C 3U5PA 3O36A 2MNZA 3GV4A 4N3WA 2L5UA 4Z0RA 5H1TA 1FP0A 5B78A 1X4IA 2KKYA 3LVRE 2CRRA 3V43A 3FANA 3I2DA 2I50A 2RI7A 2F42A 2XEUA 2JMIA 4CCGX 2BAYA 2M1RA 4YBTA 2VPDA 2B0OE 3ZNIA 1HYJA 5SVIA 4YATA 3N9OA 2ECNA 4LKAA 2L75A 3L11A 1WESA 3U5OA 2L7PA 1WEEA 2M6MA 2MA6A 1WEWA 4QF2A 2K1JA 4F52B 2C2LA 4Q6FA 5G04B 1LDJB 2UZGA 2CSYA 4YABA 2ECGA 1G25A 2MIQA 4YAXA 1E4UA 3HCTA 3FEHA 2MT5A 3O7AA 3PLWA 2Y1MA 4ZDTA 3FL2A 2VJEA 1MBMA 2YW8A 2CKLA 2G6QA 4YC9A 4S3OB 2LGGA 3JUEA 2DJAA 2F6JA 5DKAA 2MKEA 1CHCA 1WEVA 3N9NA 3FM8C 3M63A 3O47A 5C11A 2PNXA 5B79A 2RSDA 2H0DB 4Z0OA 3FAOA 2FSAA 2XOZA 2M85A 2MA5A 4AUQB 2DSMA 2E6SA 2LGKA 3DWDA 4FJCA 5TBNA 3PHDA 4NN2A 4O64A 3ZPV1 2QIZA 3KDEC 4AVXA 2LGLA 1VYXA 3LVQE 3PURA 3SOUA 1MM2A 4YBSA 1V87A 2D8UA 2YREA 3LQIA 2YURA 2F6NA 2LAUA 4GNDA 1JM7B 1JOCA 2PUYA 1ZBDB 2E6RA 3KV6A 1Z6UA 5KH9A 5D1KB 4LADB 5SVXA 1IYMA 1WEMA 5LKUA 2VNFA 2IDAA 2K16A 2ECWA 4UP0A 2KYUA 1WENA 2RR4A 2KWOA 4S3OC 3T9KA 5D1LB 3KQIA 3H7HA 2YHOA 2EGPA 5G0FA 3U5NA 2P57A 5K3QA 3Q1DA 2LN0A 1WFKA 5B77A 3ZYQA 4I7BA 1LDKC 4YADA 4F1PA 2KE1A 2CSZA 2AN6A 3HCUA 4CA1A 4WZ0A 2JM3A 3RPGB 2LQ6A 2CONA 4PTBA 4I7CA 2YVRA 2L0BA 2YYRA 2MD8C 2EODA 3C5KA 3M99A 4AYCB 2EXUA 2LXHC 1WEOA 1XWHA 2JRJA 1WILA 1WGMA 5J3XA 3EB5A 2XP0A 1WE9A 3SHBA 4L58A 4UI9B 3DDTA 5TDWA 3L1ZB 2KWNA 2XOYA 5LKTA 5SVYA 4A49A 3FJUB 2XOCA 3MHHA 3N9MA 5D1MB 2MNYA 5B8DA 3SUBA 1BORA 5C13A 2CT2A 4A4BA 3N9PA 2LXPC 1MM3A 4OGCA 5LKZA 3L1XA 4WZ2A 3KNVA 1WIMA 2YSJA 1X4UA 4LK9A 3E2DA 2G43A 2M13A 3ZVZB 1T1HA 5B75A 2H0DA 3VK6A 2VJFB 2ECTA 2MD7B 3RPGC 4TKPB 5I3LA 4X3GA 4A4CA 2C2VS 4GB0A 4XI1A 3LRQA 4V3LC 2HYED 2FUUA 2E61A 1DCQA 2KIZA 1VD4A 5AITA 5FB0A 4LJNA 2LV9A 3LQJA 3MHSA 2LGVA 1RMDA 2VP7A 1X4JA 4FK5A 5EYAF 2CRWA 2DX8A
chains in the Genus database with same CATH topology
