2F42A

Dimerization and u-box domains of zebrafish c-terminal of hsp70 interacting protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
156
structure length
138
Chain Sequence
b'AKKKRWNSIEEKRISQENELHAYLSKLILAEKERELDDSKHDKYLMDMDELFSQVDEKRKKREIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQENGWVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIP1 homology and U-box containing protein 1
publication title Structure and Interactions of the Helical and U-Box Domains of CHIP, the C Terminus of HSP70 Interacting Protein.
pubmed doi rcsb
source organism Danio rerio
molecule tags Chaperone
total genus 49
structure length 138
sequence length 156
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
A PF18391 CHIP_TPR_N CHIP N-terminal tetratricopeptide repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f42A02
2JRJA 3QZVA 3ZPV1 4A4BA 2QIZA 4QF2A 2MA5A 4WZ2A 4C9ZA 2HYED 3HCSA 3KQIA 2L5UA 4ZDTA 4N3WA 3ZPVE 1WFKA 3KV6A 5TDWA 3ZVZB 4IC3A 1WEUA 4A49A 1HYJA 2VPEA 2ECIA 5H1UA 2VJEB 5D1LB 2IDAA 4BHWA 2ECVA 5G04B 2ECWA 2QICA 3FL2A 3N9PA 5LCWB 4ZQLA 5TBNA 1WESA 3L1XA 2OXQC 5JG6A 5C13A 3KV5A 3O35A 4L7XA 2M1RA 2LGLA 3O34A 2YSJA 2KE1A 2YHNA 2YQMA 4V3LC 4BBQA 2K17A 1WEOA 2FSAA 2PNXA 4L58A 4LK9A 1VFYA 2E6RA 5AIUA 1X4JA 2F6NA 4YATA 2LRIC 4I7BA 1WENA 2PUYA 3SOUA 4YC9A 3SOXA 1X4IA 5KH3A 4YBTA 1ZBDB 2KGGA 2KFTA 2LGGA 2M6MA 3C6WA 2CKLB 2CSZA 4CCGX 1WEPA 4YBMA 4B7YC 5B75A 2ECJA 2ECTA 4AUQB 5DKAA 5KH9A 2YW8A 2CSYA 4FJCA 5B79A 1G25A 2M85A 2KYUA 3U5MA 1U6GB 2VNFA 1CHCA 1WEEA 5C11A 3SOWA 3U5PA 4R7EA 4AP4A 5B76A 3PHDA 3RPGB 4FK5A 4FIPA 4S3OB 2MIQA 4FO9A 5G05B 4LLBA 4PPEA 3U5OA 5D1MB 3LQHA 5LKXA 2D8SA 2G43A 2FUUA 2LDRA 5TABA 2JMJA 3RPGC 3GV4A 5G0FA 2KWJA 5LKZA 4S3OC 3MHSA 4F52B 2LGKA 3T7LA 4GB0A 4GNDA 2Y43A 3MHHA 4MSXA 2KWNA 3L11A 1Z60A 2L43A 5FB1A 4AYCB 3ASLA 3T6RA 1K2FA 1FBVA 4PTBA 1X4UA 3NG2A 2JMDA 4YAXA 2K4DA 1WIMA 3U5NA 3RTRB 2LV9A 2MD8C 2Y1NA 4YADA 2L80A 3LQJA 1V87A 4P5OB 1E4UA 5EYAF 1MM2A 3DPLR 1T1HA 4LADB 2VJEA 3KNVA 4O64A 2EODA 4WZ3B 3O36A 3ZNIA 3M62A 4UI9B 5LKTA 3N9MA 3ZYQA 4R2YA 2CT2A 1IYMA 4UP5A 2KR4A 2RSDA 2MNZA 2YURA 1JOCA 1JM7B 2EA6A 2F42A 2YSMA 2VP7A 1Z6UA 2LXHC 2XEUA 1LDJB 2KU3A 5H1VA 4WZ0A 2LN0A 1HYIA 4YBSA 1DVPA 2C2VS 5B77A 4A0CD 3EB6A 2QJ0A 2E6SA 2L75A 2VJFB 1N87A 5LKUA 2NAAA 5B78A 1JM7A 1Z2QA 4V3KC 2CKLA 1WEQA 1MM3A 3O33A 5TDRA 3HCUA 5H9MA 5AITA 3VK6A 2K1JA 5DINA 3DQVR 2M3HA 2KWOA 2KIZA 2HDPA 3N9NA 4B86C 3PUQA 