3ZPV1

Crystal structure of drosophila pygo phd finger in complex with legless hd1 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
GAMAIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN BCL9 HOMOLOG
publication title Evolutionary Adaptation of the Fly Pygo Phd Finger Towards Recognizing Histone H3 Tail Methylated at Arginine 2
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 10
structure length 62
sequence length 62
chains with identical sequence 3, 5, 7, 9, A, C, G, I, K, M, Q, S, U, W
ec nomenclature
pdb deposition date 2013-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zpv100
2L0BA 2ECTA 5AITA 4BHWA 2MNZA 4FIPA 4S3OC 5LKUA 2JRJA 1MM2A 2RI7A 2CT2A 1WGMA 3C5KA 3C6WA 2M85A 3SHBA 3O7AA 4ZUXU 2ECWA 1WEUA 2YW8A 3IHPA 1JM7A 2KWJA 4I7DA 3DPLR 4PTBA 4F52B 2XEUA 5TABA 2PUYA 3T7LA 5FEYA 2LXHC 2IDAA 2KE1A 2MA6A 4LJNA 4YC9A 1Z60A 2L5UA 3ZTGA 1X4IA 3EB5A 4WA6A 4AYCB 4B86C 2JMDA 2K17A 1T1HA 4LADB 1X4UA 2LRIC 1BORA 3EB6A 2ECGA 1Z6UA 2ECVA 2MIQA 4ZDTA 3SOUA 4I7CA 4WZ0A 3KNVA 2KREA 4V3KC 2YT5A 4R7EA 2NAAA 5B76A 1HYJA 3M99A 5I3LA 2C2LA 3M63A 1K2FA 3HTKC 3SOXA 2KR4A 4R2YA 3U5MA 3VK6A 5FB1A 1FP0A 4YADA 3MHHA 3ASLA 1FBVA 2YREA 2VJFA 4PPEA 3FL2A 2YSJA 3I2DA 2Y1NA 2I50A 3N9LA 2ECIA 2VPEA 2EGPA 4L58A 2EODA 2H0DA 5EYAF 2VPDA 5FB0A 2K16A 2ECNA 4FJCA 2E6SA 2VPBA 2OXQC 4A0CD 3LQJA 4A4BA 2DX8A 2MD7B 4YAXA 4XI1A 2LV9A 1V87A 3MHSA 3O37A 1WE9A 1F62A 1HYIA 3RTRB 2PNXA 1WEQA 3KQIA 4WZ2A 1E4UA 2KGIA 1WEPA 2VJEA 4X3GA 4YABA 1Z2QA 3RPGC 4O64A 4QF3A 2LGKA 2LN0A 3L11A 4FK5A 2G45A 4A4CA 2YQMA 4AUQB 4ZQLA 2KWOA 3HCSA 4YBTA 2KYUA 2VP7A 2YUCA 2QJ0A 2M3HA 4S3OB 4LLBA 2YQLA 5TBNA 3T6RA 2KWNA 2LGGA 2LGVA 4TKPB 3ZVZB 3DQVR 3ZVYA 2EA6A 3LQHA 1WEVA 5D1LB 4A49A 3L1XA 2M6MA 3SOWA 1G25A 2F42A 4GNGA 5DINA 2Y43A 4UP5A 3GV4A 1VYXA 4IC3A 3M62A 4CA1A 2CKLB 2VPGA 2YU4A 2G43A 2KFTA 5G05B 4LK9A 1MM3A 2FSAA 4FO9A 3N9OA 2LQ6A 2MT5A 5H9MA 3HCUA 4GB0A 1JOCA 4UI9B 2HDPA 2CSYA 1VFYA 5KH3A 5KH7A 2VNFA 1IYMA 2G6QA 2CSZA 5FERA 5H1UA 3ZYQA 2HYED 5H1TA 4LKAA 4R8PK 5G0FA 1N87A 3O36A 3N9PA 2KIZA 3HCTA 5KH9A 2QIZA 2LGLA 2YSMA 2L75A 2AN6A 4YBMA 4L7XA 5TDRA 2VJFB 2FUUA 3U5NA 1LDJB 2FUIA 2H0DB 3U5PA 1WILA 2D8SA 3L1ZB 4C9ZA 3GL6A 4YATA 4YBSA 1U6GB 3PHDA 2KU3A 4NN2A 5H1VA 2L80A 1WEOA 4AYCA 1WIMA 5DKAA 2L43A 5LCWB 5B79A 1LDKC 1RMDA 2JMIA 2F6JA 5D1KB 3RPGB 2F6NA 2VJEB 2ECJA 4P5OB 2UZGA 3ZPVE 5TDWA 1WEEA 2KWKA 1WESA 2ZETC 2KGGA 2E6RA 2K1JA 4WZ3B 