2LRIC 4WZ3B 4AP4A 3O70A 5FB1A 2YHNA 4C9ZA 2KWJA 2KFTA 1Z2QA 2KREA 4GNFA 4B7YC 1K2FA 1JM7A 4R7EA 2ECJA 4R2YA 2Y1NA 3KV5A 5TRBA 3T7LA 4BBQA 5TABA 3DQVR 2ECVA 2K4DA 3ZPVE 1U6GB 2YT5A 4BHWA 1VFYA 3DPLR 5AIUA 2YQMA 5TDRA 2EA6A 2YUCA 5FERA 1F62A 2QJ0A 2OXQC 3LQHA 3U5MA 2KGIA 5KH7A 3M62A 3EB6A 2NAAA 3ZTGA 1FBVA 4N4FA 4QF3A 1WEQA 3T6RA 4MVTA 3ASLA 5H1VA 3N9LA 2ZETC 3SOXA 4UP5A 4W4UA 3QZVA 2JMDA 4IC2A 3C6WA 4LLBA 5LKXA 2FUIA 4AYCA 3O33A 2LDRA 2MUMA 5LCWB 2L80A 2VJEB 3O34A 4ZQLA 2CKLB 4A0CD 4R8PK 5G05B 5H9MA 2Y43A 3NG2A 4YBMA 5DINA 5B76A 4GNGA 2K17A 4P5OB 1WEPA 4FO9A 4ZUXU 3IHPA 3HTKC 2JMJA 3ZVYA 3O35A 3RTRB 3SOWA 1DVPA 2XB1A 2ECIA 2G45A 4FIPA 1WEUA 4I7DA 2KWKA 2L43A 2VPEA 3HCSA 4GNEA 2VPGA 5KH3A 2YQLA 2VPBA 2HDPA 2KR4A 2YSMA 3N9QA 4L7XA 4PPEA 2VJFA 4V3KC 2D8SA 4MSXA 3O37A 5H1UA 2QICA 2KU3A 5JG6A 3GL6A 2KGGA 4WA6A 1HYIA 2YU4A 1Z60A 2M3HA 3PUQA 1N87A 5FEYA 4IC3A 4B86C 3U5PA 3O36A 2MNZA 3GV4A 4N3WA 2L5UA 5H1TA 1FP0A 5B78A 1X4IA 3V43A 3I2DA 2I50A 2RI7A 2F42A 2XEUA 2JMIA 4CCGX 2BAYA 2M1RA 4YBTA 2VPDA 3ZNIA 1HYJA 4YATA 3N9OA 2ECNA 4LKAA 2L75A 3L11A 1WESA 3U5OA 1WEEA 2M6MA 2MA6A 1WEWA 4QF2A 2K1JA 4F52B 2C2LA 4Q6FA 5G04B 1LDJB 2UZGA 2CSYA 4YABA 2ECGA 1G25A 2MIQA 4YAXA 1E4UA 3HCTA 2MT5A 3O7AA 2Y1MA 4ZDTA 3FL2A 2VJEA 2YW8A 2CKLA 2G6QA 4YC9A 4S3OB 2LGGA 2F6JA 5DKAA 1CHCA 1WEVA 3N9NA 3M63A 5C11A 2PNXA 5B79A 2RSDA 2H0DB 2FSAA 2M85A 2MA5A 4AUQB 2E6SA 2LGKA 4FJCA 5TBNA 3PHDA 4NN2A 4O64A 3ZPV1 2QIZA 4AVXA 2LGLA 1VYXA 3PURA 3SOUA 1MM2A 4YBSA 1V87A 2YREA 3LQIA 2YURA 2F6NA 4GNDA 1JM7B 1JOCA 2PUYA 1ZBDB 2E6RA 3KV6A 1Z6UA 5KH9A 5D1KB 4LADB 1IYMA 1WEMA 5LKUA 2VNFA 2IDAA 2K16A 2ECWA 4UP0A 2KYUA 1WENA 2KWOA 4S3OC 5D1LB 3KQIA 2YHOA 2EGPA 5G0FA 3U5NA 2LN0A 1WFKA 5B77A 3ZYQA 4I7BA 1LDKC 4YADA 2KE1A 2CSZA 2AN6A 3HCUA 4CA1A 4WZ0A 3RPGB 2LQ6A 4PTBA 4I7CA 2L0BA 2YYRA 2MD8C 2EODA 3C5KA 3M99A 4AYCB 2LXHC 1WEOA 1XWHA 2JRJA 1WILA 1WGMA 5J3XA 3EB5A 1WE9A 3SHBA 4L58A 4UI9B 5TDWA 3L1ZB 2KWNA 5LKTA 4A49A 3MHHA 3N9MA 5D1MB 2MNYA 5B8DA 1BORA 5C13A 2CT2A 4A4BA 3N9PA 2LXPC 1MM3A 5LKZA 3L1XA 4WZ2A 