2LXPC

Nmr structure of two domains in ubiquitin ligase gp78, ring and g2br, bound to its conjugating enzyme ube2g
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
AVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 G2
publication title Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lxpC00
1HYIA 1HYJA 3RPGC 2G6QA 3M99A 2KE1A 1G25A 2JMIA 1RMDA 3L1ZB 2M85A 2M3HA 3ZVZB 2L43A 3PHDA 3ASLA 2C2VS 2L0BA 1WEQA 4YAXA 4CCGX 1XWHA 2H0DA 2RI7A 4YATA 3DQVR 2JRJA 3KQIA 4AVXA 2VJEB 3O70A 5B76A 2KWKA 3U5OA 4FK5A 4AP4A 4AYCB 5B79A 3LQJA 4I7DA 3T6RA 2YQLA 4A4CA 2LGLA 1MM2A 2M6MA 5LKUA 2LQ6A 3KNVA 2PNXA 5EYAF 5KH9A 1BORA 1WEWA 3PUQA 4XI1A 5B78A 2CSYA 3N9LA 5H1VA 3N9MA 4LK9A 5LKXA 2LN0A 2F6JA 2Y1MA 2FUUA 1WILA 4PTBA 2YW8A 2K4DA 2VPGA 5KH3A 2E6SA 3SHBA 2QICA 3ZPVE 3QZVA 1MM3A 2MD7B 2ECIA 5LKTA 2ECVA 5D1LB 2MNYA 2KFTA 1JM7B 2F42A 4X3GA 4UP5A 2KU3A 4LJNA 3SOWA 4UP0A 4WZ2A 3U5PA 3O36A 2VP7A 2Y43A 4A49A 2KWOA 4NN2A 3DPLR 2KWJA 1Z2QA 2YT5A 3C6WA 4I7CA 2VPEA 3O34A 5FEYA 2KGGA 4TKPB 3L1XA 4A0CD 4V3KC 4WA6A 2CT2A 3LQHA 2DX8A 2YSJA 3L11A 2YUCA 3ZPV1 5FB0A 2E6RA 3LQIA 2L5UA 2F6NA 1VD4A 4YBMA 1T1HA 2JMDA 2LDRA 4W4UA 1E4UA 2LRIC 4GB0A 3RTRB 3V43A 4AYCA 3SOXA 2KYUA 2NAAA 5KH7A 5B77A 1WFKA 1U6GB 5AIUA 2K17A 4WZ3B 2FUIA 2YQMA 1X4IA 3IHPA 3GL6A 3EB6A 4LKAA 2MNZA 2ECNA 1WGMA 2M1RA 2FSAA 3O35A 2XB1A 2L80A 2QIZA 2EGPA 2VJFA 2LXHC 5G04B 2IDAA 1Z6UA 2LGVA 2ZETC 3SOUA 2VNFA 2YU4A 3ZVYA 3O33A 4FO9A 3N9NA 4S3OC 3HCSA 1LDKC 4QF3A 2OXQC 5D1KB 1JM7A 2ECGA 2KWNA 3GV4A 4QF2A 1DVPA 4Q6FA 1VYXA 4WZ0A 4L58A 4BHWA 3RPGB 1WE9A 2MA6A 1ZBDB 2CKLA 5TRBA 1WEPA 1K2FA 2CSZA 2LGGA 4ZUXU 3U5NA 2YHNA 1V87A 5C13A 2K16A 2YHOA 2ECJA 3O7AA 4AUQB 5B8DA 2KIZA 4F52B 5G0FA 1WESA 2G43A 1FP0A 5G05B 2RSDA 4A4BA 4B7YC 2HDPA 3LRQA 5AITA 3HTKC 2ECTA 1WEMA 3N9PA 3EB5A 2MIQA 2PUYA 3N9QA 5FERA 1X4JA 2AN6A 4ZDTA 4UI9B 4YBTA 2VJEA 3M62A 5H1UA 4GNDA 5TABA 2C2LA 4YBSA 4S3OB 5TBNA 5JG6A 4O64A 4GNGA 5D1MB 2ECWA 4MVTA 4FJCA 1WEVA 1WIMA 3MHHA 1LDJB 4BBQA 5I3LA 2XEUA 4IC3A 3HCTA 4N4FA 2MT5A 2I50A 4ZQLA 2BAYA 2KR4A 2LXPC 4GNFA 2D8SA 4I7BA 3M63A 4L7XA 5TDRA 4N3WA 1Z60A 4YABA 4GNEA 1CHCA 4PPEA 2KREA 1X4UA 1N87A 1WEUA 3HCUA 3ZTGA 4V3LC 2Y1NA 2H0DB 1WENA 3NG2A 5J3XA 2EA6A 5H1TA 2VPBA 2MA5A 3ZNIA 1WEEA 4YADA 1WEOA 2JMJA 5B75A 1F62A 2LGKA 2YREA 1JOCA 2VJFB 2L75A 2MUMA 3KV6A 5C11A 2EODA 2YSMA 4P5OB 3ZYQA 5H9MA 4YC9A 3N9OA 3PURA 3VK6A 3T7LA 3I2DA 2YYRA 5LCWB 2VPDA 2LV9A 5FB1A 1VFYA 4FIPA 4CA1A 5LKZA 4R7EA 3MHSA 3U5MA 4MSXA 2K1JA 5DKAA 4R8PK 2YURA 4B86C 2UZGA 4IC2A 1FBVA 5TDWA 3C5KA 4R2YA 2MD8C 2G45A 3O37A 2QJ0A 3KV5A 4LADB 4LLBA 3FL2A 2CKLB 2KGIA 2HYED 5DINA 1IYMA 4C9ZA