3O70A 1JM7B 2YYRA 3U5OA 1VD4A 2MA5A 4Q6FA 2CKLA 4MSXA 4AVXA 2YHOA 3PUQA 3PURA 3QZVA 5C13A 4I7BA 1CHCA 1XWHA 2QICA 2Y1MA 4GNFA 1WEMA 1WEWA 4GNDA 5C11A 2YURA 3O35A 4GNEA 4QF2A 4UP0A 4BBQA 5AIUA 4N3WA 2YHNA 1X4JA 2M1RA 2MUMA 4W4UA 3V43A 2C2VS 2BAYA 2JMJA 2LXPC 4CCGX 5B77A 5J3XA 3LRQA 3NG2A 3KV6A 3N9QA 3O33A 5JG6A 5LKXA 5B8DA 4N4FA 1WENA 5LKTA 2K4DA 2MNYA 4B7YC 5TRBA 5G04B 1ZBDB 1WFKA 4IC2A 4AP4A 3N9MA 3O34A 1DVPA 5B75A 3ZPV1 4MVTA 2RSDA 4V3LC 3KV5A 3LQIA 2XB1A 3N9NA 5D1MB 5LKZA 2MD8C 5B78A 3ZNIA 2LDRA
chains in the Genus database with same CATH superfamily
2L0BA 2ECTA 5AITA 4BHWA 2MNZA 2YVRA 4FIPA 4S3OC 5LKUA 2JRJA 1MM2A 2RI7A 2CT2A 2DJAA 1WGMA 3C5KA 3C6WA 2M85A 3SHBA 3O7AA 4ZUXU 2ECWA 1WEUA 2CRRA 2YW8A 3IHPA 1JM7A 2KWJA 4I7DA 3DPLR 4PTBA 4F52B 2XEUA 5TABA 2PUYA 3T7LA 2KKYA 3E2DA 5FEYA 2LXHC 2IDAA 2KKXA 2KE1A 2MA6A 4LJNA 4YC9A 1Z60A 2L5UA 3ZTGA 1X4IA 3EB5A 4WA6A 4AYCB 4B86C 2JMDA 2K17A 1T1HA 4LADB 1X4UA 3M7KA 2LRIC 1BORA 3EB6A 2ECGA 1Z6UA 2ECVA 2MIQA 4ZDTA 3Q1DA 3SOUA 4I7CA 4WZ0A 2L7PA 3KNVA 2KREA 4V3KC 2YT5A 4R7EA 2B0OE 2NAAA 5B76A 3O47A 1HYJA 3M99A 2P57A 5I3LA 2C2LA 2IQJA 3M63A 1K2FA 3HTKC 3SOXA 2KR4A 4R2YA 3U5MA 2XOYA 3VK6A 5FB1A 1FP0A 4YADA 3MHHA 3ASLA 1DCQA 1FBVA 2YREA 2VJFA 4PPEA 2E61A 2CONA 3FL2A 2YSJA 3I2DA 2Y1NA 2I50A 3N9LA 2ECIA 2VPEA 2EGPA 4L58A 4Z0OA 2EODA 2H0DA 5EYAF 2VPDA 2K16A 5FB0A 2ECNA 4FJCA 2E6SA 2VPBA 2OXQC 4A0CD 3LQJA 4A4BA 2DX8A 4Z0RA 3FJUB 2MD7B 2XOCA 4YAXA 3LVQE 4XI1A 2LV9A 1V87A 3MHSA 3JUEA 3O37A 1WE9A 1F62A 1HYIA 3RTRB 2PNXA 1WEQA 3KQIA 4WZ2A 1E4UA 2KGIA 1WEPA 2RR4A 2VJEA 4X3GA 4YABA 1Z2QA 3RPGC 4O64A 4QF3A 2D8UA 2LGKA 2LN0A 3LDYA 4OGEA 3L11A 4FK5A 3FEHA 2G45A 4QQ4A 4A4CA 3SUBA 2YQMA 4AUQB 2DSMA 3DDTA 4ZQLA 2KWOA 2LAUA 3HCSA 4YBTA 4H9DA 2KYUA 2VP7A 2YUCA 2QJ0A 2JM3A 2M3HA 2EXUA 5SVIB 4S3OB 4LLBA 2YQLA 5TBNA 3T6RA 2KWNA 2LGGA 2LGVA 4TKPB 3ZVZB 3DQVR 3ZVYA 2EA6A 3LQHA 1WEVA 5D1LB 4A49A 3L1XA 2M6MA 3SOWA 1G25A 2F42A 4GNGA 4OGCA 2XOZA 5SVYA 5DINA 2Y43A 4UP5A 2JUNA 3GV4A 1VYXA 3LVRE 4IC3A 3M62A 4CA1A 2CKLB 4F1PA 2VPGA 3PLWA 2YU4A 2G43A 2FD4A 2FFWA 3LJUX 2KFTA 5G05B 4LK9A 1MM3A 2FSAA 4FO9A 3N9OA 5SVXA 2LQ6A 2MT5A 5H9MA 3HCUA 4GB0A 4O62A 1JOCA 4UI9B 2HDPA 2CSYA 1VFYA 3H7HA 5KH3A 5KH7A 2VNFA 1IYMA 2G6QA 2CSZA 5FERA 5H1UA 3ZYQA 2HYED 5H1TA 4LKAA 4R8PK 5G0FA 1N87A 3O36A 3N9PA 2KIZA 3HCTA 5KH9A 2QIZA 3DWDA 2LGLA 3MDBC 2YSMA 2L75A 2AN6A 4YBMA 4L7XA 5TDRA 2VJFB 2FUUA 3U5NA 