3KNVA 1WIMA 2YSJA 1X4UA 4LK9A 2G43A 3ZVZB 1T1HA 5B75A 2H0DA 3VK6A 2VJFB 2ECTA 2MD7B 3RPGC 4TKPB 5I3LA 4X3GA 4A4CA 2C2VS 4GB0A 4XI1A 3LRQA 4V3LC 2HYED 2FUUA 2KIZA 1VD4A 5AITA 5FB0A 4LJNA 2LV9A 3LQJA 3MHSA 2LGVA 1RMDA 2VP7A 1X4JA 4FK5A 5EYAF 2DX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRI C;  4WZ3 B;  4AP4 A;  3O70 A;  5FB1 A;  2YHN A;  4C9Z A;  2KWJ A;  2KFT A;  1Z2Q A;  2KRE A;  4GNF A;  4B7Y C;  1K2F A;  1JM7 A;  4R7E A;  2ECJ A;  4R2Y A;  2Y1N A;  3KV5 A;  5TRB A;  3T7L A;  4BBQ A;  5TAB A;  3DQV R;  2ECV A;  2K4D A;  3ZPV E;  1U6G B;  2YT5 A;  4BHW A;  1VFY A;  3DPL R;  5AIU A;  2YQM A;  5TDR A;  2EA6 A;  2YUC A;  5FER A;  1F62 A;  2QJ0 A;  2OXQ C;  3LQH A;  3U5M A;  2KGI A;  5KH7 A;  3M62 A;  3EB6 A;  2NAA A;  3ZTG A;  1FBV A;  4N4F A;  4QF3 A;  1WEQ A;  3T6R A;  4MVT A;  3ASL A;  5H1V A;  3N9L A;  2ZET C;  3SOX A;  4UP5 A;  4W4U A;  3QZV A;  2JMD A;  4IC2 A;  3C6W A;  4LLB A;  5LKX A;  2FUI A;  4AYC A;  3O33 A;  2LDR A;  2MUM A;  5LCW B;  2L80 A;  2VJE B;  3O34 A;  4ZQL A;  2CKL B;  4A0C D;  4R8P K;  5G05 B;  5H9M A;  2Y43 A;  3NG2 A;  4YBM A;  5DIN A;  5B76 A;  4GNG A;  2K17 A;  4P5O B;  1WEP A;  4FO9 A;  4ZUX U;  3IHP A;  3HTK C;  2JMJ A;  3ZVY A;  3O35 A;  3RTR B;  3SOW A;  1DVP A;  2XB1 A;  2ECI A;  2G45 A;  4FIP A;  1WEU A;  4I7D A;  2KWK A;  2L43 A;  2VPE A;  3HCS A;  4GNE A;  2VPG A;  5KH3 A;  2YQL A;  2VPB A;  2HDP A;  2KR4 A;  2YSM A;  3N9Q A;  4L7X A;  4PPE A;  2VJF A;  4V3K C;  2D8S A;  4MSX A;  3O37 A;  5H1U A;  2QIC A;  2KU3 A;  5JG6 A;  3GL6 A;  2KGG A;  4WA6 A;  1HYI A;  2YU4 A;  1Z60 A;  2M3H A;  3PUQ A;  1N87 A;  5FEY A;  4IC3 A;  4B86 C;  3U5P A;  3O36 A;  2MNZ A;  3GV4 A;  4N3W A;  2L5U A;  5H1T A;  1FP0 A;  5B78 A;  1X4I A;  3V43 A;  3I2D A;  2I50 A;  2RI7 A;  2F42 A;  2XEU A;  2JMI A;  4CCG X;  2BAY A;  2M1R A;  4YBT A;  2VPD A;  3ZNI A;  1HYJ A;  4YAT A;  3N9O A;  2ECN A;  4LKA