2F42A

Dimerization and u-box domains of zebrafish c-terminal of hsp70 interacting protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
156
structure length
138
Chain Sequence
AKKKRWNSIEEKRISQENELHAYLSKLILAEKERELDDSKHDKYLMDMDELFSQVDEKRKKREIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQENGWVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Interactions of the Helical and U-Box Domains of CHIP, the C Terminus of HSP70 Interacting Protein.
pubmed doi rcsb
source organism Danio rerio
molecule tags Chaperone
molecule keywords STIP1 homology and U-box containing protein 1
total genus 49
structure length 138
sequence length 156
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
A PF18391 CHIP_TPR_N CHIP N-terminal tetratricopeptide repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f42A02
3O70A 2MUMA 4P5OB 5D1MB 1WENA 2YSJA 3LQIA 2VJEA 3NG2A 3PHDA 2C2VS 4FO9A 4AVXA 2D8SA 3GV4A 1E4UA 4BHWA 2JRJA 4L58A 4FK5A 4V3LC 2YHNA 4UP5A 1WEEA 2VPGA 3M62A 4WZ3B 4YBMA 4IC3A 4B86C 4UI9B 4AP4A 3L11A 2LXHC 2G45A 1WEOA 3V43A 5I3LA 2MA5A 4N4FA 3O34A 2K16A 4LLBA 2LN0A 5J3XA 1WEMA 2ECIA 4MSXA 4ZUXU 2KREA 3ZVZB 5TDRA 2YQLA 2YREA 3ZPVE 2RI7A 2NAAA 2PNXA 2QJ0A 3KNVA 2HYED 5FERA 4YC9A 4S3OC 1Z2QA 4I7CA 5KH7A 2BAYA 4ZDTA 1LDKC 3N9NA 3N9OA 2M1RA 2KE1A 4WZ2A 4W4UA 3U5MA 1WFKA 2I50A 4I7BA 1WILA 1HYJA 5FB1A 1IYMA 4ZQLA 2M85A 4YBTA 3FL2A 5B75A 2VPEA 5H9MA 5LKXA 3LQHA 4NN2A 4TKPB 2UZGA 2MNYA 2YW8A 3N9LA 5FB0A 5TBNA 2JMJA 1DVPA 2AN6A 3SHBA 2LDRA 1WGMA 3U5PA 5LKZA 2YHOA 1WEWA 2CSZA 4BBQA 2XB1A 2KWNA 2CKLA 3N9PA 1X4JA 3LQJA 2CSYA 3GL6A 1LDJB 3O7AA 3HCUA 3MHSA 3ASLA 3C5KA 4C9ZA 3DQVR 2LGLA 2KIZA 1RMDA 5TRBA 3L1ZB 5LKTA 2MD8C 2KGGA 5D1LB 5EYAF 2KWKA 2EGPA 2ECWA 2RSDA 1WE9A 5B79A 4L7XA 4GNFA 1JM7B 3EB5A 4B7YC 1V87A 2KWJA 2F6NA 4S3OB 3QZVA 2KYUA 4I7DA 2ECJA 4O64A 1VD4A 1FBVA 5G05B 5H1UA 2CKLB 1WEUA 4QF3A 4PPEA 2L80A 1WESA 4A4BA 1WEVA 3EB6A 2H0DB 2CT2A 3KV5A 2VJFB 2LXPC 3KQIA 3ZTGA 5H1TA 3MHHA 1BORA 2MNZA 4N3WA 3PUQA 1Z60A 2QICA 2C2LA 3RTRB 4GNGA 1WEPA 1MM3A 1WEQA 3VK6A 5B76A 1CHCA 3O36A 1JM7A 2LGKA 4R8PK 4QF2A 3PURA 2XEUA 3HCSA 2VPBA 5AITA 4R2YA 3M63A 2E6RA 3T7LA 2KGIA 2G43A 2YT5A 4GNEA 4R7EA 3ZVYA 5TDWA 2G6QA 2KR4A 2HDPA 1FP0A 2VNFA 4Q6FA 2LGGA 5JG6A 5B8DA 2MIQA 2YU4A 4YAXA 2LRIC 3HCTA 2K1JA 2QIZA 5LKUA 2L75A 5DINA 1K2FA 4LK9A 3SOXA 2VJEB 5KH9A 5LCWB 3T6RA 2KFTA 2ECVA 4WA6A 2M3HA 2ECNA 3U5OA 1G25A 4PTBA 1X4UA 2KWOA 2L43A 3SOWA 1F62A 