1LDJB 2FUIA 2H0DB 3U5PA 1WILA 2D8SA 3L1ZB 4C9ZA 3GL6A 4YATA 4YBSA 1U6GB 3PHDA 2KU3A 4NN2A 5H1VA 2L80A 1WEOA 2OWAA 4AYCA 1WIMA 5DKAA 2L43A 5LCWB 5B79A 1LDKC 1RMDA 2JMIA 3FANA 2F6JA 5D1KB 3RPGB 2F6NA 2VJEB 2ECJA 4P5OB 5K3QA 2UZGA 3ZPVE 3KDEC 5TDWA 1WEEA 2KWKA 1WESA 2ZETC 2KGGA 2E6RA 2K1JA 4WZ3B 3O70A 1JM7B 2YYRA 3U5OA 1VD4A 2MA5A 4Q6FA 2CKLA 4MSXA 4AVXA 2YHOA 3PUQA 3PURA 3QZVA 5C13A 4I7BA 1CHCA 1XWHA 2QICA 2Y1MA 4GNFA 1WEMA 2CRWA 1WEWA 4GNDA 5C11A 2YURA 3O35A 4GNEA 4QF2A 4UP0A 4BBQA 5AIUA 4N3WA 2YHNA 1X4JA 2M1RA 2MUMA 4W4UA 3V43A 2C2VS 2BAYA 2JMJA 2LXPC 2MKEA 4CCGX 5B77A 1MBMA 2XP0A 5J3XA 3LRQA 3NG2A 3KV6A 3N9QA 3O33A 2CSVA 5JG6A 5LKXA 5B8DA 4N4FA 1WENA 5LKTA 2K4DA 2MNYA 3FM8C 2EGMA 4B7YC 5TRBA 5G04B 1ZBDB 3FAOA 1WFKA 4IC2A 4AP4A 3N9MA 3O34A 1DVPA 3T9KA 2M13A 5B75A 3ZPV1 4MVTA 2RSDA 4V3LC 3KV5A 3LQIA 2XB1A 3N9NA 5D1MB 5LKZA 5SVIA 2MD8C 5B78A 3ZNIA 2LDRA
chains in the Genus database with same CATH topology
2L0BA 2ECTA 5AITA 4BHWA 2MNZA 4FIPA 4S3OC 5LKUA 2JRJA 1MM2A 2RI7A 2CT2A 1WGMA 3C5KA 3C6WA 2M85A 3SHBA 3O7AA 4ZUXU 2ECWA 1WEUA 2YW8A 3IHPA 1JM7A 2KWJA 4I7DA 3DPLR 4PTBA 4F52B 2XEUA 5TABA 2PUYA 3T7LA 5FEYA 2LXHC 2IDAA 2KE1A 2MA6A 4LJNA 4YC9A 1Z60A 2L5UA 3ZTGA 1X4IA 3EB5A 4WA6A 4AYCB 4B86C 2JMDA 2K17A 1T1HA 4LADB 1X4UA 2LRIC 1BORA 3EB6A 2ECGA 1Z6UA 2ECVA 2MIQA 4ZDTA 3SOUA 4I7CA 4WZ0A 3KNVA 2KREA 4V3KC 2YT5A 4R7EA 2NAAA 5B76A 1HYJA 3M99A 5I3LA 2C2LA 3M63A 1K2FA 3HTKC 3SOXA 2KR4A 4R2YA 3U5MA 3VK6A 5FB1A 1FP0A 4YADA 3MHHA 3ASLA 1FBVA 2YREA 2VJFA 4PPEA 3FL2A 2YSJA 3I2DA 2Y1NA 2I50A 3N9LA 2ECIA 2VPEA 2EGPA 4L58A 2EODA 2H0DA 5EYAF 2VPDA 5FB0A 2K16A 2ECNA 4FJCA 2E6SA 2VPBA 2OXQC 4A0CD 3LQJA 4A4BA 2DX8A 2MD7B 4YAXA 4XI1A 2LV9A 1V87A 3MHSA 3O37A 1WE9A 1F62A 1HYIA 3RTRB 2PNXA 1WEQA 3KQIA 4WZ2A 1E4UA 2KGIA 1WEPA 2VJEA 4X3GA 4YABA 1Z2QA 3RPGC 4O64A 4QF3A 2LGKA 2LN0A 3L11A 4FK5A 2G45A 4A4CA 2YQMA 4AUQB 4ZQLA 2KWOA 3HCSA 4YBTA 2KYUA 2VP7A 2YUCA 2QJ0A 2M3HA 4S3OB 4LLBA 2YQLA 5TBNA 3T6RA 2KWNA 2LGGA 2LGVA 4TKPB 3ZVZB 3DQVR 3ZVYA 2EA6A 3LQHA 1WEVA 5D1LB 4A49A 3L1XA 2M6MA 3SOWA 1G25A 2F42A 4GNGA 5DINA 2Y43A 4UP5A 3GV4A 1VYXA 4IC3A 3M62A 4CA1A 2CKLB 2VPGA 2YU4A 2G43A 2KFTA 5G05B 4LK9A 1MM3A 2FSAA 4FO9A 3N9OA 2LQ6A 2MT5A 5H9MA 3HCUA 4GB0A 1JOCA 4UI9B 2HDPA 2CSYA 1VFYA 5KH3A 5KH7A 2VNFA 1IYMA 2G6QA 2CSZA 5FERA 5H1UA 3ZYQA 2HYED 5H1TA 4LKAA 4R8PK 5G0FA 1N87A 3O36A 3N9PA 2KIZA 3HCTA 5KH9A 2QIZA 2LGLA 2YSMA 2L75A 