4XI1A 5TRBA 2VPDA 4YABA 1F62A 2MD7B 2VJFA 4I7CA 1XWHA 3N9LA 2G6QA 1VD4A 2K16A 2I50A 2ECGA 4LKAA 5FEYA 4I7DA 2YYRA 5I3LA 5H1TA 1RMDA 2VPBA 3PURA 3L1ZB 4ZUXU 2FUIA 4WA6A 4UP0A 3HTKC 2KWKA 2YT5A 2Y1MA 1BORA 2ZETC 2RI7A 4GNEA 5J3XA 5FERA 3EB5A 2YUCA 3O70A 3O7AA 2EGPA 4IC2A 3V43A 2YREA 2LQ6A 2MNYA 5D1KB 2MA6A 3SHBA 3LQIA 2JMIA 4LJNA 2DX8A 3O37A 2KGIA 2UZGA 3N9OA 4QF3A 2YU4A 1WEMA 4AYCA 3I2DA 2MUMA 2H0DB 2F6JA 5KH7A 2XB1A 2YQLA 1VYXA 5B8DA 3M63A 4AVXA 3HCTA 2KREA 5FB0A 2YHOA 1WE9A 1LDKC 2AN6A 2MT5A 3C5KA 3GL6A 4NN2A 2BAYA 2H0DA 4W4UA 4R8PK 4GNGA 4CA1A 1WGMA 4X3GA 2G45A 2VPGA 2C2LA 4GNFA 2L0BA 3LRQA 3IHPA 1FP0A 3ZTGA 4A4CA 2LXPC 3M99A 1WEVA 3ZVYA 3N9QA 1WEWA 2ECNA 2LGVA 4MVTA 1WILA 4TKPB 4Q6FA 4N4FA
chains in the Genus database with same CATH superfamily
2JRJA 3QZVA 3ZPV1 4A4BA 2JUNA 2QIZA 4QF2A 2MA5A 2XOYA 4WZ2A 4C9ZA 3DDTA 2HYED 2KKYA 3HCSA 3KQIA 2L5UA 4ZDTA 4N3WA 3ZPVE 1WFKA 3KV6A 2CRWA 5TDWA 3ZVZB 4IC3A 1WEUA 4A49A 1HYJA 2VPEA 2ECIA 5H1UA 2VJEB 5D1LB 2IDAA 2YVRA 4BHWA 2ECVA 5G04B 2ECWA 2QICA 3FL2A 3N9PA 5LCWB 4ZQLA 5TBNA 1WESA 3L1XA 2OXQC 5JG6A 5C13A 3KV5A 3O35A 4L7XA 2M1RA 4OGCA 3PLWA 2LGLA 3O34A 2KKXA 2YSJA 2KE1A 3FEHA 2YHNA 2YQMA 4V3LC 4BBQA 2K17A 1WEOA 2XOCA 2FSAA 2PNXA 4L58A 4LK9A 1VFYA 2E6RA 1X4JA 5AIUA 2F6NA 3KDEC 4YATA 2LRIC 4I7BA 1WENA 2PUYA 3SOUA 4YC9A 3SOXA 1X4IA 5KH3A 2CRRA 4YBTA 1ZBDB 2KGGA 2KFTA 2LGGA 2M6MA 2XOZA 3FM8C 3C6WA 2CKLB 2CSZA 4CCGX 1WEPA 4YBMA 4B7YC 5B75A 2ECJA 2CSVA 2ECTA 4AUQB 5DKAA 5KH9A 3E2DA 2YW8A 2CSYA 4FJCA 5B79A 1G25A 2DJAA 2M85A 2KYUA 5SVIB 3U5MA 1U6GB 2VNFA 1CHCA 1WEEA 5C11A 3SOWA 1MBMA 3U5PA 4R7EA 4AP4A 2L7PA 5B76A 3PHDA 3RPGB 4FK5A 4FIPA 4S3OB 3FJUB 2MIQA 4FO9A 5G05B 2OWAA 5SVYA 4LLBA 2FD4A 4PPEA 3U5OA 5D1MB 4QQ4A 3LQHA 5LKXA 2D8SA 2G43A 2FUUA 2LDRA 5TABA 2JMJA 3RPGC 3GV4A 2KWJA 5G0FA 5LKZA 4S3OC 3MHSA 4F52B 2LGKA 3T7LA 4GB0A 4GNDA 4OGEA 2Y43A 3MHHA 4MSXA 2KWNA 3L11A 1Z60A 2L43A 5FB1A 4AYCB 3ASLA 3T6RA 1K2FA 1FBVA 3T9KA 4PTBA 1X4UA 3NG2A 3H7HA 2JMDA 4YAXA 2K4DA 1WIMA 3U5NA 3RTRB 2LV9A 2M13A 2MD8C 2Y1NA 2FFWA 2L80A 4YADA 3LQJA 1V87A 4P5OB 1E4UA 5EYAF 1MM2A 3DPLR 1T1HA 3JUEA 2XP0A 2CONA 5SVXA 4LADB 2VJEA 3Q1DA 4Z0RA 3KNVA 2EGMA 4O64A 2EODA 3FAOA 4WZ3B 3O36A 3ZNIA 3M62A 4UI9B 5LKTA 3N9MA 3ZYQA 3LJUX 4R2YA 2CT2A 1IYMA 4UP5A 2KR4A 2RSDA 2MNZA 2YURA 1JOCA 1JM7B 2EA6A 2F42A 2DSMA 2YSMA 2VP7A 1Z6UA 3SUBA 2LXHC 2XEUA 1LDJB 2KU3A 5H1VA 4WZ0A 2LN0A 3DWDA 1HYIA 4YBSA 1DVPA 2C2VS 2EXUA 4A0CD 