A;  2L75 A;  3L11 A;  1WES A;  3U5O A;  1WEE A;  2M6M A;  2MA6 A;  1WEW A;  4QF2 A;  2K1J A;  4F52 B;  2C2L A;  4Q6F A;  5G04 B;  1LDJ B;  2UZG A;  2CSY A;  4YAB A;  2ECG A;  1G25 A;  2MIQ A;  4YAX A;  1E4U A;  3HCT A;  2MT5 A;  3O7A A;  2Y1M A;  4ZDT A;  3FL2 A;  2VJE A;  2YW8 A;  2CKL A;  2G6Q A;  4YC9 A;  4S3O B;  2LGG A;  2F6J A;  5DKA A;  1CHC A;  1WEV A;  3N9N A;  3M63 A;  5C11 A;  2PNX A;  5B79 A;  2RSD A;  2H0D B;  2FSA A;  2M85 A;  2MA5 A;  4AUQ B;  2E6S A;  2LGK A;  4FJC A;  5TBN A;  3PHD A;  4NN2 A;  4O64 A;  3ZPV 1;  2QIZ A;  4AVX A;  2LGL A;  1VYX A;  3PUR A;  3SOU A;  1MM2 A;  4YBS A;  1V87 A;  2YRE A;  3LQI A;  2YUR A;  2F6N A;  4GND A;  1JM7 B;  1JOC A;  2PUY A;  1ZBD B;  2E6R A;  3KV6 A;  1Z6U A;  5KH9 A;  5D1K B;  4LAD B;  1IYM A;  1WEM A;  5LKU A;  2VNF A;  2IDA A;  2K16 A;  2ECW A;  4UP0 A;  2KYU A;  1WEN A;  2KWO A;  4S3O C;  5D1L B;  3KQI A;  2YHO A;  2EGP A;  5G0F A;  3U5N A;  2LN0 A;  1WFK A;  5B77 A;  3ZYQ A;  4I7B A;  1LDK C;  4YAD A;  2KE1 A;  2CSZ A;  2AN6 A;  3HCU A;  4CA1 A;  4WZ0 A;  3RPG B;  2LQ6 A;  4PTB A;  4I7C A;  2L0B A;  2YYR A;  2MD8 C;  2EOD A;  3C5K A;  3M99 A;  4AYC B;  2LXH C;  1WEO A;  1XWH A;  2JRJ A;  1WIL A;  1WGM A;  5J3X A;  3EB5 A;  1WE9 A;  3SHB A;  4L58 A;  4UI9 B;  5TDW A;  3L1Z B;  2KWN A;  5LKT A;  4A49 A;  3MHH A;  3N9M A;  5D1M B;  2MNY A;  5B8D A;  1BOR A;  5C13 A;  2CT2 A;  4A4B A;  3N9P A;  2LXP C;  1MM3 A;  5LKZ A;  3L1X A;  4WZ2 A;  3KNV A;  1WIM A;  2YSJ A;  1X4U A;  4LK9 A;  2G43 A;  3ZVZ B;  1T1H A;  5B75 A;  2H0D A;  3VK6 A;  2VJF B;  2ECT A;  2MD7 B;  3RPG C;  4TKP B;  5I3L A;  4X3G A;  4A4C A;  2C2V S;  4GB0 A;  4XI1 A;  3LRQ A;  4V3L C;  2HYE D;  2FUU A;  2KIZ A;  1VD4 A;  5AIT A;  5FB0 A;  4LJN A;  2LV9 A;  3LQJ A;  3MHS A;  2LGV A;  1RMD A;  2VP7 A;  1X4J A;  4FK5 A;  5EYA F;  2DX8 A; 
#chains in the Genus database with same CATH topology
