2G45A

Co-crystal structure of znf ubp domain from the deubiquitinating enzyme isopeptidase t (isot) in complex with ubiquitin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
VRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title The Ubiquitin Binding Domain ZnF UBP Recognizes the C-Terminal Diglycine Motif of Unanchored Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 23
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2g45A00
4FO9A 4UP0A 3KQIA 5LKXA 4F52B 5FERA 3RTRB 5G04B 4A4BA 4I7BA 2M6MA 2AN6A 3O70A 1X4JA 1E4UA 4L7XA 4N4FA 1FP0A 1JM7A 1Z60A 3ZYQA 2MUMA 4R8PK 2EGPA 2YHOA 4B7YC 5DINA 1WEEA 3N9MA 5JG6A 3O36A 5TABA 4YATA 2RI7A 2LGGA 2YSMA 3HCSA 5B77A 4PPEA 2ECIA 4L58A 1XWHA 4QF2A 2OXQC 2KIZA 4YBMA 2KGIA 1JOCA 4AP4A 3QZVA 2LXHC 2JRJA 2K1JA 5LCWB 5D1LB 3SOXA 3NG2A 3O34A 1K2FA 2KREA 2ECNA 3LQIA 2CKLA 3I2DA 2L5UA 1MM3A 1G25A 4YBSA 4BHWA 2L80A 5G05B 2H0DA 4YC9A 4S3OC 2LN0A 2XB1A 3ZTGA 2F6NA 1X4UA 2YW8A 5LKTA 2CSZA 3ZVYA 3MHHA 4GNFA 2VP7A 4GNDA 3T7LA 4A49A 5AIUA 4X3GA 3DPLR 2C2VS 2LV9A 1LDKC 2D8SA 3IHPA 2HDPA 2MD8C 2KGGA 3VK6A 2MIQA 2VJEA 5KH3A 4PTBA 2E6RA 2Y1MA 1WEQA 3ZPV1 4ZUXU 2YHNA 4C9ZA 2IDAA 1BORA 3U5NA 2RSDA 5B76A 1HYJA 2CT2A 2VPDA 5D1MB 4I7CA 5FB0A 2ECVA 3PURA 4V3KC 1Z2QA 4B86C 5H9MA 3RPGC 3GL6A 2YYRA 2E6SA 4AYCB 1WEVA 1WILA 1WEWA 1ZBDB 3KV5A 1VD4A 5C13A 1F62A 3GV4A 2BAYA 3DQVR 3PUQA 2F42A 4UP5A 2L0BA 4WZ2A 2QICA 1IYMA 2M1RA 1WESA 2MA6A 1U6GB 2F6JA 2ECJA 2LGLA 3ZVZB 2YQLA 4A0CD 3SOUA 3U5MA 3N9NA 2VPBA 3M62A 4A4CA 3U5PA 2Y1NA 4AUQB 2QIZA 2JMDA 4FIPA 1Z6UA 4YAXA 2YURA 2K16A 4QF3A 1HYIA 2FUIA 2VJFB 4ZQLA 2YT5A 4GNGA 5TDRA 3U5OA 4V3LC 4GNEA 3N9LA 4P5OB 5FEYA 4TKPB 2K4DA 2JMJA 5H1UA 2MA5A 5FB1A 4LKAA 1WE9A 1MM2A 2YSJA 2VPGA 2YREA 1LDJB 2ECWA 2MNZA 4MSXA 4FJCA 1CHCA 2DX8A 4ZDTA 2C2LA 2EODA 2CSYA 3ZPVE 4AYCA 1WGMA 2ZETC 2L43A 5EYAF 1WEUA 5I3LA 2KWKA 2KR4A 2UZGA 3SOWA 1FBVA 4IC2A 4WZ3B 3N9QA 2VNFA 2MT5A 5TBNA 3ZNIA 2PUYA 2VPEA 5H1TA 3LQJA 2HYED 2LQ6A 3PHDA 2FSAA 3ASLA 2KWNA 2MD7B 3L11A 2K17A 2LGVA 3O33A 3FL2A 3EB6A 3M99A 1WEMA 3N9PA 2XEUA 2ECTA 2VJEB 4R2YA 1V87A 2VJFA 2EA6A 2G6QA 3O37A 4Q6FA 5B79A 4UI9B 4YABA 2JMIA 4NN2A 2LDRA 2KFTA 1X4IA 2I50A 3RPGB 2KE1A 5B8DA 1T1HA 2FUUA 5LKZA 4MVTA 4XI1A 5DKAA 5TDWA 2YQMA 3C6WA 3L1ZB 4LK9A 1JM7B 5B78A 2G45A 2PNXA 4LLBA 3SHBA 4N3WA 4GB0A 3N9OA 5AITA 2KWOA 4AVXA 1RMDA 2KWJA 2NAAA 4I7DA 1WFKA 3EB5A 2ECGA 2QJ0A 5C11A 3KV6A 