chains in the Genus database with same CATH superfamily
1HYIA 1HYJA 3RPGC 2G6QA 2CRWA 2MKEA 3M99A 3KDEC 2KE1A 1G25A 2JMIA 1RMDA 3L1ZB 2D8UA 3FANA 2M85A 2M3HA 3ZVZB 2L43A 3PHDA 3ASLA 4Z0RA 2C2VS 2L0BA 1WEQA 4YAXA 4CCGX 1XWHA 2H0DA 2RI7A 4YATA 3DQVR 2JRJA 3KQIA 4AVXA 2VJEB 3O70A 5B76A 2KWKA 3U5OA 4FK5A 4AP4A 4AYCB 5B79A 3LQJA 4I7DA 3T6RA 2B0OE 2YQLA 4A4CA 2L7PA 2LGLA 1MM2A 2P57A 2M6MA 3JUEA 2CSVA 3LVRE 5LKUA 2LQ6A 3KNVA 2PNXA 5EYAF 5KH9A 5SVYA 1BORA 1WEWA 3PUQA 4XI1A 5B78A 2CSYA 3N9LA 3E2DA 5H1VA 3N9MA 4LK9A 5LKXA 2LN0A 2F6JA 3SUBA 2Y1MA 2FUUA 1WILA 2XOZA 4PTBA 2YW8A 2K4DA 2VPGA 5KH3A 2E6SA 3SHBA 2QICA 3ZPVE 3QZVA 1MM3A 2MD7B 2ECIA 5LKTA 2ECVA 5D1LB 2MNYA 2KFTA 1JM7B 2F42A 4X3GA 4UP5A 2KU3A 4LJNA 2XOCA 3SOWA 4UP0A 3LDYA 4WZ2A 3U5PA 3O36A 2VP7A 2Y43A 4A49A 2KWOA 4NN2A 3DPLR 2KWJA 1DCQA 1Z2QA 2YT5A 3C6WA 2YVRA 4I7CA 2VPEA 3O34A 5FEYA 4F1PA 2KGGA 4TKPB 3L1XA 5SVIA 4A0CD 4V3KC 4WA6A 3O47A 2CT2A 3LQHA 2DX8A 2YSJA 3L11A 2YUCA 2M13A 3ZPV1 5FB0A 2E6RA 3LQIA 2L5UA 2F6NA 1VD4A 3LVQE 4YBMA 3PLWA 1T1HA 2JMDA 2LDRA 4W4UA 1E4UA 3FM8C 2LRIC 4GB0A 3RTRB 2EGMA 3V43A 4AYCA 3SOXA 2KYUA 2NAAA 5KH7A 5B77A 1WFKA 1U6GB 5AIUA 3H7HA 2K17A 3DDTA 4WZ3B 2FUIA 2YQMA 1X4IA 2E61A 3IHPA 3GL6A 2XOYA 4OGCA 3EB6A 2OWAA 4LKAA 2MNZA 2ECNA 1WGMA 2M1RA 2FSAA 3O35A 2XB1A 2L80A 3LJUX 2QIZA 3MDBC 2EGPA 2VJFA 2LXHC 5G04B 2IDAA 1Z6UA 2LGVA 2ZETC 3SOUA 2VNFA 2YU4A 3ZVYA 3O33A 4FO9A 3N9NA 4S3OC 3HCSA 1LDKC 2KKXA 4QF3A 2OXQC 5D1KB 2CRRA 4QQ4A 1MBMA 1JM7A 2ECGA 2KWNA 3GV4A 4QF2A 1DVPA 4Q6FA 1VYXA 4WZ0A 4L58A 4O62A 2LAUA 2XP0A 4BHWA 3RPGB 1WE9A 2MA6A 1ZBDB 2CKLA 5TRBA 1WEPA 1K2FA 2JUNA 2CSZA 2LGGA 4ZUXU 3U5NA 2YHNA 2IQJA 1V87A 5C13A 2K16A 2YHOA 2ECJA 3O7AA 4AUQB 5SVXA 2KIZA 5B8DA 4F52B 5G0FA 1WESA 2G43A 1FP0A 5G05B 3Q1DA 2RSDA 4A4BA 4B7YC 2HDPA 3LRQA 2EXUA 4H9DA 5AITA 3HTKC 2KKYA 2ECTA 1WEMA 3N9PA 2JM3A 2MIQA 3EB5A 2PUYA 3N9QA 5FERA 1X4JA 2AN6A 5K3QA 4ZDTA 4UI9B 4YBTA 2VJEA 3M62A 5H1UA 4GNDA 5TABA 2C2LA 2FD4A 4YBSA 4S3OB 5TBNA 5JG6A 4O64A 4GNGA 5D1MB 2ECWA 3T9KA 4MVTA 4FJCA 1WEVA 1WIMA 3MHHA 1LDJB 5SVIB 4BBQA 5I3LA 2XEUA 4IC3A 3HCTA 4N4FA 2MT5A 3FEHA 2I50A 4ZQLA 