3EB6A 5B77A 2QJ0A 2E6SA 2L75A 2VJFB 1N87A 3MDBC 5LKUA 2NAAA 2RR4A 5B78A 1JM7A 1Z2QA 4Z0OA 4V3KC 2CKLA 1WEQA 1MM3A 3O33A 5TDRA 3HCUA 5H9MA 3LVQE 5AITA 2B0OE 3VK6A 2IQJA 2K1JA 2JM3A 5DINA 3DQVR 2M3HA 2KWOA 2KIZA 2HDPA 3N9NA 4B86C 3PUQA 4XI1A 5TRBA 2VPDA 4YABA 1F62A 2D8UA 2MD7B 2VJFA 4I7CA 1XWHA 5SVIA 3N9LA 2G6QA 1VD4A 2K16A 2I50A 2ECGA 4LKAA 5FEYA 4I7DA 2YYRA 5I3LA 5H1TA 1RMDA 2VPBA 3PURA 3L1ZB 4ZUXU 2FUIA 4WA6A 4UP0A 3HTKC 2KWKA 4H9DA 2YT5A 2Y1MA 1BORA 2ZETC 2RI7A 4GNEA 5J3XA 5FERA 3EB5A 2YUCA 3O70A 3O7AA 2EGPA 4IC2A 3V43A 2YREA 2LQ6A 2MNYA 5D1KB 3FANA 2MA6A 3SHBA 3LQIA 2JMIA 4LJNA 2DX8A 3O37A 2KGIA 2UZGA 3N9OA 4QF3A 2YU4A 1DCQA 1WEMA 4AYCA 3I2DA 2MUMA 2H0DB 2F6JA 5KH7A 2XB1A 2P57A 2YQLA 3M7KA 3LVRE 1VYXA 5B8DA 3M63A 4AVXA 3HCTA 2KREA 5FB0A 2YHOA 5K3QA 1WE9A 2MKEA 1LDKC 2AN6A 2MT5A 4O62A 3C5KA 3GL6A 4NN2A 2BAYA 2H0DA 4W4UA 4R8PK 2E61A 4GNGA 4CA1A 1WGMA 4X3GA 2G45A 2VPGA 2C2LA 3O47A 4GNFA 2L0BA 2LAUA 3IHPA 1FP0A 3LRQA 4F1PA 3ZTGA 4A4CA 2LXPC 3M99A 3LDYA 1WEVA 3ZVYA 3N9QA 1WEWA 2ECNA 2LGVA 4MVTA 1WILA 4TKPB 4Q6FA 4N4FA
chains in the Genus database with same CATH topology
2JRJA 3QZVA 3ZPV1 4A4BA 2QIZA 4QF2A 2MA5A 4WZ2A 4C9ZA 2HYED 3HCSA 3KQIA 2L5UA 4ZDTA 4N3WA 3ZPVE 1WFKA 3KV6A 5TDWA 3ZVZB 4IC3A 1WEUA 4A49A 1HYJA 2VPEA 2ECIA 5H1UA 2VJEB 5D1LB 2IDAA 4BHWA 2ECVA 5G04B 2ECWA 2QICA 3FL2A 3N9PA 5LCWB 4ZQLA 5TBNA 1WESA 3L1XA 2OXQC 5JG6A 5C13A 3KV5A 3O35A 4L7XA 2M1RA 2LGLA 3O34A 2YSJA 2KE1A 2YHNA 2YQMA 4V3LC 4BBQA 2K17A 1WEOA 2FSAA 2PNXA 4L58A 4LK9A 1VFYA 2E6RA 5AIUA 1X4JA 2F6NA 4YATA 2LRIC 4I7BA 1WENA 2PUYA 3SOUA 4YC9A 3SOXA 1X4IA 5KH3A 4YBTA 1ZBDB 2KGGA 2KFTA 2LGGA 2M6MA 3C6WA 2CKLB 2CSZA 4CCGX 1WEPA 4YBMA 4B7YC 5B75A 2ECJA 2ECTA 4AUQB 5DKAA 5KH9A 2YW8A 2CSYA 4FJCA 5B79A 1G25A 2M85A 2KYUA 3U5MA 1U6GB 2VNFA 1CHCA 1WEEA 5C11A 3SOWA 3U5PA 4R7EA 4AP4A 5B76A 3PHDA 3RPGB 4FK5A 4FIPA 4S3OB 2MIQA 4FO9A 5G05B 4LLBA 4PPEA 3U5OA 5D1MB 3LQHA 5LKXA 2D8SA 2G43A 2FUUA 2LDRA 5TABA 2JMJA 3RPGC 3GV4A 5G0FA 2KWJA 5LKZA 4S3OC 3MHSA 4F52B 2LGKA 3T7LA 4GB0A 4GNDA 2Y43A 3MHHA 4MSXA 2KWNA 3L11A 1Z60A 2L43A 5FB1A 4AYCB 3ASLA 3T6RA 1K2FA 1FBVA 4PTBA 1X4UA 3NG2A 2JMDA 4YAXA 2K4DA 1WIMA 3U5NA 3RTRB 2LV9A 2MD8C 2Y1NA 4YADA 2L80A 3LQJA 1V87A 4P5OB 1E4UA 5EYAF 1MM2A 3DPLR 1T1HA 4LADB 2VJEA 3KNVA 4O64A 2EODA 4WZ3B 3O36A 3ZNIA 3M62A 4UI9B 5LKTA 3N9MA 3ZYQA 4R2YA 2CT2A 1IYMA 4UP5A 2KR4A 2RSDA 2MNZA 2YURA 1JOCA 1JM7B 2EA6A 2F42A 2YSMA 2VP7A 1Z6UA 2LXHC 2XEUA 