3L1XA 3V43A 3HCUA 5D1KB 5B75A 3O35A 2KYUA 5TRBA 1WIMA 3HTKC 3HCTA 4R7EA 1VFYA 2M3HA 4WA6A 1VYXA 4O64A 1WEPA 4WZ0A 4W4UA 4BBQA 4LADB 5KH9A 4IC3A 5LKUA 2LRIC 4CA1A 3O7AA 5H1VA 1WENA 5J3XA 2CKLB 5KH7A 2LXPC 2M85A 1N87A 2MNYA 1DVPA 3T6RA 3LQHA 3LRQA 4S3OB 1WEOA 3M63A 2H0DB 4CCGX 2KU3A 3C5KA 2L75A 4YADA 3MHSA 2LGKA 2YU4A 4YBTA 4LJNA 2G43A 2Y43A 3KNVA 4FK5A 2YUCA 5G0FA
chains in the Genus database with same CATH superfamily
2CRWA 3SUBA 3DDTA 4FO9A 2OWAA 4UP0A 3KQIA 5LKXA 4F52B 5FERA 3RTRB 5G04B 4A4BA 4I7BA 2M6MA 2AN6A 3O70A 1X4JA 1E4UA 4L7XA 4N4FA 3LVQE 1FP0A 1JM7A 1Z60A 2L7PA 3ZYQA 2MUMA 4R8PK 2EGPA 2YHOA 4B7YC 5DINA 1WEEA 3N9MA 4H9DA 5JG6A 2RR4A 3O36A 5TABA 4YATA 2RI7A 2LGGA 2YSMA 3HCSA 2LAUA 5B77A 4PPEA 2ECIA 4L58A 1XWHA 4QF2A 2OXQC 2KIZA 3FAOA 4YBMA 2KGIA 1JOCA 4AP4A 3QZVA 2LXHC 2JRJA 2K1JA 5LCWB 5D1LB 3SOXA 3NG2A 5SVYA 3O34A 1K2FA 2KREA 3MDBC 3KDEC 2ECNA 3LQIA 2CKLA 3I2DA 2L5UA 1MM3A 1G25A 4YBSA 4BHWA 2L80A 5G05B 2H0DA 4YC9A 5SVXA 4S3OC 2LN0A 2DSMA 2XB1A 3ZTGA 2F6NA 1X4UA 2YW8A 5LKTA 2CSZA 3ZVYA 3MHHA 4GNFA 2VP7A 3JUEA 4GNDA 3M7KA 3T7LA 4A49A 5AIUA 4X3GA 3DPLR 2C2VS 2B0OE 2LV9A 1LDKC 2D8SA 3IHPA 2HDPA 2MD8C 2JUNA 2KGGA 2CSVA 4OGCA 3VK6A 2EXUA 2MIQA 2VJEA 5KH3A 4PTBA 2E6RA 2Y1MA 1WEQA 3ZPV1 3DWDA 4ZUXU 2YHNA 4C9ZA 3H7HA 2IDAA 1BORA 3U5NA 2RSDA 5B76A 1HYJA 2CT2A 2VPDA 5D1MB 4I7CA 5FB0A 2XP0A 2ECVA 3PURA 4V3KC 1Z2QA 3FM8C 4B86C 5H9MA 3RPGC 3GL6A 2YYRA 2E6SA 4AYCB 1WEVA 1WILA 2CRRA 1WEWA 1ZBDB 3KV5A 1VD4A 2IQJA 5C13A 3GV4A 1F62A 2BAYA 3DQVR 3PUQA 2F42A 4UP5A 2L0BA 4O62A 4WZ2A 2MKEA 2QICA 1IYMA 2M1RA 1WESA 2MA6A 1U6GB 2F6JA 2XOYA 2ECJA 2LGLA 3ZVZB 2YQLA 4OGEA 4A0CD 3SOUA 3U5MA 3N9NA 2VPBA 3LJUX 3M62A 4A4CA 3U5PA 2FFWA 2EGMA 2Y1NA 4AUQB 2QIZA 2JMDA 4FIPA 1Z6UA 4YAXA 2YURA 2K16A 4QF3A 1HYIA 2FUIA 2VJFB 4ZQLA 2YT5A 4GNGA 5TDRA 3U5OA 4V3LC 4GNEA 2DJAA 3N9LA 4Z0RA 2XOCA 4P5OB 5FEYA 4TKPB 2K4DA 2JMJA 3LVRE 5H1UA 5K3QA 2MA5A 5FB1A 4LKAA 1WE9A 1MM2A 2YSJA 2YVRA 2KKXA 3FANA 2VPGA 2YREA 1LDJB 2ECWA 2MNZA 4MSXA 1DCQA 4FJCA 1CHCA 2DX8A 4ZDTA 2C2LA 2CONA 2EODA 2CSYA 3ZPVE 4AYCA 1WGMA 2ZETC 4QQ4A 2L43A 5EYAF 4Z0OA 2E61A 1WEUA 5I3LA 2P57A 2KWKA 2KR4A 2UZGA 3SOWA 1FBVA 5SVIB 4IC2A 4WZ3B 3N9QA 1MBMA 2VNFA 2MT5A 5TBNA 3ZNIA 2PUYA 2VPEA 5H1TA 3LQJA 2HYED 2LQ6A 3PHDA 2FSAA 3ASLA 2KWNA 2MD7B 3L11A 2K17A 4F1PA 2LGVA 3O33A 3FL2A 3EB6A 3M99A 1WEMA 3N9PA 2XEUA 2ECTA 2VJEB 4R2YA 1V87A 2VJFA 2EA6A 