3ZPV1

Crystal structure of drosophila pygo phd finger in complex with legless hd1 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
GAMAIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evolutionary Adaptation of the Fly Pygo Phd Finger Towards Recognizing Histone H3 Tail Methylated at Arginine 2
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords PROTEIN BCL9 HOMOLOG
total genus 10
structure length 62
sequence length 62
chains with identical sequence 3, 5, 7, 9, A, C, G, I, K, M, Q, S, U, W
ec nomenclature
pdb deposition date 2013-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zpv100
1WEMA 1WEWA 5KH9A 3SOWA 2VJFA 3VK6A 1ZBDB 2YSJA 2MD7B 5B75A 4A0CD 3PUQA 3KNVA 1WEOA 1Z60A 3SOXA 1IYMA 4S3OC 4YC9A 3MHSA 2M85A 3ZVYA 5H9MA 1WEEA 3M62A 2MA5A 4ZUXU 5H1TA 5B78A 2YQMA 4GNFA 2Y43A 2H0DA 1WGMA 3LQHA 2MUMA 1F62A 2LQ6A 2ECWA 5G04B 2YSMA 4GNGA 4R2YA 2BAYA 2RSDA 4YBMA 2K16A 4XI1A 3N9QA 2ECGA 5KH3A 4O64A 3N9OA 3O35A 2PNXA 2KE1A 1WIMA 5B8DA 1Z6UA 2CKLA 1K2FA 3T7LA 4AUQB 2JMJA 5D1MB 1MM2A 2KIZA 4WZ2A 3LQIA 4WZ3B 2KU3A 2VJFB 5D1KB 2VPBA 4AYCB 4W4UA 5EYAF 4YATA 3I2DA 4YADA 1CHCA 2HYED 2K17A 4C9ZA 5FERA 2NAAA 2YHOA 5B79A 3EB5A 1JM7A 4V3KC 2EA6A 4FO9A 3KV6A 2H0DB 4I7BA 3PHDA 2Y1NA 3NG2A 4LLBA 5J3XA 4R7EA 2K4DA 1VD4A 2QJ0A 2E6SA 5TDRA 4UP0A 4A49A 5H1UA 3N9NA 2VJEB 2DX8A 2IDAA 2YU4A 5LKTA 2XEUA 3GV4A 1HYJA 2M6MA 2KFTA 4GNEA 4S3OB 2YT5A 3IHPA 2EGPA 4PTBA 2MT5A 2MD8C 4F52B 2I50A 3M63A 2KREA 2MIQA 3DQVR 1X4UA 5FB0A 5TDWA 1LDKC 2YREA 1DVPA 2CSYA 2KWKA 2L75A 3ZNIA 2K1JA 2YW8A 4WA6A 2KWJA 2Y1MA 5LKXA 1X4IA 2KGGA 2E6RA 5DKAA 2LXPC 1XWHA 2KGIA 3U5PA 2CKLB 3ZPVE 2F6JA 5D1LB 4N4FA 3N9MA 5DINA 3FL2A 3L1ZB 2VP7A 2FUUA 5G0FA 2VJEA 5C11A 2PUYA 2LGKA 1V87A 2HDPA 2L0BA 3C6WA 2YYRA 1HYIA 4BBQA 3EB6A 3O37A 4X3GA 2VPDA 3LRQA 4Q6FA 1G25A 4ZQLA 4I7DA 2YQLA 4L7XA 2QICA 3RPGB 3GL6A 2G6QA 1WESA 4AYCA 2VNFA 2ECTA 2F6NA 3N9PA 1T1HA 2KYUA 2EODA 2MA6A 1WENA 3O7AA 1JM7B 3U5OA 3ZYQA 4FIPA 4N3WA 1WE9A 3M99A 1LDJB 2XB1A 2YURA 5B76A 1Z2QA 2ECIA 3PURA 3O70A 5FB1A 2RI7A 4B7YC 2MNZA 5JG6A 5TABA 5G05B 2LXHC 5AITA 3KV5A 2AN6A 4TKPB 2JMIA 3SHBA 3HTKC 4CA1A 1U6GB 1N87A 2L80A 5I3LA 2CT2A 5TRBA 2YHNA 4LK9A 3T6RA 2CSZA 1FBVA 3O34A 1X4JA 3HCTA 3O33A 4A4CA 4B86C 3V43A 1WEPA 2C2VS 4PPEA 2KWOA 3HCSA 1BORA 1VYXA 2VPEA 4YBTA 4LJNA 4QF3A 2UZGA 2YUCA 2LN0A 2MNYA 4NN2A 4MSXA 3QZVA 5H1VA 2KR4A 2G45A 4P5OB 2OXQC 3L1XA 5AIUA 2LRIC 2QIZA 3ZVZB 