2BAYA 2KR4A 2LXPC 4Z0OA 4GNFA 2D8SA 4I7BA 3M63A 2CONA 4L7XA 5TDRA 4N3WA 3FJUB 1Z60A 4YABA 4GNEA 1CHCA 4PPEA 2KREA 1X4UA 1N87A 1WEUA 3HCUA 3M7KA 3ZTGA 4V3LC 2Y1NA 2H0DB 1WENA 3NG2A 5J3XA 2EA6A 5H1TA 2VPBA 2MA5A 3ZNIA 1WEEA 4YADA 1WEOA 2JMJA 5B75A 1F62A 2LGKA 2YREA 1JOCA 2RR4A 2VJFB 2L75A 2FFWA 2MUMA 3KV6A 5C11A 2EODA 2YSMA 4P5OB 3ZYQA 5H9MA 4YC9A 3N9OA 3PURA 2DJAA 3VK6A 3T7LA 3I2DA 2YYRA 5LCWB 2VPDA 2LV9A 5FB1A 1VFYA 4FIPA 4CA1A 5LKZA 4R7EA 3MHSA 3U5MA 2DSMA 4MSXA 2K1JA 5DKAA 4OGEA 4R8PK 2YURA 4B86C 2UZGA 4IC2A 1FBVA 5TDWA 3C5KA 4R2YA 2MD8C 3DWDA 2G45A 3O37A 2QJ0A 3KV5A 4LADB 4LLBA 3FL2A 2CKLB 2KGIA 2HYED 5DINA 1IYMA 4C9ZA 3FAOA
chains in the Genus database with same CATH topology
1HYIA 1HYJA 3RPGC 2G6QA 3M99A 2KE1A 1G25A 2JMIA 1RMDA 3L1ZB 2M85A 2M3HA 3ZVZB 2L43A 3PHDA 3ASLA 2C2VS 2L0BA 1WEQA 4YAXA 4CCGX 1XWHA 2H0DA 2RI7A 4YATA 3DQVR 2JRJA 3KQIA 4AVXA 2VJEB 3O70A 5B76A 2KWKA 3U5OA 4FK5A 4AP4A 4AYCB 5B79A 3LQJA 4I7DA 3T6RA 2YQLA 4A4CA 2LGLA 1MM2A 2M6MA 5LKUA 2LQ6A 3KNVA 2PNXA 5EYAF 5KH9A 1BORA 1WEWA 3PUQA 4XI1A 5B78A 2CSYA 3N9LA 5H1VA 3N9MA 4LK9A 5LKXA 2LN0A 2F6JA 2Y1MA 2FUUA 1WILA 4PTBA 2YW8A 2K4DA 2VPGA 5KH3A 2E6SA 3SHBA 2QICA 3ZPVE 3QZVA 1MM3A 2MD7B 2ECIA 5LKTA 2ECVA 5D1LB 2MNYA 2KFTA 1JM7B 2F42A 4X3GA 4UP5A 2KU3A 4LJNA 3SOWA 4UP0A 4WZ2A 3U5PA 3O36A 2VP7A 2Y43A 4A49A 2KWOA 4NN2A 3DPLR 2KWJA 1Z2QA 2YT5A 3C6WA 4I7CA 2VPEA 3O34A 5FEYA 2KGGA 4TKPB 3L1XA 4A0CD 4V3KC 4WA6A 2CT2A 3LQHA 2DX8A 2YSJA 3L11A 2YUCA 3ZPV1 5FB0A 2E6RA 3LQIA 2L5UA 2F6NA 1VD4A 4YBMA 1T1HA 2JMDA 2LDRA 4W4UA 1E4UA 2LRIC 4GB0A 3RTRB 3V43A 4AYCA 3SOXA 2KYUA 2NAAA 5KH7A 5B77A 1WFKA 1U6GB 5AIUA 2K17A 4WZ3B 2FUIA 2YQMA 1X4IA 3IHPA 3GL6A 3EB6A 4LKAA 2MNZA 2ECNA 1WGMA 2M1RA 2FSAA 3O35A 2XB1A 2L80A 2QIZA 2EGPA 2VJFA 2LXHC 5G04B 2IDAA 1Z6UA 2LGVA 2ZETC 3SOUA 2VNFA 2YU4A 3ZVYA 3O33A 4FO9A 3N9NA 4S3OC 3HCSA 1LDKC 4QF3A 2OXQC 5D1KB 1JM7A 2ECGA 2KWNA 3GV4A 4QF2A 1DVPA 4Q6FA 1VYXA 4WZ0A 4L58A 4BHWA 3RPGB 1WE9A 2MA6A 1ZBDB 2CKLA 5TRBA 1WEPA 1K2FA 2CSZA 2LGGA 4ZUXU 3U5NA 2YHNA 1V87A 5C13A 2K16A 2YHOA 2ECJA 3O7AA 4AUQB 5B8DA 2KIZA 4F52B 5G0FA 1WESA 2G43A 1FP0A 5G05B 2RSDA 4A4BA 4B7YC 2HDPA 3LRQA 5AITA 3HTKC 2ECTA 1WEMA 3N9PA 3EB5A 2MIQA 2PUYA 3N9QA 5FERA 1X4JA 2AN6A 4ZDTA 4UI9B 4YBTA 2VJEA 3M62A 5H1UA 4GNDA 5TABA 2C2LA 4YBSA 4S3OB 5TBNA 5JG6A 4O64A 4GNGA 5D1MB 2ECWA 4MVTA 4FJCA 1WEVA 1WIMA 3MHHA 1LDJB 