2AN6A 4YBMA 4L7XA 5TDRA 2VJFB 2FUUA 3U5NA 1LDJB 2FUIA 2H0DB 3U5PA 1WILA 2D8SA 3L1ZB 4C9ZA 3GL6A 4YATA 4YBSA 1U6GB 3PHDA 2KU3A 4NN2A 5H1VA 2L80A 1WEOA 4AYCA 1WIMA 5DKAA 2L43A 5LCWB 5B79A 1LDKC 1RMDA 2JMIA 2F6JA 5D1KB 3RPGB 2F6NA 2VJEB 2ECJA 4P5OB 2UZGA 3ZPVE 5TDWA 1WEEA 2KWKA 1WESA 2ZETC 2KGGA 2E6RA 2K1JA 4WZ3B 3O70A 1JM7B 2YYRA 3U5OA 1VD4A 2MA5A 4Q6FA 2CKLA 4MSXA 4AVXA 2YHOA 3PUQA 3PURA 3QZVA 5C13A 4I7BA 1CHCA 1XWHA 2QICA 2Y1MA 4GNFA 1WEMA 1WEWA 4GNDA 5C11A 2YURA 3O35A 4GNEA 4QF2A 4UP0A 4BBQA 5AIUA 4N3WA 2YHNA 1X4JA 2M1RA 2MUMA 4W4UA 3V43A 2C2VS 2BAYA 2JMJA 2LXPC 4CCGX 5B77A 5J3XA 3LRQA 3NG2A 3KV6A 3N9QA 3O33A 5JG6A 5LKXA 5B8DA 4N4FA 1WENA 5LKTA 2K4DA 2MNYA 4B7YC 5TRBA 5G04B 1ZBDB 1WFKA 4IC2A 4AP4A 3N9MA 3O34A 1DVPA 5B75A 3ZPV1 4MVTA 2RSDA 4V3LC 3KV5A 3LQIA 2XB1A 3N9NA 5D1MB 5LKZA 2MD8C 5B78A 3ZNIA 2LDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0B A;  2ECT A;  5AIT A;  4BHW A;  2MNZ A;  4FIP A;  4S3O C;  5LKU A;  2JRJ A;  1MM2 A;  2RI7 A;  2CT2 A;  1WGM A;  3C5K A;  3C6W A;  2M85 A;  3SHB A;  3O7A A;  4ZUX U;  2ECW A;  1WEU A;  2YW8 A;  3IHP A;  1JM7 A;  2KWJ A;  4I7D A;  3DPL R;  4PTB A;  4F52 B;  2XEU A;  5TAB A;  2PUY A;  3T7L A;  5FEY A;  2LXH C;  2IDA A;  2KE1 A;  2MA6 A;  4LJN A;  4YC9 A;  1Z60 A;  2L5U A;  3ZTG A;  1X4I A;  3EB5 A;  4WA6 A;  4AYC B;  4B86 C;  2JMD A;  2K17 A;  1T1H A;  4LAD B;  1X4U A;  2LRI C;  1BOR A;  3EB6 A;  2ECG A;  1Z6U A;  2ECV A;  2MIQ A;  4ZDT A;  3SOU A;  4I7C A;  4WZ0 A;  3KNV A;  2KRE A;  4V3K C;  2YT5 A;  4R7E A;  2NAA A;  5B76 A;  1HYJ A;  3M99 A;  5I3L A;  2C2L A;  3M63 A;  1K2F A;  3HTK C;  3SOX A;  2KR4 A;  4R2Y A;  3U5M A;  3VK6 A;  5FB1 A;  1FP0 A;  4YAD A;  3MHH A;  3ASL A;  1FBV A;  2YRE A;  2VJF A;  4PPE A;  3FL2 A;  2YSJ A;  3I2D A;  2Y1N A;  2I50 A;  3N9L A;  2ECI A;  2VPE A;  2EGP A;  4L58 A;  2EOD A;  2H0D A;  5EYA F;  2VPD A;  5FB0 A;  2K16 A;  2ECN A;  4FJC A;  2E6S A;  2VPB A;  2OXQ C;  4A0C D;  3LQJ A;  4A4B A;  2DX8 A;  2MD7 B;  4YAX A;  4XI1 A;  2LV9 A;  1V87 A;  3MHS A;  3O37 A;  1WE9 A;  1F62 A;  1HYI A;  3RTR B;  2PNX A;  1WEQ A;  3KQI A;  4WZ2 A;  1E4U A;  2KGI A;  1WEP A;  2VJE A;  4X3G A;  4YAB A;  1Z2Q A;  3RPG C;  4O64 A;  4QF3 A;  2LGK A;  2LN0 A;  3L11 A;  4FK5 A;  2G45 A;  4A4C A;  2YQM A;  4AUQ B;  4ZQL A;  2KWO A;  3HCS A;  4YBT A;  2KYU A;  2VP7 A;  2YUC A;  2QJ0 A;  2M3H A;  4S3O B;  4LLB A;  2YQL A;  5TBN A;  