1E4UA 2JMDA 1VFYA 2FSAA 4LKAA 2FUIA 2LDRA 3ASLA 4GB0A 2LGVA 3ZTGA 4UI9B 4FK5A 4YABA 4AVXA 3O36A 5LCWB 3N9LA 4WZ0A 2C2LA 3HCUA 4IC2A 4YAXA 4R8PK 5LKUA 5B77A 2ECNA 5LKZA 2JRJA 3LQJA 1WFKA 3U5MA 4QF2A 2KWNA 4LADB 4FJCA 1WILA 1FP0A 2ECVA 4MVTA 1RMDA 3RPGC 5C13A 2G43A 3KQIA 4I7CA 2LGLA 3C5KA 3DPLR 4BHWA 4CCGX 2ZETC 3RTRB 2VPGA 4GNDA 4ZDTA 2L5UA 2ECJA 4IC3A 4A4BA 4V3LC 3U5NA 4AP4A 1WEUA 3ZPV1 2LV9A 1WEQA 2LGGA 4L58A 2M1RA 5FEYA 3SOUA 3L11A 2L43A 5KH7A 5TBNA 1MM3A 2F42A 2M3HA 4YBSA 2D8SA 4UP5A 3MHHA 1WEVA 1JOCA
chains in the Genus database with same CATH superfamily
1WEMA 1WEWA 4Z0OA 5KH9A 3SOWA 2VJFA 3VK6A 1ZBDB 2YSJA 2MD7B 5B75A 2XOZA 4A0CD 3PUQA 3Q1DA 2E61A 3KNVA 1WEOA 1Z60A 3SOXA 1IYMA 4S3OC 4YC9A 3MHSA 3SUBA 2M85A 3ZVYA 5H9MA 1WEEA 3M62A 2MA5A 4ZUXU 5H1TA 5B78A 2CONA 2YQMA 3PLWA 4GNFA 2Y43A 2H0DA 1WGMA 3LQHA 2MUMA 1F62A 2LAUA 2LQ6A 2ECWA 5G04B 2YSMA 4GNGA 4R2YA 2BAYA 2RSDA 4YBMA 2K16A 4XI1A 3N9QA 2ECGA 5KH3A 4O64A 3N9OA 3O35A 2PNXA 2KE1A 1WIMA 5B8DA 1Z6UA 2CKLA 1K2FA 3T7LA 4AUQB 2JMJA 5D1MB 2CRWA 1MM2A 2KIZA 4WZ2A 3O47A 3LQIA 4WZ3B 2KU3A 2VJFB 5D1KB 2VPBA 4H9DA 4AYCB 4W4UA 5EYAF 5SVXA 4YATA 3I2DA 2DSMA 4YADA 1CHCA 2HYED 2K17A 4C9ZA 5FERA 2NAAA 2YHOA 5B79A 3EB5A 1JM7A 4V3KC 2EA6A 4FO9A 3KV6A 2H0DB 4I7BA 3PHDA 2Y1NA 3NG2A 4LLBA 5J3XA 3KDEC 4R7EA 3LJUX 2K4DA 1VD4A 2QJ0A 2E6SA 5TDRA 4UP0A 4A49A 5H1UA 3N9NA 2VJEB 2DX8A 2IDAA 2YU4A 5LKTA 3FANA 3E2DA 2CRRA 2XEUA 3GV4A 1HYJA 2M6MA 2KFTA 4GNEA 4QQ4A 4S3OB 2YT5A 3IHPA 2EGPA 4PTBA 4OGEA 2MT5A 2MD8C 4F52B 2I50A 3M63A 2KREA 2MIQA 3DQVR 1X4UA 5FB0A 5TDWA 3M7KA 1LDKC 2YREA 1DVPA 2CSYA 2KWKA 2L75A 2YVRA 3ZNIA 2K1JA 2YW8A 4WA6A 2KWJA 2Y1MA 2OWAA 5LKXA 1X4IA 2FD4A 2KGGA 2E6RA 5DKAA 2LXPC 1XWHA 2KGIA 3U5PA 2CKLB 3ZPVE 5K3QA 3JUEA 2F6JA 5D1LB 4N4FA 3N9MA 5DINA 4F1PA 3FL2A 3L1ZB 2VP7A 2FUUA 5G0FA 5SVYA 2VJEA 5C11A 2PUYA 2LGKA 1V87A 2HDPA 2L0BA 3C6WA 2YYRA 1HYIA 4BBQA 3EB6A 2XOCA 3O37A 4X3GA 2VPDA 3LRQA 1DCQA 4Q6FA 1G25A 4ZQLA 3DWDA 4I7DA 2YQLA 4L7XA 2QICA 3RPGB 3GL6A 2JM3A 2G6QA 1WESA 4AYCA 2VNFA 2ECTA 2F6NA 3N9PA 1T1HA 3T9KA 2JUNA 2KYUA 2EODA 2CSVA 2MA6A 1WENA 2RR4A 4O62A 3O7AA 1JM7B 2EXUA 3U5OA 3ZYQA 4FIPA 4N3WA 1WE9A 2XP0A 3M99A 1LDJB 2XB1A 2YURA 5B76A 1Z2QA 2ECIA 3PURA 3O70A 5FB1A 2RI7A 4B7YC 2MNZA 2MKEA 5JG6A 5TABA 5G05B 2LXHC 5AITA 3KV5A 2AN6A 4TKPB 1MBMA 2IQJA 2JMIA 3SHBA 3LVQE 3HTKC 4CA1A 1U6GB 1N87A 3FJUB 2L80A 5I3LA 2CT2A 5TRBA 2YHNA 4LK9A 3T6RA 2CSZA 1FBVA 3O34A 1X4JA 3HCTA 4Z0RA 2EGMA 3O33A 4A4CA 4B86C 3V43A 1WEPA 2C2VS 4PPEA 2KWOA 3HCSA 1BORA 1VYXA 2FFWA 2VPEA 4YBTA 3FM8C 2KKYA 3FEHA 4LJNA 4QF3A 2UZGA 2YUCA 2LN0A 2MNYA 4NN2A 4MSXA 3QZVA 5H1VA 3LVRE 2KR4A 2G45A 4P5OB 2B0OE 5SVIB 2OXQC 3L1XA 5AIUA 2LRIC 2QIZA 3ZVZB 1E4UA 2JMDA 1VFYA 2FSAA 4LKAA 2FUIA 2LDRA 3ASLA 4GB0A 2LGVA 3ZTGA 3DDTA 2L7PA 4UI9B 4FK5A 2M13A 3MDBC 2DJAA 5SVIA 4YABA 4AVXA 3O36A 5LCWB 3N9LA 4WZ0A 2C2LA 3HCUA 4IC2A 4YAXA 4R8PK 5LKUA 5B77A 2ECNA 5LKZA 2JRJA 2KKXA 3LQJA 1WFKA 3U5MA 4QF2A 2KWNA 4LADB 4FJCA 1WILA 1FP0A 2ECVA 4MVTA 1RMDA 3RPGC 5C13A 2G43A 3KQIA 4I7CA 2LGLA 3C5KA 3DPLR 4BHWA 4CCGX 2ZETC 3RTRB 2VPGA 4GNDA 4ZDTA 2L5UA 2ECJA 4IC3A 4A4BA 4V3LC 3U5NA 4AP4A 2P57A 1WEUA 4OGCA 3ZPV1 2XOYA 2LV9A 1WEQA 2LGGA 4L58A 3FAOA 2M1RA 2D8UA 5FEYA 3SOUA 3LDYA 3L11A 2L43A 5KH7A 5TBNA 1MM3A 2F42A 2M3HA 4YBSA 2D8SA 4UP5A 3MHHA 1WEVA 3H7HA 1JOCA
chains in the Genus database with same CATH topology
1WEMA 1WEWA 5KH9A 3SOWA 2VJFA 3VK6A 1ZBDB 2YSJA 2MD7B 5B75A 4A0CD 3PUQA 3KNVA 1WEOA 1Z60A 3SOXA 1IYMA 4S3OC 4YC9A 3MHSA 2M85A 3ZVYA 5H9MA 1WEEA 3M62A 2MA5A 4ZUXU 5H1TA 5B78A 2YQMA 4GNFA 2Y43A 2H0DA 1WGMA 3LQHA 2MUMA 1F62A 2LQ6A 2ECWA 5G04B 2YSMA 4GNGA 4R2YA 2BAYA 2RSDA 4YBMA 2K16A 4XI1A 3N9QA 2ECGA 5KH3A 4O64A 3N9OA 3O35A 2PNXA 2KE1A 1WIMA 5B8DA 1Z6UA 2CKLA 1K2FA 3T7LA 4AUQB 2JMJA 5D1MB 1MM2A 2KIZA 4WZ2A 3LQIA 4WZ3B 2KU3A 2VJFB 5D1KB 2VPBA 4AYCB 4W4UA 5EYAF 4YATA 3I2DA 4YADA 1CHCA 2HYED 2K17A 4C9ZA 5FERA 2NAAA 2YHOA 5B79A 3EB5A 1JM7A 4V3KC 2EA6A 4FO9A 3KV6A 2H0DB 4I7BA 3PHDA 2Y1NA 3NG2A 4LLBA 5J3XA 4R7EA 2K4DA 1VD4A 2QJ0A 2E6SA 5TDRA 4UP0A 4A49A 5H1UA 3N9NA 2VJEB 2DX8A 2IDAA 2YU4A 5LKTA 2XEUA 3GV4A 1HYJA 2M6MA 2KFTA 4GNEA 4S3OB 2YT5A 3IHPA 2EGPA 4PTBA 2MT5A 2MD8C 4F52B 2I50A 3M63A 2KREA 2MIQA 3DQVR 1X4UA 5FB0A 5TDWA 1LDKC 2YREA 1DVPA 2CSYA 2KWKA 2L75A 3ZNIA 2K1JA 2YW8A 4WA6A 2KWJA 2Y1MA 5LKXA 1X4IA 2KGGA 2E6RA 5DKAA 2LXPC 1XWHA 2KGIA 3U5PA 2CKLB 3ZPVE 2F6JA 5D1LB 4N4FA 3N9MA 5DINA 3FL2A 3L1ZB 2VP7A 2FUUA 5G0FA 2VJEA 5C11A 2PUYA 2LGKA 1V87A 2HDPA 2L0BA 3C6WA 2YYRA 1HYIA 4BBQA 3EB6A 3O37A 4X3GA 2VPDA 3LRQA 4Q6FA 1G25A 4ZQLA 4I7DA 2YQLA 4L7XA 2QICA 3RPGB 3GL6A 2G6QA 1WESA 4AYCA 2VNFA 2ECTA 2F6NA 3N9PA 1T1HA 2KYUA 2EODA 2MA6A 1WENA 3O7AA 1JM7B 3U5OA 3ZYQA 4FIPA 4N3WA 1WE9A 3M99A 1LDJB 2XB1A 2YURA 5B76A 1Z2QA 2ECIA 3PURA 3O70A 5FB1A 2RI7A 4B7YC 2MNZA 5JG6A 5TABA 5G05B 2LXHC 5AITA 3KV5A 2AN6A 