4BBQA 5I3LA 2XEUA 4IC3A 3HCTA 4N4FA 2MT5A 2I50A 4ZQLA 2BAYA 2KR4A 2LXPC 4GNFA 2D8SA 4I7BA 3M63A 4L7XA 5TDRA 4N3WA 1Z60A 4YABA 4GNEA 1CHCA 4PPEA 2KREA 1X4UA 1N87A 1WEUA 3HCUA 3ZTGA 4V3LC 2Y1NA 2H0DB 1WENA 3NG2A 5J3XA 2EA6A 5H1TA 2VPBA 2MA5A 3ZNIA 1WEEA 4YADA 1WEOA 2JMJA 5B75A 1F62A 2LGKA 2YREA 1JOCA 2VJFB 2L75A 2MUMA 3KV6A 5C11A 2EODA 2YSMA 4P5OB 3ZYQA 5H9MA 4YC9A 3N9OA 3PURA 3VK6A 3T7LA 3I2DA 2YYRA 5LCWB 2VPDA 2LV9A 5FB1A 1VFYA 4FIPA 4CA1A 5LKZA 4R7EA 3MHSA 3U5MA 4MSXA 2K1JA 5DKAA 4R8PK 2YURA 4B86C 2UZGA 4IC2A 1FBVA 5TDWA 3C5KA 4R2YA 2MD8C 2G45A 3O37A 2QJ0A 3KV5A 4LADB 4LLBA 3FL2A 2CKLB 2KGIA 2HYED 5DINA 1IYMA 4C9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYI A;  1HYJ A;  3RPG C;  2G6Q A;  3M99 A;  2KE1 A;  1G25 A;  2JMI A;  1RMD A;  3L1Z B;  2M85 A;  2M3H A;  3ZVZ B;  2L43 A;  3PHD A;  3ASL A;  2C2V S;  2L0B A;  1WEQ A;  4YAX A;  4CCG X;  1XWH A;  2H0D A;  2RI7 A;  4YAT A;  3DQV R;  2JRJ A;  3KQI A;  4AVX A;  2VJE B;  3O70 A;  5B76 A;  2KWK A;  3U5O A;  4FK5 A;  4AP4 A;  4AYC B;  5B79 A;  3LQJ A;  4I7D A;  3T6R A;  2YQL A;  4A4C A;  2LGL A;  1MM2 A;  2M6M A;  5LKU A;  2LQ6 A;  3KNV A;  2PNX A;  5EYA F;  5KH9 A;  1BOR A;  1WEW A;  3PUQ A;  4XI1 A;  5B78 A;  2CSY A;  3N9L A;  5H1V A;  3N9M A;  4LK9 A;  5LKX A;  2LN0 A;  2F6J A;  2Y1M A;  2FUU A;  1WIL A;  4PTB A;  2YW8 A;  2K4D A;  2VPG A;  5KH3 A;  2E6S A;  3SHB A;  2QIC A;  3ZPV E;  3QZV A;  1MM3 A;  2MD7 B;  2ECI A;  5LKT A;  2ECV A;  5D1L B;  2MNY A;  2KFT A;  1JM7 B;  2F42 A;  4X3G A;  4UP5 A;  2KU3 A;  4LJN A;  3SOW A;  4UP0 A;  4WZ2 A;  3U5P A;  3O36 A;  2VP7 A;  2Y43 A;  4A49 A;  2KWO A;  4NN2 A;  3DPL R;  2KWJ A;  1Z2Q A;  2YT5 A;  3C6W A;  4I7C A;  2VPE A;  3O34 A;  5FEY A;  2KGG A;  4TKP B;  3L1X A;  4A0C D;  4V3K C;  4WA6 A;  2CT2 A;  3LQH A;  2DX8 A;  2YSJ A;  3L11 A;  2YUC A;  3ZPV 1;  5FB0 A;  2E6R A;  3LQI A;  2L5U A;  2F6N A;  1VD4 A;  4YBM A;  1T1H A;  2JMD A;  2LDR A;  4W4U A;  1E4U A;  2LRI C;  4GB0 A;  3RTR B;  3V43 A;  4AYC A;  3SOX A;  2KYU A;  2NAA A;  5KH7 A;  5B77 A;  1WFK A;  1U6G B;  5AIU A;  2K17 A;  4WZ3 B;  2FUI A;  2YQM A;  1X4I A;  3IHP A;  3GL6 A;  3EB6 A;  4LKA A;  2MNZ A;  2ECN A;  1WGM A;  2M1R A;  2FSA A;  3O35 A;  2XB1 A;  2L80 A;  2QIZ A;  2EGP A;  2VJF A;  2LXH C;  5G04 B;  2IDA A;  1Z6U A;  2LGV A;  2ZET C;  3SOU A;  2VNF A;  2YU4 A;  3ZVY A;  3O33 A;  