2G6QA 3O37A 4Q6FA 3T9KA 5B79A 2M13A 4UI9B 4YABA 2JMIA 4NN2A 2LDRA 3FJUB 2KFTA 1X4IA 2I50A 3RPGB 2KE1A 5B8DA 1T1HA 2FUUA 5LKZA 4MVTA 4XI1A 5DKAA 5TDWA 2YQMA 3C6WA 3L1ZB 4LK9A 1JM7B 5B78A 2G45A 2PNXA 4LLBA 3SHBA 4N3WA 4GB0A 3FEHA 3N9OA 5AITA 2KWOA 2XOZA 4AVXA 1RMDA 2KWJA 2NAAA 4I7DA 1WFKA 3EB5A 2ECGA 2KKYA 2QJ0A 5C11A 3KV6A 3L1XA 3V43A 3HCUA 5D1KB 5B75A 3O35A 2KYUA 3O47A 5TRBA 1WIMA 3HTKC 3HCTA 4R7EA 1VFYA 2M3HA 4WA6A 5SVIA 1VYXA 4O64A 1WEPA 3Q1DA 2D8UA 3LDYA 4WZ0A 4W4UA 4BBQA 4LADB 5KH9A 4IC3A 5LKUA 2LRIC 4CA1A 3O7AA 5H1VA 1WENA 5J3XA 2CKLB 5KH7A 2LXPC 2M85A 3PLWA 1N87A 2MNYA 1DVPA 3T6RA 2JM3A 3LQHA 3LRQA 4S3OB 1WEOA 3M63A 2H0DB 4CCGX 2KU3A 3C5KA 2L75A 4YADA 3MHSA 2LGKA 2YU4A 2FD4A 4LJNA 4YBTA 2G43A 2Y43A 3E2DA 3KNVA 4FK5A 2YUCA 5G0FA
chains in the Genus database with same CATH topology
4FO9A 4UP0A 3KQIA 5LKXA 4F52B 5FERA 3RTRB 5G04B 4A4BA 4I7BA 2M6MA 2AN6A 3O70A 1X4JA 1E4UA 4L7XA 4N4FA 1FP0A 1JM7A 1Z60A 3ZYQA 2MUMA 4R8PK 2EGPA 2YHOA 4B7YC 5DINA 1WEEA 3N9MA 5JG6A 3O36A 5TABA 4YATA 2RI7A 2LGGA 2YSMA 3HCSA 5B77A 4PPEA 2ECIA 4L58A 1XWHA 4QF2A 2OXQC 2KIZA 4YBMA 2KGIA 1JOCA 4AP4A 3QZVA 2LXHC 2JRJA 2K1JA 5LCWB 5D1LB 3SOXA 3NG2A 3O34A 1K2FA 2KREA 2ECNA 3LQIA 2CKLA 3I2DA 2L5UA 1MM3A 1G25A 4YBSA 4BHWA 2L80A 5G05B 2H0DA 4YC9A 4S3OC 2LN0A 2XB1A 3ZTGA 2F6NA 1X4UA 2YW8A 5LKTA 2CSZA 3ZVYA 3MHHA 4GNFA 2VP7A 4GNDA 3T7LA 4A49A 5AIUA 4X3GA 3DPLR 2C2VS 2LV9A 1LDKC 2D8SA 3IHPA 2HDPA 2MD8C 2KGGA 3VK6A 2MIQA 2VJEA 5KH3A 4PTBA 2E6RA 2Y1MA 1WEQA 3ZPV1 4ZUXU 2YHNA 4C9ZA 2IDAA 1BORA 3U5NA 2RSDA 5B76A 1HYJA 2CT2A 2VPDA 5D1MB 4I7CA 5FB0A 2ECVA 3PURA 4V3KC 1Z2QA 4B86C 5H9MA 3RPGC 3GL6A 2YYRA 2E6SA 4AYCB 1WEVA 1WILA 1WEWA 1ZBDB 3KV5A 1VD4A 5C13A 1F62A 3GV4A 2BAYA 3DQVR 3PUQA 2F42A 4UP5A 2L0BA 4WZ2A 2QICA 1IYMA 2M1RA 1WESA 2MA6A 1U6GB 2F6JA 2ECJA 2LGLA 3ZVZB 2YQLA 4A0CD 3SOUA 3U5MA 3N9NA 2VPBA 3M62A 4A4CA 3U5PA 2Y1NA 4AUQB 2QIZA 2JMDA 4FIPA 1Z6UA 4YAXA 2YURA 2K16A 4QF3A 1HYIA 2FUIA 2VJFB 4ZQLA 2YT5A 4GNGA 5TDRA 3U5OA 4V3LC 4GNEA 3N9LA 4P5OB 5FEYA 4TKPB 2K4DA 2JMJA 5H1UA 2MA5A 5FB1A 4LKAA 1WE9A 1MM2A 2YSJA 2VPGA 2YREA 1LDJB 2ECWA 2MNZA 4MSXA 4FJCA 1CHCA 2DX8A 4ZDTA 2C2LA 2EODA 2CSYA 3ZPVE 4AYCA 1WGMA 2ZETC 2L43A 5EYAF 1WEUA 5I3LA 2KWKA 2KR4A 2UZGA 3SOWA 1FBVA 4IC2A 4WZ3B 3N9QA 2VNFA 2MT5A 5TBNA 3ZNIA 2PUYA 2VPEA 5H1TA 3LQJA 2HYED 2LQ6A 3PHDA 2FSAA 3ASLA 2KWNA 2MD7B 3L11A 2K17A 2LGVA 3O33A 3FL2A 3EB6A 