4TKPB 2JMIA 3SHBA 3HTKC 4CA1A 1U6GB 1N87A 2L80A 5I3LA 2CT2A 5TRBA 2YHNA 4LK9A 3T6RA 2CSZA 1FBVA 3O34A 1X4JA 3HCTA 3O33A 4A4CA 4B86C 3V43A 1WEPA 2C2VS 4PPEA 2KWOA 3HCSA 1BORA 1VYXA 2VPEA 4YBTA 4LJNA 4QF3A 2UZGA 2YUCA 2LN0A 2MNYA 4NN2A 4MSXA 3QZVA 5H1VA 2KR4A 2G45A 4P5OB 2OXQC 3L1XA 5AIUA 2LRIC 2QIZA 3ZVZB 1E4UA 2JMDA 1VFYA 2FSAA 4LKAA 2FUIA 2LDRA 3ASLA 4GB0A 2LGVA 3ZTGA 4UI9B 4FK5A 4YABA 4AVXA 3O36A 5LCWB 3N9LA 4WZ0A 2C2LA 3HCUA 4IC2A 4YAXA 4R8PK 5LKUA 5B77A 2ECNA 5LKZA 2JRJA 3LQJA 1WFKA 3U5MA 4QF2A 2KWNA 4LADB 4FJCA 1WILA 1FP0A 2ECVA 4MVTA 1RMDA 3RPGC 5C13A 2G43A 3KQIA 4I7CA 2LGLA 3C5KA 3DPLR 4BHWA 4CCGX 2ZETC 3RTRB 2VPGA 4GNDA 4ZDTA 2L5UA 2ECJA 4IC3A 4A4BA 4V3LC 3U5NA 4AP4A 1WEUA 3ZPV1 2LV9A 1WEQA 2LGGA 4L58A 2M1RA 5FEYA 3SOUA 3L11A 2L43A 5KH7A 5TBNA 1MM3A 2F42A 2M3HA 4YBSA 2D8SA 4UP5A 3MHHA 1WEVA 1JOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEM A;  1WEW A;  5KH9 A;  3SOW A;  2VJF A;  3VK6 A;  1ZBD B;  2YSJ A;  2MD7 B;  5B75 A;  4A0C D;  3PUQ A;  3KNV A;  1WEO A;  1Z60 A;  3SOX A;  1IYM A;  4S3O C;  4YC9 A;  3MHS A;  2M85 A;  3ZVY A;  5H9M A;  1WEE A;  3M62 A;  2MA5 A;  4ZUX U;  5H1T A;  5B78 A;  2YQM A;  4GNF A;  2Y43 A;  2H0D A;  1WGM A;  3LQH A;  2MUM A;  1F62 A;  2LQ6 A;  2ECW A;  5G04 B;  2YSM A;  4GNG A;  4R2Y A;  2BAY A;  2RSD A;  4YBM A;  2K16 A;  4XI1 A;  3N9Q A;  2ECG A;  5KH3 A;  4O64 A;  3N9O A;  3O35 A;  2PNX A;  2KE1 A;  1WIM A;  5B8D A;  1Z6U A;  2CKL A;  1K2F A;  3T7L A;  4AUQ B;  2JMJ A;  5D1M B;  1MM2 A;  2KIZ A;  4WZ2 A;  3LQI A;  4WZ3 B;  2KU3 A;  2VJF B;  5D1K B;  2VPB A;  4AYC B;  4W4U A;  5EYA F;  4YAT A;  3I2D A;  4YAD A;  1CHC A;  2HYE D;  2K17 A;  4C9Z A;  5FER A;  2NAA A;  2YHO A;  5B79 A;  3EB5 A;  1JM7 A;  4V3K C;  2EA6 A;  4FO9 A;  3KV6 A;  2H0D B;  4I7B A;  3PHD A;  2Y1N A;  3NG2 A;  4LLB A;  5J3X A;  4R7E A;  2K4D A;  1VD4 A;  2QJ0 A;  2E6S A;  5TDR A;  4UP0 A;  4A49 A;  5H1U A;  3N9N A;  2VJE B;  2DX8 A;  2IDA A;  2YU4 A;  5LKT A;  2XEU A;  3GV4 A;  1HYJ A;  2M6M A;  2KFT A;  4GNE A;  4S3O B;  2YT5 A;  3IHP A;  2EGP A;  4PTB A;  2MT5 A;  2MD8 C;  4F52 B;  2I50 A;  3M63 A;  2KRE A;  2MIQ A;  3DQV R;  1X4U A;  5FB0 A;  5TDW A;  1LDK C;  2YRE A;  1DVP A;  2CSY A;  2KWK A;  2L75 A;  3ZNI A;  2K1J A;  2YW8 A;  4WA6 A;  2KWJ A;  2Y1M A;  5LKX A;  1X4I A;  2KGG A;  2E6R A;  5DKA A;  2LXP C;  1XWH A;  2KGI A;  3U5P A;  2CKL B;  3ZPV E;  2F6J A;  5D1L