4FO9 A;  3N9N A;  4S3O C;  3HCS A;  1LDK C;  4QF3 A;  2OXQ C;  5D1K B;  1JM7 A;  2ECG A;  2KWN A;  3GV4 A;  4QF2 A;  1DVP A;  4Q6F A;  1VYX A;  4WZ0 A;  4L58 A;  4BHW A;  3RPG B;  1WE9 A;  2MA6 A;  1ZBD B;  2CKL A;  5TRB A;  1WEP A;  1K2F A;  2CSZ A;  2LGG A;  4ZUX U;  3U5N A;  2YHN A;  1V87 A;  5C13 A;  2K16 A;  2YHO A;  2ECJ A;  3O7A A;  4AUQ B;  5B8D A;  2KIZ A;  4F52 B;  5G0F A;  1WES A;  2G43 A;  1FP0 A;  5G05 B;  2RSD A;  4A4B A;  4B7Y C;  2HDP A;  3LRQ A;  5AIT A;  3HTK C;  2ECT A;  1WEM A;  3N9P A;  3EB5 A;  2MIQ A;  2PUY A;  3N9Q A;  5FER A;  1X4J A;  2AN6 A;  4ZDT A;  4UI9 B;  4YBT A;  2VJE A;  3M62 A;  5H1U A;  4GND A;  5TAB A;  2C2L A;  4YBS A;  4S3O B;  5TBN A;  5JG6 A;  4O64 A;  4GNG A;  5D1M B;  2ECW A;  4MVT A;  4FJC A;  1WEV A;  1WIM A;  3MHH A;  1LDJ B;  4BBQ A;  5I3L A;  2XEU A;  4IC3 A;  3HCT A;  4N4F A;  2MT5 A;  2I50 A;  4ZQL A;  2BAY A;  2KR4 A;  2LXP C;  4GNF A;  2D8S A;  4I7B A;  3M63 A;  4L7X A;  5TDR A;  4N3W A;  1Z60 A;  4YAB A;  4GNE A;  1CHC A;  4PPE A;  2KRE A;  1X4U A;  1N87 A;  1WEU A;  3HCU A;  3ZTG A;  4V3L C;  2Y1N A;  2H0D B;  1WEN A;  3NG2 A;  5J3X A;  2EA6 A;  5H1T A;  2VPB A;  2MA5 A;  3ZNI A;  1WEE A;  4YAD A;  1WEO A;  2JMJ A;  5B75 A;  1F62 A;  2LGK A;  2YRE A;  1JOC A;  2VJF B;  2L75 A;  2MUM A;  3KV6 A;  5C11 A;  2EOD A;  2YSM A;  4P5O B;  3ZYQ A;  5H9M A;  4YC9 A;  3N9O A;  3PUR A;  3VK6 A;  3T7L A;  3I2D A;  2YYR A;  5LCW B;  2VPD A;  2LV9 A;  5FB1 A;  1VFY A;  4FIP A;  4CA1 A;  5LKZ A;  4R7E A;  3MHS A;  3U5M A;  4MSX A;  2K1J A;  5DKA A;  4R8P K;  2YUR A;  4B86 C;  2UZG A;  4IC2 A;  1FBV A;  5TDW A;  3C5K A;  4R2Y A;  2MD8 C;  2G45 A;  3O37 A;  2QJ0 A;  3KV5 A;  4LAD B;  4LLB A;  3FL2 A;  2CKL B;  2KGI A;  2HYE D;  5DIN A;  1IYM A;  4C9Z A; 
#chains in the Genus database with same CATH topology
 1HYI A;  1HYJ A;  3RPG C;  2G6Q A;  2CRW A;  2MKE A;  3M99 A;  3KDE C;  2KE1 A;  1G25 A;  2JMI A;  1RMD A;  3L1Z B;  2D8U A;  3FAN A;  2M85 A;  2M3H A;  3ZVZ B;  2L43 A;  3PHD A;  3ASL A;  4Z0R A;  2C2V S;  2L0B A;  1WEQ A;  4YAX A;  4CCG X;  1XWH A;  2H0D A;  2RI7 A;  4YAT A;  3DQV R;  2JRJ A;  3KQI A;  4AVX A;  2VJE B;  3O70 A;  5B76 A;  2KWK A;  3U5O A;  4FK5 A;  4AP4 A;  4AYC B;  5B79 A;  3LQJ A;  4I7D A;  3T6R A;  2B0O E;  2YQL A;  4A4C A;  2L7P A;  2LGL A;  1MM2 A;  2P57 A;  2M6M A;  3JUE A;  2CSV A;  