3M99A 1WEMA 3N9PA 2XEUA 2ECTA 2VJEB 4R2YA 1V87A 2VJFA 2EA6A 2G6QA 3O37A 4Q6FA 5B79A 4UI9B 4YABA 2JMIA 4NN2A 2LDRA 2KFTA 1X4IA 2I50A 3RPGB 2KE1A 5B8DA 1T1HA 2FUUA 5LKZA 4MVTA 4XI1A 5DKAA 5TDWA 2YQMA 3C6WA 3L1ZB 4LK9A 1JM7B 5B78A 2G45A 2PNXA 4LLBA 3SHBA 4N3WA 4GB0A 3N9OA 5AITA 2KWOA 4AVXA 1RMDA 2KWJA 2NAAA 4I7DA 1WFKA 3EB5A 2ECGA 2QJ0A 5C11A 3KV6A 3L1XA 3V43A 3HCUA 5D1KB 5B75A 3O35A 2KYUA 5TRBA 1WIMA 3HTKC 3HCTA 4R7EA 1VFYA 2M3HA 4WA6A 1VYXA 4O64A 1WEPA 4WZ0A 4W4UA 4BBQA 4LADB 5KH9A 4IC3A 5LKUA 2LRIC 4CA1A 3O7AA 5H1VA 1WENA 5J3XA 2CKLB 5KH7A 2LXPC 2M85A 1N87A 2MNYA 1DVPA 3T6RA 3LQHA 3LRQA 4S3OB 1WEOA 3M63A 2H0DB 4CCGX 2KU3A 3C5KA 2L75A 4YADA 3MHSA 2LGKA 2YU4A 4YBTA 4LJNA 2G43A 2Y43A 3KNVA 4FK5A 2YUCA 5G0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO9 A;  4UP0 A;  3KQI A;  5LKX A;  4F52 B;  5FER A;  3RTR B;  5G04 B;  4A4B A;  4I7B A;  2M6M A;  2AN6 A;  3O70 A;  1X4J A;  1E4U A;  4L7X A;  4N4F A;  1FP0 A;  1JM7 A;  1Z60 A;  3ZYQ A;  2MUM A;  4R8P K;  2EGP A;  2YHO A;  4B7Y C;  5DIN A;  1WEE A;  3N9M A;  5JG6 A;  3O36 A;  5TAB A;  4YAT A;  2RI7 A;  2LGG A;  2YSM A;  3HCS A;  5B77 A;  4PPE A;  2ECI A;  4L58 A;  1XWH A;  4QF2 A;  2OXQ C;  2KIZ A;  4YBM A;  2KGI A;  1JOC A;  4AP4 A;  3QZV A;  2LXH C;  2JRJ A;  2K1J A;  5LCW B;  5D1L B;  3SOX A;  3NG2 A;  3O34 A;  1K2F A;  2KRE A;  2ECN A;  3LQI A;  2CKL A;  3I2D A;  2L5U A;  1MM3 A;  1G25 A;  4YBS A;  4BHW A;  2L80 A;  5G05 B;  2H0D A;  4YC9 A;  4S3O C;  2LN0 A;  2XB1 A;  3ZTG A;  2F6N A;  1X4U A;  2YW8 A;  5LKT A;  2CSZ A;  3ZVY A;  3MHH A;  4GNF A;  2VP7 A;  4GND A;  3T7L A;  4A49 A;  5AIU A;  4X3G A;  3DPL R;  2C2V S;  2LV9 A;  1LDK C;  2D8S A;  3IHP A;  2HDP A;  2MD8 C;  2KGG A;  3VK6 A;  2MIQ A;  2VJE A;  5KH3 A;  4PTB A;  2E6R A;  2Y1M A;  1WEQ A;  3ZPV 1;  4ZUX U;  2YHN A;  4C9Z A;  2IDA A;  1BOR A;  3U5N A;  2RSD A;  5B76 A;  1HYJ A;  2CT2 A;  2VPD A;  5D1M B;  4I7C A;  5FB0 A;  2ECV A;  3PUR A;  4V3K C;  1Z2Q A;  4B86 C;  5H9M A;  3RPG C;  3GL6 A;  2YYR A;  2E6S A;  4AYC B;  1WEV A;  1WIL A;  1WEW A;  1ZBD B;  3KV5 A;  1VD4 A;  5C13 A;  1F62 A;  3GV4 A;  2BAY A;  3DQV R;  3PUQ A;  2F42 A;  4UP5 A;  2L0B A;  4WZ2 A;  2QIC A;  1IYM A;  2M1R A;  1WES A;  2MA6 A;  1U6G B;  2F6J A;  2ECJ A;  2LGL A;  3ZVZ B;  2YQL A;  4A0C D;  3SOU A;  3U5M A;  3N9N A;  2VPB A;  3M62 A;  4A4C A;  3U5P A;  2Y1N A;  4AUQ B;  2QIZ A;  2JMD A;  4FIP A;  1Z6U A;  4YAX A;  2YUR A;  2K16 A;  4QF3 A;  1HYI A;  2FUI A;  2VJF B;  4ZQL A;  2YT5 A;  4GNG A;  5TDR A;  3U5O A;  4V3L C;  4GNE A;  3N9L A;  4P5O B;  5FEY A;  4TKP B;  2K4D A;  2JMJ A;  5H1U A;  2MA5 A;  5FB1 A;  4LKA A;  1WE9 A;  1MM2 A;  2YSJ A;  2VPG A;  2YRE A;  1LDJ B;  2ECW A;  2MNZ A;  4MSX A;  4FJC A;  1CHC A;  2DX8 A;  4ZDT A;  2C2L A;  2EOD A;  2CSY A;  3ZPV E;  4AYC A;  1WGM A;  2ZET C;  2L43 A;  5EYA F;  1WEU A;  5I3L A;  2KWK A;  2KR4 A;  2UZG A;  3SOW A;  1FBV A;  4IC2 A;  4WZ3 B;  3N9Q A;  2VNF A;  2MT5 A;  5TBN A;  3ZNI A;  2PUY A;  2VPE A;  5H1T A;  3LQJ A;  2HYE D;  2LQ6 A;  3PHD A;  2FSA A;  3ASL A;  2KWN A;  2MD7 B;  3L11 A;  2K17 A;  2LGV A;  3O33 A;  3FL2 A;  3EB6 A;  3M99 A;  1WEM A;  3N9P A;  2XEU A;  2ECT A;  2VJE B;  4R2Y A;  1V87 A;  2VJF A;  2EA6 A;  2G6Q A;  3O37 A;  4Q6F A;  5B79 A;  4UI9 B;  4YAB A;  2JMI A;  4NN2 A;  2LDR A;  2KFT A;  1X4I A;  2I50 A;  3RPG B;  2KE1 A;  5B8D A;  1T1H A;  2FUU A;  5LKZ A;  4MVT A;  4XI1 A;  5DKA A;  5TDW A;  2YQM A;  3C6W A;  3L1Z B;  4LK9 A;  1JM7 B;  5B78 A;  2G45 A;  2PNX A;  4LLB A;  3SHB A;  4N3W A;  4GB0 A;  3N9O A;  5AIT A;  2KWO A;  4AVX A;  1RMD A;  2KWJ A;  2NAA A;  4I7D A;  1WFK A;  3EB5 A;  2ECG A;  2QJ0 A;  5C11 A;  3KV6 A;  3L1X A;  3V43 A;  3HCU A;  5D1K B;  5B75 A;  3O35 A;  2KYU A;  5TRB A;  1WIM A;  3HTK C;  3HCT A;  4R7E A;  1VFY A;  2M3H A;  4WA6 A;  1VYX A;  4O64 A;  1WEP A;  4WZ0 A;  4W4U A;  4BBQ A;  4LAD B;  5KH9 A;  4IC3 A;  5LKU A;  2LRI C;  4CA1 A;  3O7A A;  5H1V A;  1WEN A;  5J3X A;  2CKL B;  5KH7 A;  2LXP C;  2M85 A;  1N87 A;  2MNY A;  1DVP A;  3T6R A;  3LQH A;  3LRQ A;  4S3O B;  1WEO A;  3M63 A;  2H0D B;  4CCG X;  2KU3 A;  3C5K A;  2L75 A;  4YAD A;  3MHS A;  2LGK A;  2YU4 A;  4YBT A;  4LJN A;  2G43 A;  2Y43 A;  3KNV A;  4FK5 A;  2YUC A;  5G0F A; 
#chains in the Genus database with same CATH topology
 2CRW A;  3SUB A;  3DDT A;  4FO9 A;  2OWA A;  4UP0 A;  3KQI A;  5LKX A;  4F52 B;  5FER A;  3RTR B;  5G04 B;  4A4B A;  4I7B A;  2M6M A;  2AN6 A;  3O70 A;  1X4J A;  1E4U A;  4L7X A;  4N4F A;  3LVQ E;  1FP0 A;  1JM7 A;  1Z60 A;  2L7P A;  3ZYQ A;  2MUM A;  4R8P K;  2EGP A;  2YHO A;  4B7Y C;  5DIN A;  1WEE A;  3N9M A;  4H9D A;  5JG6 A;  2RR4 A;  3O36 A;  5TAB A;  4YAT A;  2RI7 A;  2LGG A;  2YSM A;  3HCS A;  2LAU A;  5B77 A;  4PPE A;  2ECI A;  4L58 A;  1XWH A;  