3T6R A;  2KWN A;  2LGG A;  2LGV A;  4TKP B;  3ZVZ B;  3DQV R;  3ZVY A;  2EA6 A;  3LQH A;  1WEV A;  5D1L B;  4A49 A;  3L1X A;  2M6M A;  3SOW A;  1G25 A;  2F42 A;  4GNG A;  5DIN A;  2Y43 A;  4UP5 A;  3GV4 A;  1VYX A;  4IC3 A;  3M62 A;  4CA1 A;  2CKL B;  2VPG A;  2YU4 A;  2G43 A;  2KFT A;  5G05 B;  4LK9 A;  1MM3 A;  2FSA A;  4FO9 A;  3N9O A;  2LQ6 A;  2MT5 A;  5H9M A;  3HCU A;  4GB0 A;  1JOC A;  4UI9 B;  2HDP A;  2CSY A;  1VFY A;  5KH3 A;  5KH7 A;  2VNF A;  1IYM A;  2G6Q A;  2CSZ A;  5FER A;  5H1U A;  3ZYQ A;  2HYE D;  5H1T A;  4LKA A;  4R8P K;  5G0F A;  1N87 A;  3O36 A;  3N9P A;  2KIZ A;  3HCT A;  5KH9 A;  2QIZ A;  2LGL A;  2YSM A;  2L75 A;  2AN6 A;  4YBM A;  4L7X A;  5TDR A;  2VJF B;  2FUU A;  3U5N A;  1LDJ B;  2FUI A;  2H0D B;  3U5P A;  1WIL A;  2D8S A;  3L1Z B;  4C9Z A;  3GL6 A;  4YAT A;  4YBS A;  1U6G B;  3PHD A;  2KU3 A;  4NN2 A;  5H1V A;  2L80 A;  1WEO A;  4AYC A;  1WIM A;  5DKA A;  2L43 A;  5LCW B;  5B79 A;  1LDK C;  1RMD A;  2JMI A;  2F6J A;  5D1K B;  3RPG B;  2F6N A;  2VJE B;  2ECJ A;  4P5O B;  2UZG A;  3ZPV E;  5TDW A;  1WEE A;  2KWK A;  1WES A;  2ZET C;  2KGG A;  2E6R A;  2K1J A;  4WZ3 B;  3O70 A;  1JM7 B;  2YYR A;  3U5O A;  1VD4 A;  2MA5 A;  4Q6F A;  2CKL A;  4MSX A;  4AVX A;  2YHO A;  3PUQ A;  3PUR A;  3QZV A;  5C13 A;  4I7B A;  1CHC A;  1XWH A;  2QIC A;  2Y1M A;  4GNF A;  1WEM A;  1WEW A;  4GND A;  5C11 A;  2YUR A;  3O35 A;  4GNE A;  4QF2 A;  4UP0 A;  4BBQ A;  5AIU A;  4N3W A;  2YHN A;  1X4J A;  2M1R A;  2MUM A;  4W4U A;  3V43 A;  2C2V S;  2BAY A;  2JMJ A;  2LXP C;  4CCG X;  5B77 A;  5J3X A;  3LRQ A;  3NG2 A;  3KV6 A;  3N9Q A;  3O33 A;  5JG6 A;  5LKX A;  5B8D A;  4N4F A;  1WEN A;  5LKT A;  2K4D A;  2MNY A;  4B7Y C;  5TRB A;  5G04 B;  1ZBD B;  1WFK A;  4IC2 A;  4AP4 A;  3N9M A;  3O34 A;  1DVP A;  5B75 A;  3ZPV 1;  4MVT A;  2RSD A;  4V3L C;  3KV5 A;  3LQI A;  2XB1 A;  3N9N A;  5D1M B;  5LKZ A;  2MD8 C;  5B78 A;  3ZNI A;  2LDR A; 
#chains in the Genus database with same CATH topology
 2L0B A;  2ECT A;  5AIT A;  4BHW A;  2MNZ A;  2YVR A;  4FIP A;  4S3O C;  5LKU A;  2JRJ A;  1MM2 A;  2RI7 A;  2CT2 A;  2DJA A;  1WGM A;  3C5K A;  3C6W A;  2M85 A;  3SHB A;  3O7A A;  4ZUX U;  2ECW A;  1WEU A;  2CRR A;  2YW8 A;  3IHP A;  1JM7 A;  2KWJ A;  4I7D A;  3DPL R;  4PTB A;  4F52 B;  2XEU A;  5TAB A;  2PUY A;  3T7L A;  2KKY A;  3E2D A;  5FEY A;  2LXH C;  2IDA A;  2KKX A;  2KE1 A;  2MA6 A;  4LJN