3LVR E;  5LKU A;  2LQ6 A;  3KNV A;  2PNX A;  5EYA F;  5KH9 A;  5SVY A;  1BOR A;  1WEW A;  3PUQ A;  4XI1 A;  5B78 A;  2CSY A;  3N9L A;  3E2D A;  5H1V A;  3N9M A;  4LK9 A;  5LKX A;  2LN0 A;  2F6J A;  3SUB A;  2Y1M A;  2FUU A;  1WIL A;  2XOZ A;  4PTB A;  2YW8 A;  2K4D A;  2VPG A;  5KH3 A;  2E6S A;  3SHB A;  2QIC A;  3ZPV E;  3QZV A;  1MM3 A;  2MD7 B;  2ECI A;  5LKT A;  2ECV A;  5D1L B;  2MNY A;  2KFT A;  1JM7 B;  2F42 A;  4X3G A;  4UP5 A;  2KU3 A;  4LJN A;  2XOC A;  3SOW A;  4UP0 A;  3LDY A;  4WZ2 A;  3U5P A;  3O36 A;  2VP7 A;  2Y43 A;  4A49 A;  2KWO A;  4NN2 A;  3DPL R;  2KWJ A;  1DCQ A;  1Z2Q A;  2YT5 A;  3C6W A;  2YVR A;  4I7C A;  2VPE A;  3O34 A;  5FEY A;  4F1P A;  2KGG A;  4TKP B;  3L1X A;  5SVI A;  4A0C D;  4V3K C;  4WA6 A;  3O47 A;  2CT2 A;  3LQH A;  2DX8 A;  2YSJ A;  3L11 A;  2YUC A;  2M13 A;  3ZPV 1;  5FB0 A;  2E6R A;  3LQI A;  2L5U A;  2F6N A;  1VD4 A;  3LVQ E;  4YBM A;  3PLW A;  1T1H A;  2JMD A;  2LDR A;  4W4U A;  1E4U A;  3FM8 C;  2LRI C;  4GB0 A;  3RTR B;  2EGM A;  3V43 A;  4AYC A;  3SOX A;  2KYU A;  2NAA A;  5KH7 A;  5B77 A;  1WFK A;  1U6G B;  5AIU A;  3H7H A;  2K17 A;  3DDT A;  4WZ3 B;  2FUI A;  2YQM A;  1X4I A;  2E61 A;  3IHP A;  3GL6 A;  2XOY A;  4OGC A;  3EB6 A;  2OWA A;  4LKA A;  2MNZ A;  2ECN A;  1WGM A;  2M1R A;  2FSA A;  3O35 A;  2XB1 A;  2L80 A;  3LJU X;  2QIZ A;  3MDB C;  2EGP A;  2VJF A;  2LXH C;  5G04 B;  2IDA A;  1Z6U A;  2LGV A;  2ZET C;  3SOU A;  2VNF A;  2YU4 A;  3ZVY A;  3O33 A;  4FO9 A;  3N9N A;  4S3O C;  3HCS A;  1LDK C;  2KKX A;  4QF3 A;  2OXQ C;  5D1K B;  2CRR A;  4QQ4 A;  1MBM A;  1JM7 A;  2ECG A;  2KWN A;  3GV4 A;  4QF2 A;  1DVP A;  4Q6F A;  1VYX A;  4WZ0 A;  4L58 A;  4O62 A;  2LAU A;  2XP0 A;  4BHW A;  3RPG B;  1WE9 A;  2MA6 A;  1ZBD B;  2CKL A;  5TRB A;  1WEP A;  1K2F A;  2JUN A;  2CSZ A;  2LGG A;  4ZUX U;  3U5N A;  2YHN A;  2IQJ A;  1V87 A;  5C13 A;  2K16 A;  2YHO A;  2ECJ A;  3O7A A;  4AUQ B;  5SVX A;  2KIZ A;  5B8D A;  4F52 B;  5G0F A;  1WES A;  2G43 A;  1FP0 A;  5G05 B;  3Q1D A;  2RSD A;  4A4B A;  4B7Y C;  2HDP A;  3LRQ A;  2EXU A;  4H9D A;  5AIT A;  3HTK C;  2KKY A;  2ECT A;  1WEM A;  3N9P A;  2JM3 A;  2MIQ A;  3EB5 A;  2PUY A;  3N9Q A;  5FER A;  1X4J A;  2AN6 A;  5K3Q A;  4ZDT A;  4UI9 B;  4YBT A;  2VJE A;  3M62 A;  5H1U A;  4GND A;  5TAB A;  2C2L A;  2FD4 A;  4YBS A;  4S3O B;  5TBN A;  5JG6 A;  4O64 A;  4GNG