4QF2 A;  2OXQ C;  2KIZ A;  3FAO A;  4YBM A;  2KGI A;  1JOC A;  4AP4 A;  3QZV A;  2LXH C;  2JRJ A;  2K1J A;  5LCW B;  5D1L B;  3SOX A;  3NG2 A;  5SVY A;  3O34 A;  1K2F A;  2KRE A;  3MDB C;  3KDE C;  2ECN A;  3LQI A;  2CKL A;  3I2D A;  2L5U A;  1MM3 A;  1G25 A;  4YBS A;  4BHW A;  2L80 A;  5G05 B;  2H0D A;  4YC9 A;  5SVX A;  4S3O C;  2LN0 A;  2DSM A;  2XB1 A;  3ZTG A;  2F6N A;  1X4U A;  2YW8 A;  5LKT A;  2CSZ A;  3ZVY A;  3MHH A;  4GNF A;  2VP7 A;  3JUE A;  4GND A;  3M7K A;  3T7L A;  4A49 A;  5AIU A;  4X3G A;  3DPL R;  2C2V S;  2B0O E;  2LV9 A;  1LDK C;  2D8S A;  3IHP A;  2HDP A;  2MD8 C;  2JUN A;  2KGG A;  2CSV A;  4OGC A;  3VK6 A;  2EXU A;  2MIQ A;  2VJE A;  5KH3 A;  4PTB A;  2E6R A;  2Y1M A;  1WEQ A;  3ZPV 1;  3DWD A;  4ZUX U;  2YHN A;  4C9Z A;  3H7H A;  2IDA A;  1BOR A;  3U5N A;  2RSD A;  5B76 A;  1HYJ A;  2CT2 A;  2VPD A;  5D1M B;  4I7C A;  5FB0 A;  2XP0 A;  2ECV A;  3PUR A;  4V3K C;  1Z2Q A;  3FM8 C;  4B86 C;  5H9M A;  3RPG C;  3GL6 A;  2YYR A;  2E6S A;  4AYC B;  1WEV A;  1WIL A;  2CRR A;  1WEW A;  1ZBD B;  3KV5 A;  1VD4 A;  2IQJ A;  5C13 A;  3GV4 A;  1F62 A;  2BAY A;  3DQV R;  3PUQ A;  2F42 A;  4UP5 A;  2L0B A;  4O62 A;  4WZ2 A;  2MKE A;  2QIC A;  1IYM A;  2M1R A;  1WES A;  2MA6 A;  1U6G B;  2F6J A;  2XOY A;  2ECJ A;  2LGL A;  3ZVZ B;  2YQL A;  4OGE A;  4A0C D;  3SOU A;  3U5M A;  3N9N A;  2VPB A;  3LJU X;  3M62 A;  4A4C A;  3U5P A;  2FFW A;  2EGM A;  2Y1N A;  4AUQ B;  2QIZ A;  2JMD A;  4FIP A;  1Z6U A;  4YAX A;  2YUR A;  2K16 A;  4QF3 A;  1HYI A;  2FUI A;  2VJF B;  4ZQL A;  2YT5 A;  4GNG A;  5TDR A;  3U5O A;  4V3L C;  4GNE A;  2DJA A;  3N9L A;  4Z0R A;  2XOC A;  4P5O B;  5FEY A;  4TKP B;  2K4D A;  2JMJ A;  3LVR E;  5H1U A;  5K3Q A;  2MA5 A;  5FB1 A;  4LKA A;  1WE9 A;  1MM2 A;  2YSJ A;  2YVR A;  2KKX A;  3FAN A;  2VPG A;  2YRE A;  1LDJ B;  2ECW A;  2MNZ A;  4MSX A;  1DCQ A;  4FJC A;  1CHC A;  2DX8 A;  4ZDT A;  2C2L A;  2CON A;  2EOD A;  2CSY A;  3ZPV E;  4AYC A;  1WGM A;  2ZET C;  4QQ4 A;  2L43 A;  5EYA F;  4Z0O A;  2E61 A;  1WEU A;  5I3L A;  2P57 A;  2KWK A;  2KR4 A;  2UZG A;  3SOW A;  1FBV A;  5SVI B;  4IC2 A;  4WZ3 B;  3N9Q A;  1MBM A;  2VNF A;  2MT5 A;  5TBN A;  3ZNI A;  2PUY A;  2VPE A;  5H1T A;  3LQJ A;  2HYE D;  2LQ6 A;  3PHD A;  2FSA A;  3ASL A;  2KWN A;  2MD7 B;  3L11 A;  2K17 A;  4F1P A;  2LGV A;  3O33 A;  3FL2 A;  3EB6 A;  3M99 A;  1WEM A;  3N9P A;  2XEU