B;  4N4F A;  3N9M A;  5DIN A;  3FL2 A;  3L1Z B;  2VP7 A;  2FUU A;  5G0F A;  2VJE A;  5C11 A;  2PUY A;  2LGK A;  1V87 A;  2HDP A;  2L0B A;  3C6W A;  2YYR A;  1HYI A;  4BBQ A;  3EB6 A;  3O37 A;  4X3G A;  2VPD A;  3LRQ A;  4Q6F A;  1G25 A;  4ZQL A;  4I7D A;  2YQL A;  4L7X A;  2QIC A;  3RPG B;  3GL6 A;  2G6Q A;  1WES A;  4AYC A;  2VNF A;  2ECT A;  2F6N A;  3N9P A;  1T1H A;  2KYU A;  2EOD A;  2MA6 A;  1WEN A;  3O7A A;  1JM7 B;  3U5O A;  3ZYQ A;  4FIP A;  4N3W A;  1WE9 A;  3M99 A;  1LDJ B;  2XB1 A;  2YUR A;  5B76 A;  1Z2Q A;  2ECI A;  3PUR A;  3O70 A;  5FB1 A;  2RI7 A;  4B7Y C;  2MNZ A;  5JG6 A;  5TAB A;  5G05 B;  2LXH C;  5AIT A;  3KV5 A;  2AN6 A;  4TKP B;  2JMI A;  3SHB A;  3HTK C;  4CA1 A;  1U6G B;  1N87 A;  2L80 A;  5I3L A;  2CT2 A;  5TRB A;  2YHN A;  4LK9 A;  3T6R A;  2CSZ A;  1FBV A;  3O34 A;  1X4J A;  3HCT A;  3O33 A;  4A4C A;  4B86 C;  3V43 A;  1WEP A;  2C2V S;  4PPE A;  2KWO A;  3HCS A;  1BOR A;  1VYX A;  2VPE A;  4YBT A;  4LJN A;  4QF3 A;  2UZG A;  2YUC A;  2LN0 A;  2MNY A;  4NN2 A;  4MSX A;  3QZV A;  5H1V A;  2KR4 A;  2G45 A;  4P5O B;  2OXQ C;  3L1X A;  5AIU A;  2LRI C;  2QIZ A;  3ZVZ B;  1E4U A;  2JMD A;  1VFY A;  2FSA A;  4LKA A;  2FUI A;  2LDR A;  3ASL A;  4GB0 A;  2LGV A;  3ZTG A;  4UI9 B;  4FK5 A;  4YAB A;  4AVX A;  3O36 A;  5LCW B;  3N9L A;  4WZ0 A;  2C2L A;  3HCU A;  4IC2 A;  4YAX A;  4R8P K;  5LKU A;  5B77 A;  2ECN A;  5LKZ A;  2JRJ A;  3LQJ A;  1WFK A;  3U5M A;  4QF2 A;  2KWN A;  4LAD B;  4FJC A;  1WIL A;  1FP0 A;  2ECV A;  4MVT A;  1RMD A;  3RPG C;  5C13 A;  2G43 A;  3KQI A;  4I7C A;  2LGL A;  3C5K A;  3DPL R;  4BHW A;  4CCG X;  2ZET C;  3RTR B;  2VPG A;  4GND A;  4ZDT A;  2L5U A;  2ECJ A;  4IC3 A;  4A4B A;  4V3L C;  3U5N A;  4AP4 A;  1WEU A;  3ZPV 1;  2LV9 A;  1WEQ A;  2LGG A;  4L58 A;  2M1R A;  5FEY A;  3SOU A;  3L11 A;  2L43 A;  5KH7 A;  5TBN A;  1MM3 A;  2F42 A;  2M3H A;  4YBS A;  2D8S A;  4UP5 A;  3MHH A;  1WEV A;  1JOC A; 
#chains in the Genus database with same CATH topology
 1WEM A;  1WEW A;  4Z0O A;  5KH9 A;  3SOW A;  2VJF A;  3VK6 A;  1ZBD B;  2YSJ A;  2MD7 B;  5B75 A;  2XOZ A;  4A0C D;  3PUQ A;  3Q1D A;  2E61 A;  3KNV A;  1WEO A;  1Z60 A;  3SOX A;  1IYM A;  4S3O C;  4YC9 A;  3MHS A;  3SUB A;  2M85 A;  3ZVY A;  5H9M A;  1WEE A;  3M62 A;  2MA5 A;  4ZUX U;  5H1T A;  5B78 A;  2CON A;  2YQM A;  3PLW A;  4GNF A;  2Y43 A;  2H0D A;  1WGM A;  3LQH A;  2MUM A;  1F62 A;  2LAU