A;  5D1M B;  2ECW A;  3T9K A;  4MVT A;  4FJC A;  1WEV A;  1WIM A;  3MHH A;  1LDJ B;  5SVI B;  4BBQ A;  5I3L A;  2XEU A;  4IC3 A;  3HCT A;  4N4F A;  2MT5 A;  3FEH A;  2I50 A;  4ZQL A;  2BAY A;  2KR4 A;  2LXP C;  4Z0O A;  4GNF A;  2D8S A;  4I7B A;  3M63 A;  2CON A;  4L7X A;  5TDR A;  4N3W A;  3FJU B;  1Z60 A;  4YAB A;  4GNE A;  1CHC A;  4PPE A;  2KRE A;  1X4U A;  1N87 A;  1WEU A;  3HCU A;  3M7K A;  3ZTG A;  4V3L C;  2Y1N A;  2H0D B;  1WEN A;  3NG2 A;  5J3X A;  2EA6 A;  5H1T A;  2VPB A;  2MA5 A;  3ZNI A;  1WEE A;  4YAD A;  1WEO A;  2JMJ A;  5B75 A;  1F62 A;  2LGK A;  2YRE A;  1JOC A;  2RR4 A;  2VJF B;  2L75 A;  2FFW A;  2MUM A;  3KV6 A;  5C11 A;  2EOD A;  2YSM A;  4P5O B;  3ZYQ A;  5H9M A;  4YC9 A;  3N9O A;  3PUR A;  2DJA A;  3VK6 A;  3T7L A;  3I2D A;  2YYR A;  5LCW B;  2VPD A;  2LV9 A;  5FB1 A;  1VFY A;  4FIP A;  4CA1 A;  5LKZ A;  4R7E A;  3MHS A;  3U5M A;  2DSM A;  4MSX A;  2K1J A;  5DKA A;  4OGE A;  4R8P K;  2YUR A;  4B86 C;  2UZG A;  4IC2 A;  1FBV A;  5TDW A;  3C5K A;  4R2Y A;  2MD8 C;  3DWD A;  2G45 A;  3O37 A;  2QJ0 A;  3KV5 A;  4LAD B;  4LLB A;  3FL2 A;  2CKL B;  2KGI A;  2HYE D;  5DIN A;  1IYM A;  4C9Z A;  3FAO A; 
#chains in the Genus database with same CATH homology
 1HYI A;  1HYJ A;  3RPG C;  2G6Q A;  3M99 A;  2KE1 A;  1G25 A;  2JMI A;  1RMD A;  3L1Z B;  2M85 A;  2M3H A;  3ZVZ B;  2L43 A;  3PHD A;  3ASL A;  2C2V S;  2L0B A;  1WEQ A;  4YAX A;  4CCG X;  1XWH A;  2H0D A;  2RI7 A;  4YAT A;  3DQV R;  2JRJ A;  3KQI A;  4AVX A;  2VJE B;  3O70 A;  5B76 A;  2KWK A;  3U5O A;  4FK5 A;  4AP4 A;  4AYC B;  5B79 A;  3LQJ A;  4I7D A;  3T6R A;  2YQL A;  4A4C A;  2LGL A;  1MM2 A;  2M6M A;  5LKU A;  2LQ6 A;  3KNV A;  2PNX A;  5EYA F;  5KH9 A;  1BOR A;  1WEW A;  3PUQ A;  4XI1 A;  5B78 A;  2CSY A;  3N9L A;  5H1V A;  3N9M A;  4LK9 A;  5LKX A;  2LN0 A;  2F6J A;  2Y1M A;  2FUU A;  1WIL A;  4PTB A;  2YW8 A;  2K4D A;  2VPG A;  5KH3 A;  2E6S A;  3SHB A;  2QIC A;  3ZPV E;  3QZV A;  1MM3 A;  2MD7 B;  2ECI A;  5LKT A;  2ECV A;  5D1L B;  2MNY A;  2KFT A;  1JM7 B;  2F42 A;  4X3G A;  4UP5 A;  2KU3 A;  4LJN A;  3SOW A;  4UP0 A;  4WZ2 A;  3U5P A;  3O36 A;  2VP7 A;  2Y43 A;  4A49 A;  2KWO A;  4NN2 A;  3DPL R;  2KWJ A;  1Z2Q A;  2YT5 A;  3C6W A;  4I7C A;  2VPE A;  3O34 A;  5FEY A;  2KGG A;  4TKP B;  3L1X A;  4A0C D;  4V3K C;  4WA6 A;  2CT2 A;  3LQH A;  2DX8 A;  2YSJ A;  3L11 A;  