A;  2ECT A;  2VJE B;  4R2Y A;  1V87 A;  2VJF A;  2EA6 A;  2G6Q A;  3O37 A;  4Q6F A;  3T9K A;  5B79 A;  2M13 A;  4UI9 B;  4YAB A;  2JMI A;  4NN2 A;  2LDR A;  3FJU B;  2KFT A;  1X4I A;  2I50 A;  3RPG B;  2KE1 A;  5B8D A;  1T1H A;  2FUU A;  5LKZ A;  4MVT A;  4XI1 A;  5DKA A;  5TDW A;  2YQM A;  3C6W A;  3L1Z B;  4LK9 A;  1JM7 B;  5B78 A;  2G45 A;  2PNX A;  4LLB A;  3SHB A;  4N3W A;  4GB0 A;  3FEH A;  3N9O A;  5AIT A;  2KWO A;  2XOZ A;  4AVX A;  1RMD A;  2KWJ A;  2NAA A;  4I7D A;  1WFK A;  3EB5 A;  2ECG A;  2KKY A;  2QJ0 A;  5C11 A;  3KV6 A;  3L1X A;  3V43 A;  3HCU A;  5D1K B;  5B75 A;  3O35 A;  2KYU A;  3O47 A;  5TRB A;  1WIM A;  3HTK C;  3HCT A;  4R7E A;  1VFY A;  2M3H A;  4WA6 A;  5SVI A;  1VYX A;  4O64 A;  1WEP A;  3Q1D A;  2D8U A;  3LDY A;  4WZ0 A;  4W4U A;  4BBQ A;  4LAD B;  5KH9 A;  4IC3 A;  5LKU A;  2LRI C;  4CA1 A;  3O7A A;  5H1V A;  1WEN A;  5J3X A;  2CKL B;  5KH7 A;  2LXP C;  2M85 A;  3PLW A;  1N87 A;  2MNY A;  1DVP A;  3T6R A;  2JM3 A;  3LQH A;  3LRQ A;  4S3O B;  1WEO A;  3M63 A;  2H0D B;  4CCG X;  2KU3 A;  3C5K A;  2L75 A;  4YAD A;  3MHS A;  2LGK A;  2YU4 A;  2FD4 A;  4LJN A;  4YBT A;  2G43 A;  2Y43 A;  3E2D A;  3KNV A;  4FK5 A;  2YUC A;  5G0F A; 
#chains in the Genus database with same CATH homology
 4FO9 A;  4UP0 A;  3KQI A;  5LKX A;  4F52 B;  5FER A;  3RTR B;  5G04 B;  4A4B A;  4I7B A;  2M6M A;  2AN6 A;  3O70 A;  1X4J A;  1E4U A;  4L7X A;  4N4F A;  1FP0 A;  1JM7 A;  1Z60 A;  3ZYQ A;  2MUM A;  4R8P K;  2EGP A;  2YHO A;  4B7Y C;  5DIN A;  1WEE A;  3N9M A;  5JG6 A;  3O36 A;  5TAB A;  4YAT A;  2RI7 A;  2LGG A;  2YSM A;  3HCS A;  5B77 A;  4PPE A;  2ECI A;  4L58 A;  1XWH A;  4QF2 A;  2OXQ C;  2KIZ A;  4YBM A;  2KGI A;  1JOC A;  4AP4 A;  3QZV A;  2LXH C;  2JRJ A;  2K1J A;  5LCW B;  5D1L B;  3SOX A;  3NG2 A;  3O34 A;  1K2F A;  2KRE A;  2ECN A;  3LQI A;  2CKL A;  3I2D A;  2L5U A;  1MM3 A;  1G25 A;  4YBS A;  4BHW A;  2L80 A;  5G05 B;  2H0D A;  4YC9 A;  4S3O C;  2LN0 A;  2XB1 A;  3ZTG A;  2F6N A;  1X4U A;  2YW8 A;  5LKT A;  2CSZ A;  3ZVY A;  3MHH A;  4GNF A;  2VP7 A;  4GND A;  3T7L A;  4A49 A;  5AIU A;  4X3G A;  3DPL R;  2C2V S;  2LV9 A;  1LDK C;  2D8S A;  3IHP A;  2HDP A;  2MD8 C;  2KGG A;  3VK6 A;  2MIQ A;  2VJE A;  5KH3 A;  4PTB A;  2E6R A;  2Y1M A;  1WEQ A;  3ZPV 1;  4ZUX U;  2YHN A;  4C9Z A;  2IDA A;  1BOR A;  3U5N A;  2RSD A;  5B76 A;  1HYJ A;  2CT2 A;  2VPD A;  