A;  4YC9 A;  1Z60 A;  2L5U A;  3ZTG A;  1X4I A;  3EB5 A;  4WA6 A;  4AYC B;  4B86 C;  2JMD A;  2K17 A;  1T1H A;  4LAD B;  1X4U A;  3M7K A;  2LRI C;  1BOR A;  3EB6 A;  2ECG A;  1Z6U A;  2ECV A;  2MIQ A;  4ZDT A;  3Q1D A;  3SOU A;  4I7C A;  4WZ0 A;  2L7P A;  3KNV A;  2KRE A;  4V3K C;  2YT5 A;  4R7E A;  2B0O E;  2NAA A;  5B76 A;  3O47 A;  1HYJ A;  3M99 A;  2P57 A;  5I3L A;  2C2L A;  2IQJ A;  3M63 A;  1K2F A;  3HTK C;  3SOX A;  2KR4 A;  4R2Y A;  3U5M A;  2XOY A;  3VK6 A;  5FB1 A;  1FP0 A;  4YAD A;  3MHH A;  3ASL A;  1DCQ A;  1FBV A;  2YRE A;  2VJF A;  4PPE A;  2E61 A;  2CON A;  3FL2 A;  2YSJ A;  3I2D A;  2Y1N A;  2I50 A;  3N9L A;  2ECI A;  2VPE A;  2EGP A;  4L58 A;  4Z0O A;  2EOD A;  2H0D A;  5EYA F;  2VPD A;  2K16 A;  5FB0 A;  2ECN A;  4FJC A;  2E6S A;  2VPB A;  2OXQ C;  4A0C D;  3LQJ A;  4A4B A;  2DX8 A;  4Z0R A;  3FJU B;  2MD7 B;  2XOC A;  4YAX A;  3LVQ E;  4XI1 A;  2LV9 A;  1V87 A;  3MHS A;  3JUE A;  3O37 A;  1WE9 A;  1F62 A;  1HYI A;  3RTR B;  2PNX A;  1WEQ A;  3KQI A;  4WZ2 A;  1E4U A;  2KGI A;  1WEP A;  2RR4 A;  2VJE A;  4X3G A;  4YAB A;  1Z2Q A;  3RPG C;  4O64 A;  4QF3 A;  2D8U A;  2LGK A;  2LN0 A;  3LDY A;  4OGE A;  3L11 A;  4FK5 A;  3FEH A;  2G45 A;  4QQ4 A;  4A4C A;  3SUB A;  2YQM A;  4AUQ B;  2DSM A;  3DDT A;  4ZQL A;  2KWO A;  2LAU A;  3HCS A;  4YBT A;  4H9D A;  2KYU A;  2VP7 A;  2YUC A;  2QJ0 A;  2JM3 A;  2M3H A;  2EXU A;  5SVI B;  4S3O B;  4LLB A;  2YQL A;  5TBN A;  3T6R A;  2KWN A;  2LGG A;  2LGV A;  4TKP B;  3ZVZ B;  3DQV R;  3ZVY A;  2EA6 A;  3LQH A;  1WEV A;  5D1L B;  4A49 A;  3L1X A;  2M6M A;  3SOW A;  1G25 A;  2F42 A;  4GNG A;  4OGC A;  2XOZ A;  5SVY A;  5DIN A;  2Y43 A;  4UP5 A;  2JUN A;  3GV4 A;  1VYX A;  3LVR E;  4IC3 A;  3M62 A;  4CA1 A;  2CKL B;  4F1P A;  2VPG A;  3PLW A;  2YU4 A;  2G43 A;  2FD4 A;  2FFW A;  3LJU X;  2KFT A;  5G05 B;  4LK9 A;  1MM3 A;  2FSA A;  4FO9 A;  3N9O A;  5SVX A;  2LQ6 A;  2MT5 A;  5H9M A;  3HCU A;  4GB0 A;  4O62 A;  1JOC A;  4UI9 B;  2HDP A;  2CSY A;  1VFY A;  3H7H A;  5KH3 A;  5KH7 A;  2VNF A;  1IYM A;  2G6Q A;  2CSZ A;  5FER A;  5H1U A;  3ZYQ A;  2HYE D;  5H1T A;  4LKA A;  4R8P K;  5G0F A;  1N87 A;  3O36 A;  3N9P A;  2KIZ A;  3HCT A;  5KH9 A;  2QIZ A;  3DWD A;  2LGL A;  3MDB C;  2YSM A;  2L75 A;  2AN6 A;  4YBM A;  4L7X A;  5TDR A;  2VJF B;  2FUU A;  3U5N A;  1LDJ B;  2FUI A;  2H0D B;  3U5P A;  1WIL A;  2D8S A;  3L1Z B;  4C9Z A;  3GL6 A;  