A;  2LQ6 A;  2ECW A;  5G04 B;  2YSM A;  4GNG A;  4R2Y A;  2BAY A;  2RSD A;  4YBM A;  2K16 A;  4XI1 A;  3N9Q A;  2ECG A;  5KH3 A;  4O64 A;  3N9O A;  3O35 A;  2PNX A;  2KE1 A;  1WIM A;  5B8D A;  1Z6U A;  2CKL A;  1K2F A;  3T7L A;  4AUQ B;  2JMJ A;  5D1M B;  2CRW A;  1MM2 A;  2KIZ A;  4WZ2 A;  3O47 A;  3LQI A;  4WZ3 B;  2KU3 A;  2VJF B;  5D1K B;  2VPB A;  4H9D A;  4AYC B;  4W4U A;  5EYA F;  5SVX A;  4YAT A;  3I2D A;  2DSM A;  4YAD A;  1CHC A;  2HYE D;  2K17 A;  4C9Z A;  5FER A;  2NAA A;  2YHO A;  5B79 A;  3EB5 A;  1JM7 A;  4V3K C;  2EA6 A;  4FO9 A;  3KV6 A;  2H0D B;  4I7B A;  3PHD A;  2Y1N A;  3NG2 A;  4LLB A;  5J3X A;  3KDE C;  4R7E A;  3LJU X;  2K4D A;  1VD4 A;  2QJ0 A;  2E6S A;  5TDR A;  4UP0 A;  4A49 A;  5H1U A;  3N9N A;  2VJE B;  2DX8 A;  2IDA A;  2YU4 A;  5LKT A;  3FAN A;  3E2D A;  2CRR A;  2XEU A;  3GV4 A;  1HYJ A;  2M6M A;  2KFT A;  4GNE A;  4QQ4 A;  4S3O B;  2YT5 A;  3IHP A;  2EGP A;  4PTB A;  4OGE A;  2MT5 A;  2MD8 C;  4F52 B;  2I50 A;  3M63 A;  2KRE A;  2MIQ A;  3DQV R;  1X4U A;  5FB0 A;  5TDW A;  3M7K A;  1LDK C;  2YRE A;  1DVP A;  2CSY A;  2KWK A;  2L75 A;  2YVR A;  3ZNI A;  2K1J A;  2YW8 A;  4WA6 A;  2KWJ A;  2Y1M A;  2OWA A;  5LKX A;  1X4I A;  2FD4 A;  2KGG A;  2E6R A;  5DKA A;  2LXP C;  1XWH A;  2KGI A;  3U5P A;  2CKL B;  3ZPV E;  5K3Q A;  3JUE A;  2F6J A;  5D1L B;  4N4F A;  3N9M A;  5DIN A;  4F1P A;  3FL2 A;  3L1Z B;  2VP7 A;  2FUU A;  5G0F A;  5SVY A;  2VJE A;  5C11 A;  2PUY A;  2LGK A;  1V87 A;  2HDP A;  2L0B A;  3C6W A;  2YYR A;  1HYI A;  4BBQ A;  3EB6 A;  2XOC A;  3O37 A;  4X3G A;  2VPD A;  3LRQ A;  1DCQ A;  4Q6F A;  1G25 A;  4ZQL A;  3DWD A;  4I7D A;  2YQL A;  4L7X A;  2QIC A;  3RPG B;  3GL6 A;  2JM3 A;  2G6Q A;  1WES A;  4AYC A;  2VNF A;  2ECT A;  2F6N A;  3N9P A;  1T1H A;  3T9K A;  2JUN A;  2KYU A;  2EOD A;  2CSV A;  2MA6 A;  1WEN A;  2RR4 A;  4O62 A;  3O7A A;  1JM7 B;  2EXU A;  3U5O A;  3ZYQ A;  4FIP A;  4N3W A;  1WE9 A;  2XP0 A;  3M99 A;  1LDJ B;  2XB1 A;  2YUR A;  5B76 A;  1Z2Q A;  2ECI A;  3PUR A;  3O70 A;  5FB1 A;  2RI7 A;  4B7Y C;  2MNZ A;  2MKE A;  5JG6 A;  5TAB A;  5G05 B;  2LXH C;  5AIT A;  3KV5 A;  2AN6 A;  4TKP B;  1MBM A;  2IQJ A;  2JMI A;  3SHB A;  3LVQ E;  3HTK C;  4CA1 A;  1U6G B;  1N87 A;  3FJU B;  2L80 A;  5I3L A;  2CT2 A;  5TRB A;  2YHN A;  4LK9 A;  3T6R A;  2CSZ A;  1FBV A;  3O34 A;  1X4J A;  3HCT A;  4Z0R A;  2EGM A;  3O33 A;  4A4C A;  4B86 C;  