1X4IA 2MT5A 4XI1A 4LJNA 2MD7B 2YQMA 2IDAA 2H0DA 4FIPA 5TABA 5DKAA 2FUUA 2KU3A 4GB0A 3HTKC 5AIUA 3LRQA 2JMIA 4LKAA 3RPGB 3O33A 4UP0A 5KH3A 3KV6A 2LV9A 2YSMA 4A0CD 1JOCA 4F52B 4YABA 2OXQC 2EA6A 3O37A 3ZYQA 2FSAA 2ECGA 5B78A 3N9MA 3RPGC 1Z6UA 3C6WA 2Y1NA 4WZ0A 4X3GA 2L5UA 2VPDA 2E6SA 2LGVA 2YUCA 2Y43A 2EODA 2Y1MA 5G0FA 2JMDA 5D1KB 1N87A 3L1XA 3SOUA 3N9QA 2ECTA 3DPLR 1U6GB 2PUYA 3ZNIA 5C11A 1HYIA 2LQ6A 3IHPA 1WIMA 5FEYA 4A4CA 2VP7A 4V3KC 5G04B 4CA1A 2F42A 2L0BA 1XWHA 2MA6A 4IC2A 2DX8A 4MVTA 2YYRA 2M6MA 1ZBDB 1VYXA 1VFYA 2YURA 3M99A 5C13A 5B77A 3ZPV1 2K17A 4FJCA 4GNDA 4A49A 4YBSA 3U5NA 4AUQB 1MM2A 3O35A 4YATA 2FUIA 4AYCB 3I2DA 4AYCA 2K4DA 2VJFA 5H1VA 4YADA 1T1HA 2F6JA 2ZETC 4LADB 4CCGX
chains in the Genus database with same CATH superfamily
3O70A 2MUMA 2CRRA 4P5OB 5D1MB 1WENA 2YSJA 3LQIA 2VJEA 3NG2A 2B0OE 3PHDA 2C2VS 2D8UA 4FO9A 4AVXA 2D8SA 3GV4A 1E4UA 3FANA 4BHWA 2JRJA 4L58A 4FK5A 4V3LC 2YHNA 4UP5A 1WEEA 2VPGA 3M62A 4WZ3B 1MBMA 4YBMA 4IC3A 4B86C 4UI9B 4AP4A 3L11A 2LXHC 2CONA 2G45A 1WEOA 3H7HA 3V43A 5I3LA 2MA5A 4N4FA 3O34A 4F1PA 2K16A 4LLBA 2LN0A 5J3XA 1WEMA 2ECIA 4MSXA 4ZUXU 2XOYA 2KREA 3ZVZB 5TDRA 2YQLA 2YVRA 2YREA 3JUEA 3ZPVE 2RI7A 2NAAA 2FFWA 2PNXA 2QJ0A 3KNVA 2HYED 5FERA 4YC9A 2IQJA 4S3OC 1Z2QA 4I7CA 5KH7A 2BAYA 4ZDTA 1LDKC 3E2DA 3N9NA 3N9OA 2M1RA 2KE1A 4WZ2A 4W4UA 3U5MA 1WFKA 4I7BA 2I50A 1WILA 1HYJA 5FB1A 2OWAA 5SVIB 3FEHA 1IYMA 4ZQLA 2M85A 2E61A 4YBTA 3FL2A 5B75A 2VPEA 3LVRE 5H9MA 5LKXA 3LQHA 4NN2A 4TKPB 2UZGA 2MNYA 3FM8C 2YW8A 3N9LA 5FB0A 5TBNA 2JMJA 1DVPA 2AN6A 3SHBA 2LAUA 2LDRA 2JUNA 1WGMA 3U5PA 5LKZA 2YHOA 5SVXA 1WEWA 2CSZA 3LVQE 4BBQA 2XB1A 2KWNA 2CKLA 3N9PA 1X4JA 3LQJA 2CSYA 3O47A 3GL6A 1LDJB 3O7AA 3HCUA 3MHSA 3ASLA 3C5KA 4C9ZA 3DQVR 2LGLA 2KIZA 1RMDA 5TRBA 3L1ZB 3T9KA 3Q1DA 5LKTA 2MD8C 2KGGA 2L7PA 2CSVA 5D1LB 2DJAA 4H9DA 5EYAF 2EGMA 2KWKA 2EGPA 2ECWA 2RSDA 1WE9A 5B79A 4L7XA 4O62A 4GNFA 1JM7B 3EB5A 4B7YC 1V87A 2KWJA 2F6NA 2KKYA 4S3OB 3QZVA 2KYUA 4I7DA 2ECJA 4O64A 2MKEA 1VD4A 1FBVA 5G05B 5H1UA 2CKLB 1WEUA 4QF3A 4PPEA 2L80A 4Z0RA 1WESA 4A4BA 1WEVA 3EB6A 3DWDA 2H0DB 2CT2A 3KV5A 2VJFB 2LXPC 3KQIA 3ZTGA 5H1TA 3MHHA 1BORA 2MNZA 4N3WA 3FAOA 3PUQA 1Z60A 2QICA 2C2LA 3RTRB 4GNGA 1WEPA 3FJUB 1MM3A 1WEQA 3VK6A 5B76A 1CHCA 3O36A 1JM7A 2LGKA 4R8PK 4QF2A 3PURA 2XEUA 2XP0A 3HCSA 2VPBA 5AITA 4R2YA 2RR4A 3M63A 2E6RA 3T7LA 2KGIA 2G43A 2YT5A 3LDYA 4GNEA 5K3QA 3MDBC 4R7EA 3ZVYA 5TDWA 2G6QA 3PLWA 2KR4A 2HDPA 1FP0A 2VNFA 4Q6FA 