1LDJB 2KU3A 5H1VA 4WZ0A 2LN0A 1HYIA 4YBSA 1DVPA 2C2VS 5B77A 4A0CD 3EB6A 2QJ0A 2E6SA 2L75A 2VJFB 1N87A 5LKUA 2NAAA 5B78A 1JM7A 1Z2QA 4V3KC 2CKLA 1WEQA 1MM3A 3O33A 5TDRA 3HCUA 5H9MA 5AITA 3VK6A 2K1JA 5DINA 3DQVR 2M3HA 2KWOA 2KIZA 2HDPA 3N9NA 4B86C 3PUQA 4XI1A 5TRBA 2VPDA 4YABA 1F62A 2MD7B 2VJFA 4I7CA 1XWHA 3N9LA 2G6QA 1VD4A 2K16A 2I50A 2ECGA 4LKAA 5FEYA 4I7DA 2YYRA 5I3LA 5H1TA 1RMDA 2VPBA 3PURA 3L1ZB 4ZUXU 2FUIA 4WA6A 4UP0A 3HTKC 2KWKA 2YT5A 2Y1MA 1BORA 2ZETC 2RI7A 4GNEA 5J3XA 5FERA 3EB5A 2YUCA 3O70A 3O7AA 2EGPA 4IC2A 3V43A 2YREA 2LQ6A 2MNYA 5D1KB 2MA6A 3SHBA 3LQIA 2JMIA 4LJNA 2DX8A 3O37A 2KGIA 2UZGA 3N9OA 4QF3A 2YU4A 1WEMA 4AYCA 3I2DA 2MUMA 2H0DB 2F6JA 5KH7A 2XB1A 2YQLA 1VYXA 5B8DA 3M63A 4AVXA 3HCTA 2KREA 5FB0A 2YHOA 1WE9A 1LDKC 2AN6A 2MT5A 3C5KA 3GL6A 4NN2A 2BAYA 2H0DA 4W4UA 4R8PK 4GNGA 4CA1A 1WGMA 4X3GA 2G45A 2VPGA 2C2LA 4GNFA 2L0BA 3LRQA 3IHPA 1FP0A 3ZTGA 4A4CA 2LXPC 3M99A 1WEVA 3ZVYA 3N9QA 1WEWA 2ECNA 2LGVA 4MVTA 1WILA 4TKPB 4Q6FA 4N4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRJ A;  3QZV A;  3ZPV 1;  4A4B A;  2QIZ A;  4QF2 A;  2MA5 A;  4WZ2 A;  4C9Z A;  2HYE D;  3HCS A;  3KQI A;  2L5U A;  4ZDT A;  4N3W A;  3ZPV E;  1WFK A;  3KV6 A;  5TDW A;  3ZVZ B;  4IC3 A;  1WEU A;  4A49 A;  1HYJ A;  2VPE A;  2ECI A;  5H1U A;  2VJE B;  5D1L B;  2IDA A;  4BHW A;  2ECV A;  5G04 B;  2ECW A;  2QIC A;  3FL2 A;  3N9P A;  5LCW B;  4ZQL A;  5TBN A;  1WES A;  3L1X A;  2OXQ C;  5JG6 A;  5C13 A;  3KV5 A;  3O35 A;  4L7X A;  2M1R A;  2LGL A;  3O34 A;  2YSJ A;  2KE1 A;  2YHN A;  2YQM A;  4V3L C;  4BBQ A;  2K17 A;  1WEO A;  2FSA A;  2PNX A;  4L58 A;  4LK9 A;  1VFY A;  2E6R A;  5AIU A;  1X4J A;  2F6N A;  4YAT A;  2LRI C;  4I7B A;  1WEN A;  2PUY A;  3SOU A;  4YC9 A;  3SOX A;  1X4I A;  5KH3 A;  4YBT A;  1ZBD B;  2KGG A;  2KFT A;  2LGG A;  2M6M A;  3C6W A;  2CKL B;  2CSZ A;  4CCG X;  1WEP A;  4YBM A;  4B7Y C;  5B75 A;  2ECJ A;  2ECT A;  4AUQ B;  5DKA A;  5KH9 A;  2YW8 A;  2CSY A;  4FJC A;  5B79 A;  1G25 A;  2M85 A;  2KYU A;  3U5M A;  1U6G B;  2VNF A;  1CHC A;  1WEE A;  5C11 A;  3SOW A;  3U5P A;  4R7E A;  4AP4 A;  5B76 A;  3PHD A;  3RPG B;  4FK5 A;  4FIP A;  4S3O B;  2MIQ A;  4FO9 A;  5G05 B;  4LLB A;  4PPE A;  3U5O A;  5D1M B;  3LQH A;  5LKX A;  2D8S A;  2G43 A;  2FUU A;  2LDR A;  5TAB A;  2JMJ A;  3RPG C;  3GV4 A;  5G0F A;  2KWJ A;  5LKZ A;  4S3O C;  3MHS A;  4F52 B;  2LGK A;  3T7L A;  4GB0 A;  4GND A;  2Y43 A;  3MHH A;  4MSX A;  2KWN