 2LRI C;  4OGE A;  4WZ3 B;  4AP4 A;  3O70 A;  5FB1 A;  3LDY A;  2EGM A;  2YHN A;  4C9Z A;  2KWJ A;  2KFT A;  1Z2Q A;  2KRE A;  4GNF A;  4B7Y C;  1K2F A;  1JM7 A;  4R7E A;  2ECJ A;  4QQ4 A;  4R2Y A;  2Y1N A;  3KV5 A;  5TRB A;  3T7L A;  4BBQ A;  5TAB A;  3DQV R;  2OWA A;  2ECV A;  2K4D A;  3ZPV E;  1U6G B;  2YT5 A;  4BHW A;  1VFY A;  3DPL R;  5AIU A;  2YQM A;  2JUN A;  5TDR A;  2EA6 A;  2YUC A;  5FER A;  1F62 A;  2QJ0 A;  2OXQ C;  3MDB C;  5SVI B;  3LQH A;  3U5M A;  2FD4 A;  2KGI A;  5KH7 A;  3M62 A;  3EB6 A;  2NAA A;  3ZTG A;  1FBV A;  4N4F A;  4QF3 A;  1WEQ A;  3T6R A;  4MVT A;  3ASL A;  5H1V A;  3N9L A;  2ZET C;  4O62 A;  3SOX A;  4UP5 A;  4W4U A;  3QZV A;  2JMD A;  4IC2 A;  3C6W A;  4LLB A;  5LKX A;  2FUI A;  4AYC A;  3O33 A;  2LDR A;  2MUM A;  5LCW B;  2L80 A;  2VJE B;  3O34 A;  4ZQL A;  2CKL B;  2IQJ A;  4A0C D;  4R8P K;  5G05 B;  2Y43 A;  3NG2 A;  5H9M A;  4YBM A;  5DIN A;  5B76 A;  3M7K A;  4GNG A;  2K17 A;  4P5O B;  1WEP A;  2FFW A;  4FO9 A;  4ZUX U;  3IHP A;  3HTK C;  2JMJ A;  2KKX A;  3ZVY A;  3O35 A;  3RTR B;  3SOW A;  1DVP A;  2XB1 A;  2ECI A;  2G45 A;  4FIP A;  1WEU A;  4H9D A;  4I7D A;  2KWK A;  2L43 A;  2VPE A;  3HCS A;  4GNE A;  2VPG A;  5KH3 A;  2YQL A;  2VPB A;  2HDP A;  2KR4 A;  2YSM A;  3N9Q A;  4L7X A;  4PPE A;  2VJF A;  4V3K C;  2D8S A;  4MSX A;  3O37 A;  5H1U A;  2QIC A;  2KU3 A;  5JG6 A;  3LJU X;  3GL6 A;  2KGG A;  4WA6 A;  2CSV A;  1HYI A;  2YU4 A;  1Z60 A;  2M3H A;  3PUQ A;  1N87 A;  5FEY A;  4IC3 A;  4B86 C;  3U5P A;  3O36 A;  2MNZ A;  3GV4 A;  4N3W A;  2L5U A;  4Z0R A;  5H1T A;  1FP0 A;  5B78 A;  1X4I A;  2KKY A;  3LVR E;  2CRR A;  3V43 A;  3FAN A;  3I2D A;  2I50 A;  2RI7 A;  2F42 A;  2XEU A;  2JMI A;  4CCG X;  2BAY A;  2M1R A;  4YBT A;  2VPD A;  2B0O E;  3ZNI A;  1HYJ A;  5SVI A;  4YAT A;  3N9O A;  2ECN A;  4LKA A;  2L75 A;  3L11 A;  1WES A;  3U5O A;  2L7P A;  1WEE A;  2M6M A;  2MA6 A;  1WEW