2LGGA 5JG6A 5B8DA 2MIQA 2YU4A 3SUBA 4YAXA 2LRIC 3HCTA 2K1JA 2QIZA 5LKUA 2L75A 5SVYA 5DINA 2EXUA 1K2FA 4LK9A 3SOXA 2VJEB 5KH9A 5LCWB 3T6RA 2KFTA 2ECVA 4WA6A 2M3HA 2XOCA 2ECNA 3U5OA 1G25A 4PTBA 1X4UA 2KWOA 2L43A 3SOWA 1F62A 1X4IA 2KKXA 2MT5A 4XI1A 4LJNA 2MD7B 2YQMA 2IDAA 2H0DA 4FIPA 5TABA 5DKAA 2FUUA 4OGCA 2KU3A 4GB0A 2M13A 3HTKC 5AIUA 3KDEC 3LRQA 2JMIA 4LKAA 3RPGB 3DDTA 3O33A 4UP0A 5KH3A 3KV6A 2LV9A 2YSMA 4A0CD 1JOCA 4F52B 4YABA 2OXQC 2EA6A 3O37A 3ZYQA 2FSAA 2ECGA 5B78A 3N9MA 3RPGC 1Z6UA 3C6WA 2Y1NA 4WZ0A 3M7KA 4X3GA 2L5UA 2VPDA 2E6SA 2LGVA 2YUCA 2Y43A 2EODA 2Y1MA 5G0FA 2JMDA 5D1KB 1N87A 3L1XA 2JM3A 3SOUA 3N9QA 2ECTA 2XOZA 3DPLR 1U6GB 2PUYA 3ZNIA 5C11A 1HYIA 2LQ6A 3IHPA 2CRWA 1WIMA 5FEYA 4A4CA 2VP7A 4V3KC 5G04B 1DCQA 4Z0OA 4OGEA 4CA1A 2F42A 2L0BA 1XWHA 2MA6A 4IC2A 2DX8A 3LJUX 4MVTA 2YYRA 2M6MA 2P57A 1ZBDB 1VYXA 1VFYA 2YURA 3M99A 5C13A 5B77A 3ZPV1 2FD4A 4QQ4A 2K17A 2DSMA 4FJCA 4GNDA 4A49A 4YBSA 3U5NA 4AUQB 1MM2A 3O35A 4YATA 2FUIA 4AYCB 3I2DA 4AYCA 5SVIA 2K4DA 2VJFA 5H1VA 4YADA 1T1HA 2F6JA 2ZETC 4LADB 4CCGX
chains in the Genus database with same CATH topology
3O70A 2MUMA 4P5OB 5D1MB 1WENA 2YSJA 3LQIA 2VJEA 3NG2A 3PHDA 2C2VS 4FO9A 4AVXA 2D8SA 3GV4A 1E4UA 4BHWA 2JRJA 4L58A 4FK5A 4V3LC 2YHNA 4UP5A 1WEEA 2VPGA 3M62A 4WZ3B 4YBMA 4IC3A 4B86C 4UI9B 4AP4A 3L11A 2LXHC 2G45A 1WEOA 3V43A 5I3LA 2MA5A 4N4FA 3O34A 2K16A 4LLBA 2LN0A 5J3XA 1WEMA 2ECIA 4MSXA 4ZUXU 2KREA 3ZVZB 5TDRA 2YQLA 2YREA 3ZPVE 2RI7A 2NAAA 2PNXA 2QJ0A 3KNVA 2HYED 5FERA 4YC9A 4S3OC 1Z2QA 4I7CA 5KH7A 2BAYA 4ZDTA 1LDKC 3N9NA 3N9OA 2M1RA 2KE1A 4WZ2A 4W4UA 3U5MA 1WFKA 2I50A 4I7BA 1WILA 1HYJA 5FB1A 1IYMA 4ZQLA 2M85A 4YBTA 3FL2A 5B75A 2VPEA 5H9MA 5LKXA 3LQHA 4NN2A 4TKPB 2UZGA 2MNYA 2YW8A 3N9LA 5FB0A 5TBNA 2JMJA 1DVPA 2AN6A 3SHBA 2LDRA 1WGMA 3U5PA 5LKZA 2YHOA 1WEWA 2CSZA 4BBQA 2XB1A 2KWNA 2CKLA 3N9PA 1X4JA 3LQJA 2CSYA 3GL6A 1LDJB 3O7AA 3HCUA 3MHSA 3ASLA 3C5KA 4C9ZA 3DQVR 2LGLA 2KIZA 1RMDA 5TRBA 3L1ZB 5LKTA 2MD8C 2KGGA 5D1LB 5EYAF 2KWKA 2EGPA 2ECWA 2RSDA 1WE9A 5B79A 4L7XA 4GNFA 1JM7B 3EB5A 4B7YC 1V87A 2KWJA 2F6NA 4S3OB 3QZVA 2KYUA 4I7DA 2ECJA 4O64A 1VD4A 1FBVA 5G05B 5H1UA 2CKLB 1WEUA 4QF3A 4PPEA 2L80A 1WESA 4A4BA 1WEVA 3EB6A 2H0DB 2CT2A 3KV5A 2VJFB 2LXPC 3KQIA 3ZTGA 5H1TA 3MHHA 1BORA 2MNZA 4N3WA 3PUQA 1Z60A 2QICA 2C2LA 3RTRB 4GNGA 1WEPA 1MM3A 1WEQA 3VK6A 5B76A 1CHCA 3O36A 1JM7A 2LGKA 4R8PK 4QF2A 3PURA 2XEUA 3HCSA 2VPBA 5AITA 4R2YA 3M63A 2E6RA 3T7LA 2KGIA 2G43A 2YT5A 4GNEA 