A;  3L11 A;  1Z60 A;  2L43 A;  5FB1 A;  4AYC B;  3ASL A;  3T6R A;  1K2F A;  1FBV A;  4PTB A;  1X4U A;  3NG2 A;  2JMD A;  4YAX A;  2K4D A;  1WIM A;  3U5N A;  3RTR B;  2LV9 A;  2MD8 C;  2Y1N A;  4YAD A;  2L80 A;  3LQJ A;  1V87 A;  4P5O B;  1E4U A;  5EYA F;  1MM2 A;  3DPL R;  1T1H A;  4LAD B;  2VJE A;  3KNV A;  4O64 A;  2EOD A;  4WZ3 B;  3O36 A;  3ZNI A;  3M62 A;  4UI9 B;  5LKT A;  3N9M A;  3ZYQ A;  4R2Y A;  2CT2 A;  1IYM A;  4UP5 A;  2KR4 A;  2RSD A;  2MNZ A;  2YUR A;  1JOC A;  1JM7 B;  2EA6 A;  2F42 A;  2YSM A;  2VP7 A;  1Z6U A;  2LXH C;  2XEU A;  1LDJ B;  2KU3 A;  5H1V A;  4WZ0 A;  2LN0 A;  1HYI A;  4YBS A;  1DVP A;  2C2V S;  5B77 A;  4A0C D;  3EB6 A;  2QJ0 A;  2E6S A;  2L75 A;  2VJF B;  1N87 A;  5LKU A;  2NAA A;  5B78 A;  1JM7 A;  1Z2Q A;  4V3K C;  2CKL A;  1WEQ A;  1MM3 A;  3O33 A;  5TDR A;  3HCU A;  5H9M A;  5AIT A;  3VK6 A;  2K1J A;  5DIN A;  3DQV R;  2M3H A;  2KWO A;  2KIZ A;  2HDP A;  3N9N A;  4B86 C;  3PUQ A;  4XI1 A;  5TRB A;  2VPD A;  4YAB A;  1F62 A;  2MD7 B;  2VJF A;  4I7C A;  1XWH A;  3N9L A;  2G6Q A;  1VD4 A;  2K16 A;  2I50 A;  2ECG A;  4LKA A;  5FEY A;  4I7D A;  2YYR A;  5I3L A;  5H1T A;  1RMD A;  2VPB A;  3PUR A;  3L1Z B;  4ZUX U;  2FUI A;  4WA6 A;  4UP0 A;  3HTK C;  2KWK A;  2YT5 A;  2Y1M A;  1BOR A;  2ZET C;  2RI7 A;  4GNE A;  5J3X A;  5FER A;  3EB5 A;  2YUC A;  3O70 A;  3O7A A;  2EGP A;  4IC2 A;  3V43 A;  2YRE A;  2LQ6 A;  2MNY A;  5D1K B;  2MA6 A;  3SHB A;  3LQI A;  2JMI A;  4LJN A;  2DX8 A;  3O37 A;  2KGI A;  2UZG A;  3N9O A;  4QF3 A;  2YU4 A;  1WEM A;  4AYC A;  3I2D A;  2MUM A;  2H0D B;  2F6J A;  5KH7 A;  2XB1 A;  2YQL A;  1VYX A;  5B8D A;  3M63 A;  4AVX A;  3HCT A;  2KRE A;  5FB0 A;  2YHO A;  1WE9 A;  1LDK C;  2AN6 A;  2MT5 A;  3C5K A;  3GL6 A;  4NN2 A;  2BAY A;  2H0D A;  4W4U A;  4R8P K;  4GNG A;  4CA1 A;  1WGM A;  4X3G A;  2G45 A;  2VPG A;  2C2L A;  4GNF A;  2L0B A;  3LRQ A;  3IHP A;  1FP0 A;  3ZTG A;  4A4C A;  2LXP C;  3M99 A;  1WEV A;  3ZVY A;  3N9Q A;  1WEW A;  2ECN A;  2LGV A;  4MVT A;  1WIL A;  4TKP B;  4Q6F A;  4N4F A; 
#chains in the Genus database with same CATH topology