3V43 A;  1WEP A;  2C2V S;  4PPE A;  2KWO A;  3HCS A;  1BOR A;  1VYX A;  2FFW A;  2VPE A;  4YBT A;  3FM8 C;  2KKY A;  3FEH A;  4LJN A;  4QF3 A;  2UZG A;  2YUC A;  2LN0 A;  2MNY A;  4NN2 A;  4MSX A;  3QZV A;  5H1V A;  3LVR E;  2KR4 A;  2G45 A;  4P5O B;  2B0O E;  5SVI B;  2OXQ C;  3L1X A;  5AIU A;  2LRI C;  2QIZ A;  3ZVZ B;  1E4U A;  2JMD A;  1VFY A;  2FSA A;  4LKA A;  2FUI A;  2LDR A;  3ASL A;  4GB0 A;  2LGV A;  3ZTG A;  3DDT A;  2L7P A;  4UI9 B;  4FK5 A;  2M13 A;  3MDB C;  2DJA A;  5SVI A;  4YAB A;  4AVX A;  3O36 A;  5LCW B;  3N9L A;  4WZ0 A;  2C2L A;  3HCU A;  4IC2 A;  4YAX A;  4R8P K;  5LKU A;  5B77 A;  2ECN A;  5LKZ A;  2JRJ A;  2KKX A;  3LQJ A;  1WFK A;  3U5M A;  4QF2 A;  2KWN A;  4LAD B;  4FJC A;  1WIL A;  1FP0 A;  2ECV A;  4MVT A;  1RMD A;  3RPG C;  5C13 A;  2G43 A;  3KQI A;  4I7C A;  2LGL A;  3C5K A;  3DPL R;  4BHW A;  4CCG X;  2ZET C;  3RTR B;  2VPG A;  4GND A;  4ZDT A;  2L5U A;  2ECJ A;  4IC3 A;  4A4B A;  4V3L C;  3U5N A;  4AP4 A;  2P57 A;  1WEU A;  4OGC A;  3ZPV 1;  2XOY A;  2LV9 A;  1WEQ A;  2LGG A;  4L58 A;  3FAO A;  2M1R A;  2D8U A;  5FEY A;  3SOU A;  3LDY A;  3L11 A;  2L43 A;  5KH7 A;  5TBN A;  1MM3 A;  2F42 A;  2M3H A;  4YBS A;  2D8S A;  4UP5 A;  3MHH A;  1WEV A;  3H7H A;  1JOC A; 
#chains in the Genus database with same CATH homology
 1WEM A;  1WEW A;  5KH9 A;  3SOW A;  2VJF A;  3VK6 A;  1ZBD B;  2YSJ A;  2MD7 B;  5B75 A;  4A0C D;  3PUQ A;  3KNV A;  1WEO A;  1Z60 A;  3SOX A;  1IYM A;  4S3O C;  4YC9 A;  3MHS A;  2M85 A;  3ZVY A;  5H9M A;  1WEE A;  3M62 A;  2MA5 A;  4ZUX U;  5H1T A;  5B78 A;  2YQM A;  4GNF A;  2Y43 A;  2H0D A;  1WGM A;  3LQH A;  2MUM A;  1F62 A;  2LQ6 A;  2ECW A;  5G04 B;  2YSM A;  4GNG A;  4R2Y A;  2BAY A;  2RSD A;  4YBM A;  2K16 A;  4XI1 A;  3N9Q A;  2ECG A;  5KH3 A;  4O64 A;  3N9O A;  3O35 A;  2PNX A;  2KE1 A;  1WIM A;  5B8D A;  1Z6U A;  2CKL A;  1K2F A;  3T7L A;  4AUQ B;  2JMJ A;  5D1M B;  1MM2 A;  2KIZ A;  4WZ2 A;  3LQI A;  4WZ3 B;  2KU3 A;  2VJF B;  5D1K B;  2VPB A;  4AYC B;  4W4U A;  5EYA F;  4YAT A;  3I2D A;  4YAD A;  1CHC A;  2HYE D;  2K17 A;  4C9Z A;  5FER A;  2NAA A;  2YHO A;  5B79 A;  3EB5 A;  1JM7 A;  4V3K C;  2EA6 A;  4FO9 A;  3KV6 A;  2H0D B;  4I7B A;  3PHD A;  2Y1N A;  3NG2 A;  4LLB A;  5J3X A;  4R7E A;  2K4D A;  1VD4 A;  2QJ0 A;  2E6S A;  5TDR A;  4UP0 A;  4A49 A;  5H1U A;  3N9N A;  2VJE B;  2DX8 A;  2IDA A;  2YU4 A;  5LKT A;  2XEU A;  3GV4 A;  