4R7EA 3ZVYA 5TDWA 2G6QA 2KR4A 2HDPA 1FP0A 2VNFA 4Q6FA 2LGGA 5JG6A 5B8DA 2MIQA 2YU4A 4YAXA 2LRIC 3HCTA 2K1JA 2QIZA 5LKUA 2L75A 5DINA 1K2FA 4LK9A 3SOXA 2VJEB 5KH9A 5LCWB 3T6RA 2KFTA 2ECVA 4WA6A 2M3HA 2ECNA 3U5OA 1G25A 4PTBA 1X4UA 2KWOA 2L43A 3SOWA 1F62A 1X4IA 2MT5A 4XI1A 4LJNA 2MD7B 2YQMA 2IDAA 2H0DA 4FIPA 5TABA 5DKAA 2FUUA 2KU3A 4GB0A 3HTKC 5AIUA 3LRQA 2JMIA 4LKAA 3RPGB 3O33A 4UP0A 5KH3A 3KV6A 2LV9A 2YSMA 4A0CD 1JOCA 4F52B 4YABA 2OXQC 2EA6A 3O37A 3ZYQA 2FSAA 2ECGA 5B78A 3N9MA 3RPGC 1Z6UA 3C6WA 2Y1NA 4WZ0A 4X3GA 2L5UA 2VPDA 2E6SA 2LGVA 2YUCA 2Y43A 2EODA 2Y1MA 5G0FA 2JMDA 5D1KB 1N87A 3L1XA 3SOUA 3N9QA 2ECTA 3DPLR 1U6GB 2PUYA 3ZNIA 5C11A 1HYIA 2LQ6A 3IHPA 1WIMA 5FEYA 4A4CA 2VP7A 4V3KC 5G04B 4CA1A 2F42A 2L0BA 1XWHA 2MA6A 4IC2A 2DX8A 4MVTA 2YYRA 2M6MA 1ZBDB 1VYXA 1VFYA 2YURA 3M99A 5C13A 5B77A 3ZPV1 2K17A 4FJCA 4GNDA 4A49A 4YBSA 3U5NA 4AUQB 1MM2A 3O35A 4YATA 2FUIA 4AYCB 3I2DA 4AYCA 2K4DA 2VJFA 5H1VA 4YADA 1T1HA 2F6JA 2ZETC 4LADB 4CCGX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O70 A;  2MUM A;  4P5O B;  5D1M B;  1WEN A;  2YSJ A;  3LQI A;  2VJE A;  3NG2 A;  3PHD A;  2C2V S;  4FO9 A;  4AVX A;  2D8S A;  3GV4 A;  1E4U A;  4BHW A;  2JRJ A;  4L58 A;  4FK5 A;  4V3L C;  2YHN A;  4UP5 A;  1WEE A;  2VPG A;  3M62 A;  4WZ3 B;  4YBM A;  4IC3 A;  4B86 C;  4UI9 B;  4AP4 A;  3L11 A;  2LXH C;  2G45 A;  1WEO A;  3V43 A;  5I3L A;  2MA5 A;  4N4F A;  3O34 A;  2K16 A;  4LLB A;  2LN0 A;  5J3X A;  1WEM A;  2ECI A;  4MSX A;  4ZUX U;  2KRE A;  3ZVZ B;  5TDR A;  2YQL A;  2YRE A;  3ZPV E;  2RI7 A;  2NAA A;  2PNX A;  2QJ0 A;  3KNV A;  2HYE D;  5FER A;  4YC9 A;  4S3O C;  1Z2Q A;  4I7C A;  5KH7 A;  2BAY A;  4ZDT A;  1LDK C;  3N9N A;  3N9O A;  2M1R A;  2KE1 A;  4WZ2 A;  4W4U A;  3U5M A;  1WFK A;  2I50 A;  4I7B A;  1WIL A;  1HYJ A;  5FB1 A;  1IYM A;  4ZQL A;  2M85 A;  4YBT A;  3FL2 A;  5B75 A;  2VPE A;  5H9M A;  5LKX A;  3LQH A;  4NN2 A;  4TKP B;  2UZG A;  2MNY A;  2YW8 A;  3N9L A;  5FB0 A;  5TBN A;  2JMJ A;  1DVP A;  2AN6 A;  3SHB A;  2LDR A;  1WGM A;  3U5P A;  5LKZ A;  2YHO A;  1WEW A;  2CSZ A;  4BBQ A;  2XB1 A;  2KWN A;  2CKL A;  3N9P A;  1X4J A;  3LQJ A;  2CSY A;  3GL6 A;  1LDJ B;  3O7A A;  3HCU A;  3MHS A;  3ASL A;  3C5K A;  4C9Z A;  3DQV R;  2LGL A;  2KIZ A;  1RMD A;  5TRB A;  3L1Z B;  5LKT A;  2MD8 C;  2KGG A;  5D1L B;  5EYA F;  2KWK A;  2EGP A;  2ECW A;  2RSD A;  1WE9 A;  5B79 A;  4L7X A;  4GNF A;  1JM7 B;  3EB5 A;  4B7Y C;  1V87 A;  2KWJ A;  2F6N A;  4S3O B;  3QZV A;  2KYU A;  4I7D A;  2ECJ A;  4O64 A;  1VD4 A;  1FBV A;  5G05 B;  5H1U A;  2CKL B;  1WEU A;  4QF3 A;  4PPE A;  2L80 A;  1WES A;  4A4B A;  1WEV A;  3EB6 A;  2H0D B;  2CT2 A;  3KV5 A;  2VJF B;  2LXP C;  3KQI A;  3ZTG A;  5H1T A;  3MHH A;  1BOR A;  2MNZ A;  4N3W A;  3PUQ A;  1Z60 A;  2QIC A;  2C2L A;  3RTR B;  4GNG A;  1WEP A;  1MM3 A;  1WEQ A;  3VK6 A;  5B76 A;  1CHC A;  3O36 A;  1JM7 A;  2LGK A;  4R8P K;  4QF2 A;  3PUR A;  2XEU A;  3HCS A;  2VPB A;  5AIT A;  4R2Y A;  3M63 A;  2E6R A;  3T7L A;  2KGI A;  2G43 A;  2YT5 A;  4GNE A;  4R7E A;  3ZVY A;  5TDW A;  2G6Q A;  2KR4 A;  2HDP A;  1FP0 A;  2VNF A;  4Q6F A;  2LGG A;  5JG6 A;  5B8D A;  2MIQ A;  2YU4 A;  4YAX A;  2LRI C;  3HCT A;  2K1J A;  2QIZ A;  5LKU A;  2L75 A;  5DIN A;  1K2F A;  4LK9 A;  3SOX A;  2VJE B;  5KH9 A;  5LCW B;  3T6R A;  2KFT A;  2ECV A;  4WA6 A;  2M3H A;  2ECN A;  3U5O A;  1G25 A;  4PTB A;  1X4U A;  2KWO A;  2L43 A;  3SOW A;  1F62 A;  1X4I A;  2MT5 A;  4XI1 A;  4LJN A;  2MD7 B;  2YQM A;  2IDA A;  2H0D A;  4FIP A;  5TAB A;  5DKA A;  2FUU A;  2KU3 A;  4GB0 A;  3HTK C;  5AIU A;  3LRQ A;  2JMI A;  4LKA A;  3RPG B;  3O33 A;  4UP0 A;  5KH3 A;  3KV6 A;  2LV9 A;  2YSM A;  4A0C D;  1JOC A;  4F52 B;  4YAB A;  2OXQ C;  2EA6 A;  3O37 A;  3ZYQ A;  2FSA A;  2ECG A;  5B78 A;  3N9M A;  3RPG C;  1Z6U A;  3C6W A;  2Y1N A;  4WZ0 A;  4X3G A;  2L5U A;  2VPD A;  2E6S A;  2LGV A;  2YUC A;  2Y43 A;  2EOD A;  2Y1M A;  5G0F A;  2JMD A;  5D1K B;  1N87 A;  3L1X A;  3SOU A;  3N9Q A;  2ECT A;  3DPL R;  1U6G B;  2PUY A;  3ZNI A;  5C11 A;  1HYI A;  2LQ6 A;  3IHP A;  1WIM A;  5FEY A;  4A4C A;  2VP7 A;  4V3K C;  5G04 B;  4CA1 A;  2F42 A;  2L0B A;  1XWH A;  2MA6 A;  4IC2 A;  2DX8 A;  4MVT A;  2YYR A;  2M6M A;  1ZBD B;  1VYX A;  1VFY A;  2YUR A;  3M99 A;  5C13 A;  5B77 A;  3ZPV 1;  2K17 A;  4FJC A;  4GND A;  4A49 A;  4YBS A;  3U5N A;  4AUQ B;  1MM2 A;  3O35 A;  4YAT A;  2FUI A;  4AYC B;  3I2D A;  4AYC A;  2K4D A;  2VJF A;  5H1V A;  4YAD A;  1T1H A;  2F6J A;  2ZET C;  4LAD B;  4CCG X; 
#chains in the Genus database with same CATH topology