A;  4QF2 A;  2K1J A;  4F52 B;  2C2L A;  4Q6F A;  5G04 B;  1LDJ B;  2UZG A;  2CSY A;  4YAB A;  2ECG A;  1G25 A;  2MIQ A;  4YAX A;  1E4U A;  3HCT A;  3FEH A;  2MT5 A;  3O7A A;  3PLW A;  2Y1M A;  4ZDT A;  3FL2 A;  2VJE A;  1MBM A;  2YW8 A;  2CKL A;  2G6Q A;  4YC9 A;  4S3O B;  2LGG A;  3JUE A;  2DJA A;  2F6J A;  5DKA A;  2MKE A;  1CHC A;  1WEV A;  3N9N A;  3FM8 C;  3M63 A;  3O47 A;  5C11 A;  2PNX A;  5B79 A;  2RSD A;  2H0D B;  4Z0O A;  3FAO A;  2FSA A;  2XOZ A;  2M85 A;  2MA5 A;  4AUQ B;  2DSM A;  2E6S A;  2LGK A;  3DWD A;  4FJC A;  5TBN A;  3PHD A;  4NN2 A;  4O64 A;  3ZPV 1;  2QIZ A;  3KDE C;  4AVX A;  2LGL A;  1VYX A;  3LVQ E;  3PUR A;  3SOU A;  1MM2 A;  4YBS A;  1V87 A;  2D8U A;  2YRE A;  3LQI A;  2YUR A;  2F6N A;  2LAU A;  4GND A;  1JM7 B;  1JOC A;  2PUY A;  1ZBD B;  2E6R A;  3KV6 A;  1Z6U A;  5KH9 A;  5D1K B;  4LAD B;  5SVX A;  1IYM A;  1WEM A;  5LKU A;  2VNF A;  2IDA A;  2K16 A;  2ECW A;  4UP0 A;  2KYU A;  1WEN A;  2RR4 A;  2KWO A;  4S3O C;  3T9K A;  5D1L B;  3KQI A;  3H7H A;  2YHO A;  2EGP A;  5G0F A;  3U5N A;  2P57 A;  5K3Q A;  3Q1D A;  2LN0 A;  1WFK A;  5B77 A;  3ZYQ A;  4I7B A;  1LDK C;  4YAD A;  4F1P A;  2KE1 A;  2CSZ A;  2AN6 A;  3HCU A;  4CA1 A;  4WZ0 A;  2JM3 A;  3RPG B;  2LQ6 A;  2CON A;  4PTB A;  4I7C A;  2YVR A;  2L0B A;  2YYR A;  2MD8 C;  2EOD A;  3C5K A;  3M99 A;  4AYC B;  2EXU A;  2LXH C;  1WEO A;  1XWH A;  2JRJ A;  1WIL A;  1WGM A;  5J3X A;  3EB5 A;  2XP0 A;  1WE9 A;  3SHB A;  4L58 A;  4UI9 B;  3DDT A;  5TDW A;  3L1Z B;  2KWN A;  2XOY A;  5LKT A;  5SVY A;  4A49 A;  3FJU B;  2XOC A;  3MHH A;  3N9M A;  5D1M B;  2MNY A;  5B8D A;  3SUB A;  1BOR A;  5C13 A;  2CT2 A;  4A4B A;  3N9P A;  2LXP C;  1MM3 A;  4OGC A;  5LKZ A;  3L1X A;  4WZ2 A;  3KNV A;  1WIM A;  2YSJ A;  1X4U A;  4LK9 A;  3E2D A;  2G43 A;  2M13 A;  3ZVZ B;  1T1H A;  5B75 A;  2H0D A;  3VK6 A;  2VJF B;  2ECT A;  2MD7 B;  3RPG C;  4TKP B;  5I3L A;  4X3G A;  4A4C A;  2C2V S;  4GB0 A;  4XI1 A;  3LRQ A;  4V3L C;  2HYE D;  2FUU A;  2E61 A;  1DCQ A;  2KIZ A;  1VD4 A;  5AIT A;  5FB0 A;  4LJN A;  2LV9 A;  3LQJ A;  3MHS A;  2LGV A;  1RMD A;  2VP7 A;  1X4J A;  4FK5 A;  5EYA F;  2CRW A;  2DX8 A; 