 2JRJ A;  3QZV A;  3ZPV 1;  4A4B A;  2JUN A;  2QIZ A;  4QF2 A;  2MA5 A;  2XOY A;  4WZ2 A;  4C9Z A;  3DDT A;  2HYE D;  2KKY A;  3HCS A;  3KQI A;  2L5U A;  4ZDT A;  4N3W A;  3ZPV E;  1WFK A;  3KV6 A;  2CRW A;  5TDW A;  3ZVZ B;  4IC3 A;  1WEU A;  4A49 A;  1HYJ A;  2VPE A;  2ECI A;  5H1U A;  2VJE B;  5D1L B;  2IDA A;  2YVR A;  4BHW A;  2ECV A;  5G04 B;  2ECW A;  2QIC A;  3FL2 A;  3N9P A;  5LCW B;  4ZQL A;  5TBN A;  1WES A;  3L1X A;  2OXQ C;  5JG6 A;  5C13 A;  3KV5 A;  3O35 A;  4L7X A;  2M1R A;  4OGC A;  3PLW A;  2LGL A;  3O34 A;  2KKX A;  2YSJ A;  2KE1 A;  3FEH A;  2YHN A;  2YQM A;  4V3L C;  4BBQ A;  2K17 A;  1WEO A;  2XOC A;  2FSA A;  2PNX A;  4L58 A;  4LK9 A;  1VFY A;  2E6R A;  1X4J A;  5AIU A;  2F6N A;  3KDE C;  4YAT A;  2LRI C;  4I7B A;  1WEN A;  2PUY A;  3SOU A;  4YC9 A;  3SOX A;  1X4I A;  5KH3 A;  2CRR A;  4YBT A;  1ZBD B;  2KGG A;  2KFT A;  2LGG A;  2M6M A;  2XOZ A;  3FM8 C;  3C6W A;  2CKL B;  2CSZ A;  4CCG X;  1WEP A;  4YBM A;  4B7Y C;  5B75 A;  2ECJ A;  2CSV A;  2ECT A;  4AUQ B;  5DKA A;  5KH9 A;  3E2D A;  2YW8 A;  2CSY A;  4FJC A;  5B79 A;  1G25 A;  2DJA A;  2M85 A;  2KYU A;  5SVI B;  3U5M A;  1U6G B;  2VNF A;  1CHC A;  1WEE A;  5C11 A;  3SOW A;  1MBM A;  3U5P A;  4R7E A;  4AP4 A;  2L7P A;  5B76 A;  3PHD A;  3RPG B;  4FK5 A;  4FIP A;  4S3O B;  3FJU B;  2MIQ A;  4FO9 A;  5G05 B;  2OWA A;  5SVY A;  4LLB A;  2FD4 A;  4PPE A;  3U5O A;  5D1M B;  4QQ4 A;  3LQH A;  5LKX A;  2D8S A;  2G43 A;  2FUU A;  2LDR A;  5TAB A;  2JMJ A;  3RPG C;  3GV4 A;  2KWJ A;  5G0F A;  5LKZ A;  4S3O C;  3MHS A;  4F52 B;  2LGK A;  3T7L A;  4GB0 A;  4GND A;  4OGE A;  2Y43 A;  3MHH A;  4MSX A;  2KWN A;  3L11 A;  1Z60 A;  2L43 A;  5FB1 A;  4AYC B;  3ASL A;  3T6R A;  1K2F A;  1FBV A;  3T9K A;  4PTB A;  1X4U A;  3NG2 A;  3H7H A;  2JMD A;  4YAX A;  2K4D A;  1WIM A;  3U5N A;  3RTR B;  2LV9 A;  2M13 A;  2MD8 C;  2Y1N A;  2FFW A;  2L80 A;  4YAD A;  3LQJ A;  1V87 A;  4P5O B;  1E4U A;  5EYA F;  1MM2 A;  3DPL R;  1T1H A;  3JUE A;  2XP0 A;  2CON A;  5SVX A;  4LAD B;  2VJE A;  3Q1D A;  4Z0R A;  3KNV A;  2EGM A;  4O64 A;  2EOD A;  3FAO A;  4WZ3 B;  3O36 A;  3ZNI A;  3M62 A;  4UI9 B;  5LKT A;  3N9M A;  3ZYQ A;  3LJU X;  4R2Y A;  2CT2 A;  1IYM A;  4UP5 A;  2KR4 A;  2RSD A;  2MNZ A;  2YUR A;  1JOC A;  1JM7 B;  2EA6 A;  2F42 A;  2DSM A;  2YSM A;  2VP7 A;  1Z6U A;  3SUB A;  2LXH C;  2XEU A;  1LDJ B;  2KU3 A;  5H1V A;  4WZ0 A;  2LN0 A;  3DWD A;  1HYI A;  4YBS A;  1DVP A;  2C2V S;  2EXU A;  4A0C D;  3EB6 A;  5B77 A;  2QJ0 A;  2E6S A;  2L75 A;  2VJF B;  1N87 A;  3MDB C;  5LKU A;  2NAA A;  2RR4 A;  5B78 A;  1JM7 A;  1Z2Q A;  4Z0O A;  4V3K C;  2CKL A;  1WEQ A;  1MM3 A;  3O33 A;  5TDR A;  3HCU A;  5H9M A;  3LVQ E;  5AIT A;  2B0O E;  3VK6 A;  2IQJ A;  2K1J A;  2JM3 A;  5DIN A;  3DQV R;  2M3H A;  2KWO A;  2KIZ A;  2HDP A;  3N9N A;  4B86 C;  3PUQ A;  4XI1 A;  5TRB A;  2VPD A;  4YAB A;  1F62 A;  2D8U A;  2MD7 B;  2VJF A;  4I7C A;  1XWH A;  5SVI A;  3N9L A;  2G6Q A;  1VD4 A;  2K16 A;  2I50 A;  2ECG A;  4LKA A;  5FEY A;  4I7D A;  2YYR A;  5I3L A;  5H1T A;  1RMD A;  2VPB A;  3PUR A;  3L1Z B;  4ZUX U;  2FUI A;  4WA6 A;  4UP0 A;  3HTK C;  2KWK A;  4H9D A;  2YT5 A;  2Y1M A;  1BOR A;  2ZET C;  2RI7 A;  4GNE A;  5J3X A;  5FER A;  3EB5 A;  2YUC A;  3O70 A;  3O7A A;  2EGP A;  4IC2 A;  3V43 A;  2YRE A;  2LQ6 A;  2MNY A;  5D1K B;  3FAN A;  2MA6 A;  3SHB A;  3LQI A;  2JMI A;  4LJN A;  2DX8 A;  3O37 A;  2KGI A;  2UZG A;  3N9O A;  4QF3 A;  2YU4 A;  1DCQ A;  1WEM A;  4AYC A;  3I2D A;  2MUM A;  2H0D B;  2F6J A;  5KH7 A;  2XB1 A;  2P57 A;  2YQL A;  3M7K A;  3LVR E;  1VYX A;  5B8D A;  3M63 A;  4AVX A;  3HCT A;  2KRE A;  5FB0 A;  2YHO A;  5K3Q A;  1WE9 A;  2MKE A;  1LDK C;  2AN6 A;  2MT5 A;  4O62 A;  3C5K A;  3GL6 A;  4NN2 A;  2BAY A;  2H0D A;  4W4U A;  4R8P K;  2E61 A;  4GNG A;  4CA1 A;  1WGM A;  4X3G A;  2G45 A;  2VPG A;  2C2L A;  3O47 A;  4GNF A;  2L0B A;  2LAU A;  3IHP A;  1FP0 A;  3LRQ A;  4F1P A;  3ZTG A;  4A4C A;  2LXP C;  3M99 A;  3LDY A;  1WEV A;  3ZVY A;  3N9Q A;  1WEW A;  2ECN A;  2LGV A;  4MVT A;  1WIL A;  4TKP B;  4Q6F A;  4N4F A; 
#chains in the Genus database with same CATH homology
 2JRJ A;  3QZV A;  3ZPV 1;  4A4B A;  2QIZ A;  4QF2 A;  2MA5 A;  4WZ2 A;  4C9Z A;  2HYE D;  3HCS A;  3KQI A;  2L5U A;  4ZDT A;  4N3W A;  3ZPV E;  1WFK A;  3KV6 A;  5TDW A;  3ZVZ B;  4IC3 A;  1WEU A;  4A49 A;  1HYJ A;  2VPE A;  2ECI A;  5H1U A;  2VJE B;  5D1L B;  2IDA A;  4BHW A;  2ECV A;  5G04 B;  2ECW A;  2QIC A;  3FL2 A;  3N9P A;  5LCW B;  4ZQL A;  5TBN A;  1WES A;  3L1X A;  2OXQ C;  5JG6 A;  5C13 A;  3KV5 A;  3O35 A;  4L7X A;  2M1R A;  2LGL A;  3O34 A;  2YSJ A;  2KE1 A;  2YHN A;  2YQM A;  4V3L C;  4BBQ A;  2K17 A;  1WEO A;  2FSA A;  2PNX A;  4L58 A;  4LK9 A;  1VFY A;  2E6R A;  5AIU A;  1X4J A;  2F6N A;  4YAT A;  2LRI C;  4I7B A;  1WEN A;  2PUY A;  3SOU A;  4YC9 A;  3SOX A;  1X4I A;  5KH3 A;  4YBT A;  1ZBD B;  2KGG A;  2KFT A;  2LGG A;  2M6M A;  3C6W A;  2CKL B;  2CSZ A;  4CCG X;  1WEP A;  4YBM A;  4B7Y C;  5B75 A;  2ECJ A;  2ECT A;  4AUQ B;  5DKA A;  5KH9 A;  2YW8 A;  2CSY A;  4FJC A;  5B79 A;  1G25 A;  2M85 A;  2KYU A;  3U5M A;  1U6G B;  2VNF A;  1CHC A;  1WEE A;  5C11 A;  3SOW A;  3U5P A;  4R7E A;  4AP4 A;  5B76 