 3O70 A;  2MUM A;  2CRR A;  4P5O B;  5D1M B;  1WEN A;  2YSJ A;  3LQI A;  2VJE A;  3NG2 A;  2B0O E;  3PHD A;  2C2V S;  2D8U A;  4FO9 A;  4AVX A;  2D8S A;  3GV4 A;  1E4U A;  3FAN A;  4BHW A;  2JRJ A;  4L58 A;  4FK5 A;  4V3L C;  2YHN A;  4UP5 A;  1WEE A;  2VPG A;  3M62 A;  4WZ3 B;  1MBM A;  4YBM A;  4IC3 A;  4B86 C;  4UI9 B;  4AP4 A;  3L11 A;  2LXH C;  2CON A;  2G45 A;  1WEO A;  3H7H A;  3V43 A;  5I3L A;  2MA5 A;  4N4F A;  3O34 A;  4F1P A;  2K16 A;  4LLB A;  2LN0 A;  5J3X A;  1WEM A;  2ECI A;  4MSX A;  4ZUX U;  2XOY A;  2KRE A;  3ZVZ B;  5TDR A;  2YQL A;  2YVR A;  2YRE A;  3JUE A;  3ZPV E;  2RI7 A;  2NAA A;  2FFW A;  2PNX A;  2QJ0 A;  3KNV A;  2HYE D;  5FER A;  4YC9 A;  2IQJ A;  4S3O C;  1Z2Q A;  4I7C A;  5KH7 A;  2BAY A;  4ZDT A;  1LDK C;  3E2D A;  3N9N A;  3N9O A;  2M1R A;  2KE1 A;  4WZ2 A;  4W4U A;  3U5M A;  1WFK A;  4I7B A;  2I50 A;  1WIL A;  1HYJ A;  5FB1 A;  2OWA A;  5SVI B;  3FEH A;  1IYM A;  4ZQL A;  2M85 A;  2E61 A;  4YBT A;  3FL2 A;  5B75 A;  2VPE A;  3LVR E;  5H9M A;  5LKX A;  3LQH A;  4NN2 A;  4TKP B;  2UZG A;  2MNY A;  3FM8 C;  2YW8 A;  3N9L A;  5FB0 A;  5TBN A;  2JMJ A;  1DVP A;  2AN6 A;  3SHB A;  2LAU A;  2LDR A;  2JUN A;  1WGM A;  3U5P A;  5LKZ A;  2YHO A;  5SVX A;  1WEW A;  2CSZ A;  3LVQ E;  4BBQ A;  2XB1 A;  2KWN A;  2CKL A;  3N9P A;  1X4J A;  3LQJ A;  2CSY A;  3O47 A;  3GL6 A;  1LDJ B;  3O7A A;  3HCU A;  3MHS A;  3ASL A;  3C5K A;  4C9Z A;  3DQV R;  2LGL A;  2KIZ A;  1RMD A;  5TRB A;  3L1Z B;  3T9K A;  3Q1D A;  5LKT A;  2MD8 C;  2KGG A;  2L7P A;  2CSV A;  5D1L B;  2DJA A;  4H9D A;  5EYA F;  2EGM A;  2KWK A;  2EGP A;  2ECW A;  2RSD A;  1WE9 A;  5B79 A;  4L7X A;  4O62 A;  4GNF A;  1JM7 B;  3EB5 A;  4B7Y C;  1V87 A;  2KWJ A;  2F6N A;  2KKY A;  4S3O B;  3QZV A;  2KYU A;  4I7D A;  2ECJ A;  4O64 A;  2MKE A;  1VD4 A;  1FBV A;  5G05 B;  5H1U A;  2CKL B;  1WEU A;  4QF3 A;  4PPE A;  2L80 A;  4Z0R A;  1WES A;  4A4B A;  1WEV A;  3EB6 A;  3DWD A;  2H0D B;  2CT2 A;  3KV5 A;  2VJF B;  2LXP C;  3KQI A;  3ZTG A;  5H1T A;  3MHH A;  1BOR A;  2MNZ A;  4N3W A;  3FAO A;  3PUQ A;  1Z60 A;  2QIC A;  2C2L A;  3RTR B;  4GNG A;  1WEP A;  3FJU B;  1MM3 A;  1WEQ A;  3VK6 A;  5B76 A;  1CHC A;  3O36 A;  1JM7 A;  2LGK A;  4R8P K;  4QF2 A;  3PUR A;  2XEU A;  2XP0 A;  3HCS A;  2VPB A;  5AIT A;  4R2Y A;  2RR4 A;  3M63 A;  2E6R A;  3T7L A;  2KGI A;  2G43 A;  2YT5 A;  3LDY A;  4GNE A;  5K3Q A;  3MDB C;  4R7E A;  3ZVY A;  5TDW A;  2G6Q A;  3PLW A;  2KR4 A;  2HDP A;  1FP0 A;  2VNF A;  4Q6F A;  2LGG A;  5JG6 A;  5B8D A;  2MIQ A;  2YU4 A;  3SUB A;  4YAX A;  2LRI C;  3HCT A;  2K1J A;  2QIZ A;  5LKU A;  2L75 A;  5SVY A;  5DIN A;  2EXU A;  1K2F A;  4LK9 A;  3SOX A;  2VJE B;  5KH9 A;  5LCW B;  3T6R A;  2KFT A;  2ECV A;  4WA6 A;  2M3H A;  2XOC A;  2ECN A;  3U5O