4YAT A;  4YBS A;  1U6G B;  3PHD A;  2KU3 A;  4NN2 A;  5H1V A;  2L80 A;  1WEO A;  2OWA A;  4AYC A;  1WIM A;  5DKA A;  2L43 A;  5LCW B;  5B79 A;  1LDK C;  1RMD A;  2JMI A;  3FAN A;  2F6J A;  5D1K B;  3RPG B;  2F6N A;  2VJE B;  2ECJ A;  4P5O B;  5K3Q A;  2UZG A;  3ZPV E;  3KDE C;  5TDW A;  1WEE A;  2KWK A;  1WES A;  2ZET C;  2KGG A;  2E6R A;  2K1J A;  4WZ3 B;  3O70 A;  1JM7 B;  2YYR A;  3U5O A;  1VD4 A;  2MA5 A;  4Q6F A;  2CKL A;  4MSX A;  4AVX A;  2YHO A;  3PUQ A;  3PUR A;  3QZV A;  5C13 A;  4I7B A;  1CHC A;  1XWH A;  2QIC A;  2Y1M A;  4GNF A;  1WEM A;  2CRW A;  1WEW A;  4GND A;  5C11 A;  2YUR A;  3O35 A;  4GNE A;  4QF2 A;  4UP0 A;  4BBQ A;  5AIU A;  4N3W A;  2YHN A;  1X4J A;  2M1R A;  2MUM A;  4W4U A;  3V43 A;  2C2V S;  2BAY A;  2JMJ A;  2LXP C;  2MKE A;  4CCG X;  5B77 A;  1MBM A;  2XP0 A;  5J3X A;  3LRQ A;  3NG2 A;  3KV6 A;  3N9Q A;  3O33 A;  2CSV A;  5JG6 A;  5LKX A;  5B8D A;  4N4F A;  1WEN A;  5LKT A;  2K4D A;  2MNY A;  3FM8 C;  2EGM A;  4B7Y C;  5TRB A;  5G04 B;  1ZBD B;  3FAO A;  1WFK A;  4IC2 A;  4AP4 A;  3N9M A;  3O34 A;  1DVP A;  3T9K A;  2M13 A;  5B75 A;  3ZPV 1;  4MVT A;  2RSD A;  4V3L C;  3KV5 A;  3LQI A;  2XB1 A;  3N9N A;  5D1M B;  5LKZ A;  5SVI A;  2MD8 C;  5B78 A;  3ZNI A;  2LDR A; 
#chains in the Genus database with same CATH homology
 2L0B A;  2ECT A;  5AIT A;  4BHW A;  2MNZ A;  4FIP A;  4S3O C;  5LKU A;  2JRJ A;  1MM2 A;  2RI7 A;  2CT2 A;  1WGM A;  3C5K A;  3C6W A;  2M85 A;  3SHB A;  3O7A A;  4ZUX U;  2ECW A;  1WEU A;  2YW8 A;  3IHP A;  1JM7 A;  2KWJ A;  4I7D A;  3DPL R;  4PTB A;  4F52 B;  2XEU A;  5TAB A;  2PUY A;  3T7L A;  5FEY A;  2LXH C;  2IDA A;  2KE1 A;  2MA6 A;  4LJN A;  4YC9 A;  1Z60 A;  2L5U A;  3ZTG A;  1X4I A;  3EB5 A;  4WA6 A;  4AYC B;  4B86 C;  2JMD A;  2K17 A;  1T1H A;  4LAD B;  1X4U A;  2LRI C;  1BOR A;  3EB6 A;  2ECG A;  1Z6U A;  2ECV A;  2MIQ A;  4ZDT A;  3SOU A;  4I7C A;  4WZ0 A;  3KNV A;  2KRE A;  4V3K C;  2YT5 A;  4R7E A;  2NAA A;  5B76 A;  1HYJ A;  3M99 A;  5I3L A;  2C2L A;  3M63 A;  1K2F A;  3HTK C;  3SOX A;  2KR4 A;  4R2Y A;  3U5M A;  3VK6 A;  5FB1 A;  1FP0 A;  4YAD A;  3MHH A;  3ASL A;  1FBV A;  2YRE A;  2VJF A;  4PPE A;  3FL2 A;  2YSJ A;  3I2D A;  2Y1N A;  2I50 A;  3N9L A;  2ECI A;  2VPE A;  2EGP A;  4L58 A;  2EOD A;  2H0D A;  5EYA F;  2VPD A;  5FB0 A;  2K16 A;  2ECN A;  4FJC A;  2E6S A;  2VPB A;  2OXQ C;  4A0C D;  3LQJ A;  4A4B A;  2DX8 A;  2MD7 B;  