A;  3PHD A;  3RPG B;  4FK5 A;  4FIP A;  4S3O B;  2MIQ A;  4FO9 A;  5G05 B;  4LLB A;  4PPE A;  3U5O A;  5D1M B;  3LQH A;  5LKX A;  2D8S A;  2G43 A;  2FUU A;  2LDR A;  5TAB A;  2JMJ A;  3RPG C;  3GV4 A;  5G0F A;  2KWJ A;  5LKZ A;  4S3O C;  3MHS A;  4F52 B;  2LGK A;  3T7L A;  4GB0 A;  4GND A;  2Y43 A;  3MHH A;  4MSX A;  2KWN A;  3L11 A;  1Z60 A;  2L43 A;  5FB1 A;  4AYC B;  3ASL A;  3T6R A;  1K2F A;  1FBV A;  4PTB A;  1X4U A;  3NG2 A;  2JMD A;  4YAX A;  2K4D A;  1WIM A;  3U5N A;  3RTR B;  2LV9 A;  2MD8 C;  2Y1N A;  4YAD A;  2L80 A;  3LQJ A;  1V87 A;  4P5O B;  1E4U A;  5EYA F;  1MM2 A;  3DPL R;  1T1H A;  4LAD B;  2VJE A;  3KNV A;  4O64 A;  2EOD A;  4WZ3 B;  3O36 A;  3ZNI A;  3M62 A;  4UI9 B;  5LKT A;  3N9M A;  3ZYQ A;  4R2Y A;  2CT2 A;  1IYM A;  4UP5 A;  2KR4 A;  2RSD A;  2MNZ A;  2YUR A;  1JOC A;  1JM7 B;  2EA6 A;  2F42 A;  2YSM A;  2VP7 A;  1Z6U A;  2LXH C;  2XEU A;  1LDJ B;  2KU3 A;  5H1V A;  4WZ0 A;  2LN0 A;  1HYI A;  4YBS A;  1DVP A;  2C2V S;  5B77 A;  4A0C D;  3EB6 A;  2QJ0 A;  2E6S A;  2L75 A;  2VJF B;  1N87 A;  5LKU A;  2NAA A;  5B78 A;  1JM7 A;  1Z2Q A;  4V3K C;  2CKL A;  1WEQ A;  1MM3 A;  3O33 A;  5TDR A;  3HCU A;  5H9M A;  5AIT A;  3VK6 A;  2K1J A;  5DIN A;  3DQV R;  2M3H A;  2KWO A;  2KIZ A;  2HDP A;  3N9N A;  4B86 C;  3PUQ A;  4XI1 A;  5TRB A;  2VPD A;  4YAB A;  1F62 A;  2MD7 B;  2VJF A;  4I7C A;  1XWH A;  3N9L A;  2G6Q A;  1VD4 A;  2K16 A;  2I50 A;  2ECG A;  4LKA A;  5FEY A;  4I7D A;  2YYR A;  5I3L A;  5H1T A;  1RMD A;  2VPB A;  3PUR A;  3L1Z B;  4ZUX U;  2FUI A;  4WA6 A;  4UP0 A;  3HTK C;  2KWK A;  2YT5 A;  2Y1M A;  1BOR A;  2ZET C;  2RI7 A;  4GNE A;  5J3X A;  5FER A;  3EB5 A;  2YUC A;  3O70 A;  3O7A A;  2EGP A;  4IC2 A;  3V43 A;  2YRE A;  2LQ6 A;  2MNY A;  5D1K B;  2MA6 A;  3SHB A;  3LQI A;  2JMI A;  4LJN A;  2DX8 A;  3O37 A;  2KGI A;  2UZG A;  3N9O A;  4QF3 A;  2YU4 A;  1WEM A;  4AYC A;  3I2D A;  2MUM A;  2H0D B;  2F6J A;  5KH7 A;  2XB1 A;  2YQL A;  1VYX A;  5B8D A;  3M63 A;  4AVX A;  3HCT A;  2KRE A;  5FB0 A;  2YHO A;  1WE9 A;  1LDK C;  2AN6 A;  2MT5 A;  3C5K A;  3GL6 A;  4NN2 A;  2BAY A;  2H0D A;  4W4U A;  4R8P K;  4GNG A;  4CA1 A;  1WGM A;  4X3G A;  2G45 A;  2VPG A;  2C2L A;  4GNF A;  2L0B A;  3LRQ A;  3IHP A;  1FP0 A;  3ZTG A;  4A4C A;  2LXP C;  3M99 A;  1WEV A;  3ZVY A;  3N9Q A;  1WEW A;  2ECN A;  2LGV A;  4MVT A;  1WIL A;  4TKP B;  4Q6F A;  4N4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...