A;  1G25 A;  4PTB A;  1X4U A;  2KWO A;  2L43 A;  3SOW A;  1F62 A;  1X4I A;  2KKX A;  2MT5 A;  4XI1 A;  4LJN A;  2MD7 B;  2YQM A;  2IDA A;  2H0D A;  4FIP A;  5TAB A;  5DKA A;  2FUU A;  4OGC A;  2KU3 A;  4GB0 A;  2M13 A;  3HTK C;  5AIU A;  3KDE C;  3LRQ A;  2JMI A;  4LKA A;  3RPG B;  3DDT A;  3O33 A;  4UP0 A;  5KH3 A;  3KV6 A;  2LV9 A;  2YSM A;  4A0C D;  1JOC A;  4F52 B;  4YAB A;  2OXQ C;  2EA6 A;  3O37 A;  3ZYQ A;  2FSA A;  2ECG A;  5B78 A;  3N9M A;  3RPG C;  1Z6U A;  3C6W A;  2Y1N A;  4WZ0 A;  3M7K A;  4X3G A;  2L5U A;  2VPD A;  2E6S A;  2LGV A;  2YUC A;  2Y43 A;  2EOD A;  2Y1M A;  5G0F A;  2JMD A;  5D1K B;  1N87 A;  3L1X A;  2JM3 A;  3SOU A;  3N9Q A;  2ECT A;  2XOZ A;  3DPL R;  1U6G B;  2PUY A;  3ZNI A;  5C11 A;  1HYI A;  2LQ6 A;  3IHP A;  2CRW A;  1WIM A;  5FEY A;  4A4C A;  2VP7 A;  4V3K C;  5G04 B;  1DCQ A;  4Z0O A;  4OGE A;  4CA1 A;  2F42 A;  2L0B A;  1XWH A;  2MA6 A;  4IC2 A;  2DX8 A;  3LJU X;  4MVT A;  2YYR A;  2M6M A;  2P57 A;  1ZBD B;  1VYX A;  1VFY A;  2YUR A;  3M99 A;  5C13 A;  5B77 A;  3ZPV 1;  2FD4 A;  4QQ4 A;  2K17 A;  2DSM A;  4FJC A;  4GND A;  4A49 A;  4YBS A;  3U5N A;  4AUQ B;  1MM2 A;  3O35 A;  4YAT A;  2FUI A;  4AYC B;  3I2D A;  4AYC A;  5SVI A;  2K4D A;  2VJF A;  5H1V A;  4YAD A;  1T1H A;  2F6J A;  2ZET C;  4LAD B;  4CCG X; 
#chains in the Genus database with same CATH homology
 3O70 A;  2MUM A;  4P5O B;  5D1M B;  1WEN A;  2YSJ A;  3LQI A;  2VJE A;  3NG2 A;  3PHD A;  2C2V S;  4FO9 A;  4AVX A;  2D8S A;  3GV4 A;  1E4U A;  4BHW A;  2JRJ A;  4L58 A;  4FK5 A;  4V3L C;  2YHN A;  4UP5 A;  1WEE A;  2VPG A;  3M62 A;  4WZ3 B;  4YBM A;  4IC3 A;  4B86 C;  4UI9 B;  4AP4 A;  3L11 A;  2LXH C;  2G45 A;  1WEO A;  3V43 A;  5I3L A;  2MA5 A;  4N4F A;  3O34 A;  2K16 A;  4LLB A;  2LN0 A;  5J3X A;  1WEM A;  2ECI A;  4MSX A;  4ZUX U;  2KRE A;  3ZVZ B;  5TDR A;  2YQL A;  2YRE A;  3ZPV E;  2RI7 A;  2NAA A;  2PNX A;  2QJ0 A;  3KNV A;  2HYE D;  5FER A;  4YC9 A;  4S3O C;  1Z2Q A;  4I7C A;  5KH7 A;  2BAY A;  4ZDT A;  1LDK C;  3N9N A;  3N9O A;  2M1R A;  2KE1 A;  4WZ2 A;  4W4U A;  3U5M A;  1WFK A;  2I50 A;  4I7B A;  1WIL A;  1HYJ A;  5FB1 A;  1IYM A;  4ZQL A;  2M85 A;  4YBT A;  3FL2 A;  5B75 A;  2VPE A;  5H9M A;  5LKX A;  3LQH A;  4NN2 A;  4TKP B;  2UZG A;  2MNY A;  2YW8 A;  3N9L A;  5FB0 A;  5TBN A;  2JMJ A;  1DVP A;  2AN6 A;  3SHB A;  2LDR A;  1WGM A;  3U5P A;  5LKZ A;  2YHO A;  1WEW A;  2CSZ A;  4BBQ A;  2XB1 A;  2KWN A;  