5D1M B;  4I7C A;  5FB0 A;  2ECV A;  3PUR A;  4V3K C;  1Z2Q A;  4B86 C;  5H9M A;  3RPG C;  3GL6 A;  2YYR A;  2E6S A;  4AYC B;  1WEV A;  1WIL A;  1WEW A;  1ZBD B;  3KV5 A;  1VD4 A;  5C13 A;  1F62 A;  3GV4 A;  2BAY A;  3DQV R;  3PUQ A;  2F42 A;  4UP5 A;  2L0B A;  4WZ2 A;  2QIC A;  1IYM A;  2M1R A;  1WES A;  2MA6 A;  1U6G B;  2F6J A;  2ECJ A;  2LGL A;  3ZVZ B;  2YQL A;  4A0C D;  3SOU A;  3U5M A;  3N9N A;  2VPB A;  3M62 A;  4A4C A;  3U5P A;  2Y1N A;  4AUQ B;  2QIZ A;  2JMD A;  4FIP A;  1Z6U A;  4YAX A;  2YUR A;  2K16 A;  4QF3 A;  1HYI A;  2FUI A;  2VJF B;  4ZQL A;  2YT5 A;  4GNG A;  5TDR A;  3U5O A;  4V3L C;  4GNE A;  3N9L A;  4P5O B;  5FEY A;  4TKP B;  2K4D A;  2JMJ A;  5H1U A;  2MA5 A;  5FB1 A;  4LKA A;  1WE9 A;  1MM2 A;  2YSJ A;  2VPG A;  2YRE A;  1LDJ B;  2ECW A;  2MNZ A;  4MSX A;  4FJC A;  1CHC A;  2DX8 A;  4ZDT A;  2C2L A;  2EOD A;  2CSY A;  3ZPV E;  4AYC A;  1WGM A;  2ZET C;  2L43 A;  5EYA F;  1WEU A;  5I3L A;  2KWK A;  2KR4 A;  2UZG A;  3SOW A;  1FBV A;  4IC2 A;  4WZ3 B;  3N9Q A;  2VNF A;  2MT5 A;  5TBN A;  3ZNI A;  2PUY A;  2VPE A;  5H1T A;  3LQJ A;  2HYE D;  2LQ6 A;  3PHD A;  2FSA A;  3ASL A;  2KWN A;  2MD7 B;  3L11 A;  2K17 A;  2LGV A;  3O33 A;  3FL2 A;  3EB6 A;  3M99 A;  1WEM A;  3N9P A;  2XEU A;  2ECT A;  2VJE B;  4R2Y A;  1V87 A;  2VJF A;  2EA6 A;  2G6Q A;  3O37 A;  4Q6F A;  5B79 A;  4UI9 B;  4YAB A;  2JMI A;  4NN2 A;  2LDR A;  2KFT A;  1X4I A;  2I50 A;  3RPG B;  2KE1 A;  5B8D A;  1T1H A;  2FUU A;  5LKZ A;  4MVT A;  4XI1 A;  5DKA A;  5TDW A;  2YQM A;  3C6W A;  3L1Z B;  4LK9 A;  1JM7 B;  5B78 A;  2G45 A;  2PNX A;  4LLB A;  3SHB A;  4N3W A;  4GB0 A;  3N9O A;  5AIT A;  2KWO A;  4AVX A;  1RMD A;  2KWJ A;  2NAA A;  4I7D A;  1WFK A;  3EB5 A;  2ECG A;  2QJ0 A;  5C11 A;  3KV6 A;  3L1X A;  3V43 A;  3HCU A;  5D1K B;  5B75 A;  3O35 A;  2KYU A;  5TRB A;  1WIM A;  3HTK C;  3HCT A;  4R7E A;  1VFY A;  2M3H A;  4WA6 A;  1VYX A;  4O64 A;  1WEP A;  4WZ0 A;  4W4U A;  4BBQ A;  4LAD B;  5KH9 A;  4IC3 A;  5LKU A;  2LRI C;  4CA1 A;  3O7A A;  5H1V A;  1WEN A;  5J3X A;  2CKL B;  5KH7 A;  2LXP C;  2M85 A;  1N87 A;  2MNY A;  1DVP A;  3T6R A;  3LQH A;  3LRQ A;  4S3O B;  1WEO A;  3M63 A;  2H0D B;  4CCG X;  2KU3 A;  3C5K A;  2L75 A;  4YAD A;  3MHS A;  2LGK A;  2YU4 A;  4YBT A;  4LJN A;  2G43 A;  2Y43 A;  3KNV A;  4FK5 A;  2YUC A;  5G0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...