4YAX A;  4XI1 A;  2LV9 A;  1V87 A;  3MHS A;  3O37 A;  1WE9 A;  1F62 A;  1HYI A;  3RTR B;  2PNX A;  1WEQ A;  3KQI A;  4WZ2 A;  1E4U A;  2KGI A;  1WEP A;  2VJE A;  4X3G A;  4YAB A;  1Z2Q A;  3RPG C;  4O64 A;  4QF3 A;  2LGK A;  2LN0 A;  3L11 A;  4FK5 A;  2G45 A;  4A4C A;  2YQM A;  4AUQ B;  4ZQL A;  2KWO A;  3HCS A;  4YBT A;  2KYU A;  2VP7 A;  2YUC A;  2QJ0 A;  2M3H A;  4S3O B;  4LLB A;  2YQL A;  5TBN A;  3T6R A;  2KWN A;  2LGG A;  2LGV A;  4TKP B;  3ZVZ B;  3DQV R;  3ZVY A;  2EA6 A;  3LQH A;  1WEV A;  5D1L B;  4A49 A;  3L1X A;  2M6M A;  3SOW A;  1G25 A;  2F42 A;  4GNG A;  5DIN A;  2Y43 A;  4UP5 A;  3GV4 A;  1VYX A;  4IC3 A;  3M62 A;  4CA1 A;  2CKL B;  2VPG A;  2YU4 A;  2G43 A;  2KFT A;  5G05 B;  4LK9 A;  1MM3 A;  2FSA A;  4FO9 A;  3N9O A;  2LQ6 A;  2MT5 A;  5H9M A;  3HCU A;  4GB0 A;  1JOC A;  4UI9 B;  2HDP A;  2CSY A;  1VFY A;  5KH3 A;  5KH7 A;  2VNF A;  1IYM A;  2G6Q A;  2CSZ A;  5FER A;  5H1U A;  3ZYQ A;  2HYE D;  5H1T A;  4LKA A;  4R8P K;  5G0F A;  1N87 A;  3O36 A;  3N9P A;  2KIZ A;  3HCT A;  5KH9 A;  2QIZ A;  2LGL A;  2YSM A;  2L75 A;  2AN6 A;  4YBM A;  4L7X A;  5TDR A;  2VJF B;  2FUU A;  3U5N A;  1LDJ B;  2FUI A;  2H0D B;  3U5P A;  1WIL A;  2D8S A;  3L1Z B;  4C9Z A;  3GL6 A;  4YAT A;  4YBS A;  1U6G B;  3PHD A;  2KU3 A;  4NN2 A;  5H1V A;  2L80 A;  1WEO A;  4AYC A;  1WIM A;  5DKA A;  2L43 A;  5LCW B;  5B79 A;  1LDK C;  1RMD A;  2JMI A;  2F6J A;  5D1K B;  3RPG B;  2F6N A;  2VJE B;  2ECJ A;  4P5O B;  2UZG A;  3ZPV E;  5TDW A;  1WEE A;  2KWK A;  1WES A;  2ZET C;  2KGG A;  2E6R A;  2K1J A;  4WZ3 B;  3O70 A;  1JM7 B;  2YYR A;  3U5O A;  1VD4 A;  2MA5 A;  4Q6F A;  2CKL A;  4MSX A;  4AVX A;  2YHO A;  3PUQ A;  3PUR A;  3QZV A;  5C13 A;  4I7B A;  1CHC A;  1XWH A;  2QIC A;  2Y1M A;  4GNF A;  1WEM A;  1WEW A;  4GND A;  5C11 A;  2YUR A;  3O35 A;  4GNE A;  4QF2 A;  4UP0 A;  4BBQ A;  5AIU A;  4N3W A;  2YHN A;  1X4J A;  2M1R A;  2MUM A;  4W4U A;  3V43 A;  2C2V S;  2BAY A;  2JMJ A;  2LXP C;  4CCG X;  5B77 A;  5J3X A;  3LRQ A;  3NG2 A;  3KV6 A;  3N9Q A;  3O33 A;  5JG6 A;  5LKX A;  5B8D A;  4N4F A;  1WEN A;  5LKT A;  2K4D A;  2MNY A;  4B7Y C;  5TRB A;  5G04 B;  1ZBD B;  1WFK A;  4IC2 A;  4AP4 A;  3N9M A;  3O34 A;  1DVP A;  5B75 A;  3ZPV 1;  4MVT A;  2RSD A;  4V3L C;  3KV5 A;  3LQI A;  2XB1 A;  3N9N A;  5D1M B;  5LKZ A;  2MD8 C;  5B78 A;  3ZNI A;  2LDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...