2YUC A;  3ZPV 1;  5FB0 A;  2E6R A;  3LQI A;  2L5U A;  2F6N A;  1VD4 A;  4YBM A;  1T1H A;  2JMD A;  2LDR A;  4W4U A;  1E4U A;  2LRI C;  4GB0 A;  3RTR B;  3V43 A;  4AYC A;  3SOX A;  2KYU A;  2NAA A;  5KH7 A;  5B77 A;  1WFK A;  1U6G B;  5AIU A;  2K17 A;  4WZ3 B;  2FUI A;  2YQM A;  1X4I A;  3IHP A;  3GL6 A;  3EB6 A;  4LKA A;  2MNZ A;  2ECN A;  1WGM A;  2M1R A;  2FSA A;  3O35 A;  2XB1 A;  2L80 A;  2QIZ A;  2EGP A;  2VJF A;  2LXH C;  5G04 B;  2IDA A;  1Z6U A;  2LGV A;  2ZET C;  3SOU A;  2VNF A;  2YU4 A;  3ZVY A;  3O33 A;  4FO9 A;  3N9N A;  4S3O C;  3HCS A;  1LDK C;  4QF3 A;  2OXQ C;  5D1K B;  1JM7 A;  2ECG A;  2KWN A;  3GV4 A;  4QF2 A;  1DVP A;  4Q6F A;  1VYX A;  4WZ0 A;  4L58 A;  4BHW A;  3RPG B;  1WE9 A;  2MA6 A;  1ZBD B;  2CKL A;  5TRB A;  1WEP A;  1K2F A;  2CSZ A;  2LGG A;  4ZUX U;  3U5N A;  2YHN A;  1V87 A;  5C13 A;  2K16 A;  2YHO A;  2ECJ A;  3O7A A;  4AUQ B;  5B8D A;  2KIZ A;  4F52 B;  5G0F A;  1WES A;  2G43 A;  1FP0 A;  5G05 B;  2RSD A;  4A4B A;  4B7Y C;  2HDP A;  3LRQ A;  5AIT A;  3HTK C;  2ECT A;  1WEM A;  3N9P A;  3EB5 A;  2MIQ A;  2PUY A;  3N9Q A;  5FER A;  1X4J A;  2AN6 A;  4ZDT A;  4UI9 B;  4YBT A;  2VJE A;  3M62 A;  5H1U A;  4GND A;  5TAB A;  2C2L A;  4YBS A;  4S3O B;  5TBN A;  5JG6 A;  4O64 A;  4GNG A;  5D1M B;  2ECW A;  4MVT A;  4FJC A;  1WEV A;  1WIM A;  3MHH A;  1LDJ B;  4BBQ A;  5I3L A;  2XEU A;  4IC3 A;  3HCT A;  4N4F A;  2MT5 A;  2I50 A;  4ZQL A;  2BAY A;  2KR4 A;  2LXP C;  4GNF A;  2D8S A;  4I7B A;  3M63 A;  4L7X A;  5TDR A;  4N3W A;  1Z60 A;  4YAB A;  4GNE A;  1CHC A;  4PPE A;  2KRE A;  1X4U A;  1N87 A;  1WEU A;  3HCU A;  3ZTG A;  4V3L C;  2Y1N A;  2H0D B;  1WEN A;  3NG2 A;  5J3X A;  2EA6 A;  5H1T A;  2VPB A;  2MA5 A;  3ZNI A;  1WEE A;  4YAD A;  1WEO A;  2JMJ A;  5B75 A;  1F62 A;  2LGK A;  2YRE A;  1JOC A;  2VJF B;  2L75 A;  2MUM A;  3KV6 A;  5C11 A;  2EOD A;  2YSM A;  4P5O B;  3ZYQ A;  5H9M A;  4YC9 A;  3N9O A;  3PUR A;  3VK6 A;  3T7L A;  3I2D A;  2YYR A;  5LCW B;  2VPD A;  2LV9 A;  5FB1 A;  1VFY A;  4FIP A;  4CA1 A;  5LKZ A;  4R7E A;  3MHS A;  3U5M A;  4MSX A;  2K1J A;  5DKA A;  4R8P K;  2YUR A;  4B86 C;  2UZG A;  4IC2 A;  1FBV A;  5TDW A;  3C5K A;  4R2Y A;  2MD8 C;  2G45 A;  3O37 A;  2QJ0 A;  3KV5 A;  4LAD B;  4LLB A;  3FL2 A;  2CKL B;  2KGI A;  2HYE D;  5DIN A;  1IYM A;  4C9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...