#chains in the Genus database with same CATH homology
 2LRI C;  4WZ3 B;  4AP4 A;  3O70 A;  5FB1 A;  2YHN A;  4C9Z A;  2KWJ A;  2KFT A;  1Z2Q A;  2KRE A;  4GNF A;  4B7Y C;  1K2F A;  1JM7 A;  4R7E A;  2ECJ A;  4R2Y A;  2Y1N A;  3KV5 A;  5TRB A;  3T7L A;  4BBQ A;  5TAB A;  3DQV R;  2ECV A;  2K4D A;  3ZPV E;  1U6G B;  2YT5 A;  4BHW A;  1VFY A;  3DPL R;  5AIU A;  2YQM A;  5TDR A;  2EA6 A;  2YUC A;  5FER A;  1F62 A;  2QJ0 A;  2OXQ C;  3LQH A;  3U5M A;  2KGI A;  5KH7 A;  3M62 A;  3EB6 A;  2NAA A;  3ZTG A;  1FBV A;  4N4F A;  4QF3 A;  1WEQ A;  3T6R A;  4MVT A;  3ASL A;  5H1V A;  3N9L A;  2ZET C;  3SOX A;  4UP5 A;  4W4U A;  3QZV A;  2JMD A;  4IC2 A;  3C6W A;  4LLB A;  5LKX A;  2FUI A;  4AYC A;  3O33 A;  2LDR A;  2MUM A;  5LCW B;  2L80 A;  2VJE B;  3O34 A;  4ZQL A;  2CKL B;  4A0C D;  4R8P K;  5G05 B;  5H9M A;  2Y43 A;  3NG2 A;  4YBM A;  5DIN A;  5B76 A;  4GNG A;  2K17 A;  4P5O B;  1WEP A;  4FO9 A;  4ZUX U;  3IHP A;  3HTK C;  2JMJ A;  3ZVY A;  3O35 A;  3RTR B;  3SOW A;  1DVP A;  2XB1 A;  2ECI A;  2G45 A;  4FIP A;  1WEU A;  4I7D A;  2KWK A;  2L43 A;  2VPE A;  3HCS A;  4GNE A;  2VPG A;  5KH3 A;  2YQL A;  2VPB A;  2HDP A;  2KR4 A;  2YSM A;  3N9Q A;  4L7X A;  4PPE A;  2VJF A;  4V3K C;  2D8S A;  4MSX A;  3O37 A;  5H1U A;  2QIC A;  2KU3 A;  5JG6 A;  3GL6 A;  2KGG A;  4WA6 A;  1HYI A;  2YU4 A;  1Z60 A;  2M3H A;  3PUQ A;  1N87 A;  5FEY A;  4IC3 A;  4B86 C;  3U5P A;  3O36 A;  2MNZ A;  3GV4 A;  4N3W A;  2L5U A;  5H1T A;  1FP0 A;  5B78 A;  1X4I A;  3V43 A;  3I2D A;  2I50 A;  2RI7 A;  2F42 A;  2XEU A;  2JMI A;  4CCG X;  2BAY A;  2M1R A;  4YBT A;  2VPD A;  3ZNI A;  1HYJ A;  4YAT A;  3N9O A;  2ECN