2CKL A;  3N9P A;  1X4J A;  3LQJ A;  2CSY A;  3GL6 A;  1LDJ B;  3O7A A;  3HCU A;  3MHS A;  3ASL A;  3C5K A;  4C9Z A;  3DQV R;  2LGL A;  2KIZ A;  1RMD A;  5TRB A;  3L1Z B;  5LKT A;  2MD8 C;  2KGG A;  5D1L B;  5EYA F;  2KWK A;  2EGP A;  2ECW A;  2RSD A;  1WE9 A;  5B79 A;  4L7X A;  4GNF A;  1JM7 B;  3EB5 A;  4B7Y C;  1V87 A;  2KWJ A;  2F6N A;  4S3O B;  3QZV A;  2KYU A;  4I7D A;  2ECJ A;  4O64 A;  1VD4 A;  1FBV A;  5G05 B;  5H1U A;  2CKL B;  1WEU A;  4QF3 A;  4PPE A;  2L80 A;  1WES A;  4A4B A;  1WEV A;  3EB6 A;  2H0D B;  2CT2 A;  3KV5 A;  2VJF B;  2LXP C;  3KQI A;  3ZTG A;  5H1T A;  3MHH A;  1BOR A;  2MNZ A;  4N3W A;  3PUQ A;  1Z60 A;  2QIC A;  2C2L A;  3RTR B;  4GNG A;  1WEP A;  1MM3 A;  1WEQ A;  3VK6 A;  5B76 A;  1CHC A;  3O36 A;  1JM7 A;  2LGK A;  4R8P K;  4QF2 A;  3PUR A;  2XEU A;  3HCS A;  2VPB A;  5AIT A;  4R2Y A;  3M63 A;  2E6R A;  3T7L A;  2KGI A;  2G43 A;  2YT5 A;  4GNE A;  4R7E A;  3ZVY A;  5TDW A;  2G6Q A;  2KR4 A;  2HDP A;  1FP0 A;  2VNF A;  4Q6F A;  2LGG A;  5JG6 A;  5B8D A;  2MIQ A;  2YU4 A;  4YAX A;  2LRI C;  3HCT A;  2K1J A;  2QIZ A;  5LKU A;  2L75 A;  5DIN A;  1K2F A;  4LK9 A;  3SOX A;  2VJE B;  5KH9 A;  5LCW B;  3T6R A;  2KFT A;  2ECV A;  4WA6 A;  2M3H A;  2ECN A;  3U5O A;  1G25 A;  4PTB A;  1X4U A;  2KWO A;  2L43 A;  3SOW A;  1F62 A;  1X4I A;  2MT5 A;  4XI1 A;  4LJN A;  2MD7 B;  2YQM A;  2IDA A;  2H0D A;  4FIP A;  5TAB A;  5DKA A;  2FUU A;  2KU3 A;  4GB0 A;  3HTK C;  5AIU A;  3LRQ A;  2JMI A;  4LKA A;  3RPG B;  3O33 A;  4UP0 A;  5KH3 A;  3KV6 A;  2LV9 A;  2YSM A;  4A0C D;  1JOC A;  4F52 B;  4YAB A;  2OXQ C;  2EA6 A;  3O37 A;  3ZYQ A;  2FSA A;  2ECG A;  5B78 A;  3N9M A;  3RPG C;  1Z6U A;  3C6W A;  2Y1N A;  4WZ0 A;  4X3G A;  2L5U A;  2VPD A;  2E6S A;  2LGV A;  2YUC A;  2Y43 A;  2EOD A;  2Y1M A;  5G0F A;  2JMD A;  5D1K B;  1N87 A;  3L1X A;  3SOU A;  3N9Q A;  2ECT A;  3DPL R;  1U6G B;  2PUY A;  3ZNI A;  5C11 A;  1HYI A;  2LQ6 A;  3IHP A;  1WIM A;  5FEY A;  4A4C A;  2VP7 A;  4V3K C;  5G04 B;  4CA1 A;  2F42 A;  2L0B A;  1XWH A;  2MA6 A;  4IC2 A;  2DX8 A;  4MVT A;  2YYR A;  2M6M A;  1ZBD B;  1VYX A;  1VFY A;  2YUR A;  3M99 A;  5C13 A;  5B77 A;  3ZPV 1;  2K17 A;  4FJC A;  4GND A;  4A49 A;  4YBS A;  3U5N A;  4AUQ B;  1MM2 A;  3O35 A;  4YAT A;  2FUI A;  4AYC B;  3I2D A;  4AYC A;  2K4D A;  2VJF A;  5H1V A;  4YAD A;  1T1H A;  2F6J A;  2ZET C;  4LAD B;  4CCG X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...