1HYJ A;  2M6M A;  2KFT A;  4GNE A;  4S3O B;  2YT5 A;  3IHP A;  2EGP A;  4PTB A;  2MT5 A;  2MD8 C;  4F52 B;  2I50 A;  3M63 A;  2KRE A;  2MIQ A;  3DQV R;  1X4U A;  5FB0 A;  5TDW A;  1LDK C;  2YRE A;  1DVP A;  2CSY A;  2KWK A;  2L75 A;  3ZNI A;  2K1J A;  2YW8 A;  4WA6 A;  2KWJ A;  2Y1M A;  5LKX A;  1X4I A;  2KGG A;  2E6R A;  5DKA A;  2LXP C;  1XWH A;  2KGI A;  3U5P A;  2CKL B;  3ZPV E;  2F6J A;  5D1L B;  4N4F A;  3N9M A;  5DIN A;  3FL2 A;  3L1Z B;  2VP7 A;  2FUU A;  5G0F A;  2VJE A;  5C11 A;  2PUY A;  2LGK A;  1V87 A;  2HDP A;  2L0B A;  3C6W A;  2YYR A;  1HYI A;  4BBQ A;  3EB6 A;  3O37 A;  4X3G A;  2VPD A;  3LRQ A;  4Q6F A;  1G25 A;  4ZQL A;  4I7D A;  2YQL A;  4L7X A;  2QIC A;  3RPG B;  3GL6 A;  2G6Q A;  1WES A;  4AYC A;  2VNF A;  2ECT A;  2F6N A;  3N9P A;  1T1H A;  2KYU A;  2EOD A;  2MA6 A;  1WEN A;  3O7A A;  1JM7 B;  3U5O A;  3ZYQ A;  4FIP A;  4N3W A;  1WE9 A;  3M99 A;  1LDJ B;  2XB1 A;  2YUR A;  5B76 A;  1Z2Q A;  2ECI A;  3PUR A;  3O70 A;  5FB1 A;  2RI7 A;  4B7Y C;  2MNZ A;  5JG6 A;  5TAB A;  5G05 B;  2LXH C;  5AIT A;  3KV5 A;  2AN6 A;  4TKP B;  2JMI A;  3SHB A;  3HTK C;  4CA1 A;  1U6G B;  1N87 A;  2L80 A;  5I3L A;  2CT2 A;  5TRB A;  2YHN A;  4LK9 A;  3T6R A;  2CSZ A;  1FBV A;  3O34 A;  1X4J A;  3HCT A;  3O33 A;  4A4C A;  4B86 C;  3V43 A;  1WEP A;  2C2V S;  4PPE A;  2KWO A;  3HCS A;  1BOR A;  1VYX A;  2VPE A;  4YBT A;  4LJN A;  4QF3 A;  2UZG A;  2YUC A;  2LN0 A;  2MNY A;  4NN2 A;  4MSX A;  3QZV A;  5H1V A;  2KR4 A;  2G45 A;  4P5O B;  2OXQ C;  3L1X A;  5AIU A;  2LRI C;  2QIZ A;  3ZVZ B;  1E4U A;  2JMD A;  1VFY A;  2FSA A;  4LKA A;  2FUI A;  2LDR A;  3ASL A;  4GB0 A;  2LGV A;  3ZTG A;  4UI9 B;  4FK5 A;  4YAB A;  4AVX A;  3O36 A;  5LCW B;  3N9L A;  4WZ0 A;  2C2L A;  3HCU A;  4IC2 A;  4YAX A;  4R8P K;  5LKU A;  5B77 A;  2ECN A;  5LKZ A;  2JRJ A;  3LQJ A;  1WFK A;  3U5M A;  4QF2 A;  2KWN A;  4LAD B;  4FJC A;  1WIL A;  1FP0 A;  2ECV A;  4MVT A;  1RMD A;  3RPG C;  5C13 A;  2G43 A;  3KQI A;  4I7C A;  2LGL A;  3C5K A;  3DPL R;  4BHW A;  4CCG X;  2ZET C;  3RTR B;  2VPG A;  4GND A;  4ZDT A;  2L5U A;  2ECJ A;  4IC3 A;  4A4B A;  4V3L C;  3U5N A;  4AP4 A;  1WEU A;  3ZPV 1;  2LV9 A;  1WEQ A;  2LGG A;  4L58 A;  2M1R A;  5FEY A;  3SOU A;  3L11 A;  2L43 A;  5KH7 A;  5TBN A;  1MM3 A;  2F42 A;  2M3H A;  4YBS A;  2D8S A;  4UP5 A;  3MHH A;  1WEV A;  1JOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...