A;  4LKA A;  2L75 A;  3L11 A;  1WES A;  3U5O A;  1WEE A;  2M6M A;  2MA6 A;  1WEW A;  4QF2 A;  2K1J A;  4F52 B;  2C2L A;  4Q6F A;  5G04 B;  1LDJ B;  2UZG A;  2CSY A;  4YAB A;  2ECG A;  1G25 A;  2MIQ A;  4YAX A;  1E4U A;  3HCT A;  2MT5 A;  3O7A A;  2Y1M A;  4ZDT A;  3FL2 A;  2VJE A;  2YW8 A;  2CKL A;  2G6Q A;  4YC9 A;  4S3O B;  2LGG A;  2F6J A;  5DKA A;  1CHC A;  1WEV A;  3N9N A;  3M63 A;  5C11 A;  2PNX A;  5B79 A;  2RSD A;  2H0D B;  2FSA A;  2M85 A;  2MA5 A;  4AUQ B;  2E6S A;  2LGK A;  4FJC A;  5TBN A;  3PHD A;  4NN2 A;  4O64 A;  3ZPV 1;  2QIZ A;  4AVX A;  2LGL A;  1VYX A;  3PUR A;  3SOU A;  1MM2 A;  4YBS A;  1V87 A;  2YRE A;  3LQI A;  2YUR A;  2F6N A;  4GND A;  1JM7 B;  1JOC A;  2PUY A;  1ZBD B;  2E6R A;  3KV6 A;  1Z6U A;  5KH9 A;  5D1K B;  4LAD B;  1IYM A;  1WEM A;  5LKU A;  2VNF A;  2IDA A;  2K16 A;  2ECW A;  4UP0 A;  2KYU A;  1WEN A;  2KWO A;  4S3O C;  5D1L B;  3KQI A;  2YHO A;  2EGP A;  5G0F A;  3U5N A;  2LN0 A;  1WFK A;  5B77 A;  3ZYQ A;  4I7B A;  1LDK C;  4YAD A;  2KE1 A;  2CSZ A;  2AN6 A;  3HCU A;  4CA1 A;  4WZ0 A;  3RPG B;  2LQ6 A;  4PTB A;  4I7C A;  2L0B A;  2YYR A;  2MD8 C;  2EOD A;  3C5K A;  3M99 A;  4AYC B;  2LXH C;  1WEO A;  1XWH A;  2JRJ A;  1WIL A;  1WGM A;  5J3X A;  3EB5 A;  1WE9 A;  3SHB A;  4L58 A;  4UI9 B;  5TDW A;  3L1Z B;  2KWN A;  5LKT A;  4A49 A;  3MHH A;  3N9M A;  5D1M B;  2MNY A;  5B8D A;  1BOR A;  5C13 A;  2CT2 A;  4A4B A;  3N9P A;  2LXP C;  1MM3 A;  5LKZ A;  3L1X A;  4WZ2 A;  3KNV A;  1WIM A;  2YSJ A;  1X4U A;  4LK9 A;  2G43 A;  3ZVZ B;  1T1H A;  5B75 A;  2H0D A;  3VK6 A;  2VJF B;  2ECT A;  2MD7 B;  3RPG C;  4TKP B;  5I3L A;  4X3G A;  4A4C A;  2C2V S;  4GB0 A;  4XI1 A;  3LRQ A;  4V3L C;  2HYE D;  2FUU A;  2KIZ A;  1VD4 A;  5AIT A;  5FB0 A;  4LJN A;  2LV9 A;  3LQJ A;  3MHS A;  2LGV A;  1RMD A;  2VP7 A;  1X4J A;  4FK5 A;  5EYA F;  2DX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...