2LXPC

Nmr structure of two domains in ubiquitin ligase gp78, ring and g2br, bound to its conjugating enzyme ube2g
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
AVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 G2
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lxpC00
3VK6A 5TBNA 3RPGB 2M85A 2LN0A 4V3LC 4FK5A 3ZPVE 3SOXA 3EB6A 5AITA 2YT5A 3M63A 3EB5A 4ZDTA 3IHPA 5D1LB 1Z2QA 4R2YA 2MNYA 3HCSA 2YQLA 1E4UA 4IC3A 2LGVA 1MM3A 1DVPA 5LKXA 2ECJA 1WIMA 1N87A 5FB0A 3O36A 2RI7A 2HDPA 2QJ0A 3KV6A 4Q6FA 1WFKA 2ZETC 2CSZA 2KFTA 4LKAA 2VP7A 5B75A 4LJNA 2LRIC 2MNZA 3HCUA 3N9QA 2JMDA 1Z60A 3C6WA 2M3HA 3HCTA 2M1RA 2MIQA 1WEVA 1X4JA 1WEEA 2EGPA 4UP5A 2LDRA 5C13A 4YADA 2KR4A 5H1UA 4BHWA 2MA6A 2KE1A 2F42A 3M99A 1ZBDB 3QZVA 1VFYA 2G43A 2VPBA 2CT2A 1LDKC 2L43A 4GNEA 2H0DB 3RTRB 2LGKA 4F52B 2PNXA 4UI9B 3N9NA 2C2VS 4ZQLA 2VJEA 1IYMA 1WEWA 5B77A 1HYIA 1WEOA 2Y1MA 5C11A 1FBVA 2KREA 5EYAF 4CA1A 5B79A 4AYCA 2YSMA 2E6RA 2VJFA 2MT5A 4TKPB 5B76A 4YBSA 4L58A 5J3XA 1JM7B 1JM7A 4NN2A 1X4UA 1T1HA 4FO9A 4ZUXU 2YYRA 2KGIA 2QICA 3T7LA 1XWHA 2VPDA 2LXPC 2L80A 3LQJA 3MHHA 2KWJA 3O35A 4R7EA 1BORA 3V43A 4GNFA 3LRQA 3FL2A 4FJCA 2KWKA 5LKUA 3ZPV1 1WILA 2KU3A 4YBMA 1WEQA 2LGGA 4LK9A 5G05B 5KH7A 1WEPA 4B7YC 2C2LA 4R8PK 5LKTA 5TDWA 2UZGA 4AUQB 2G45A 2L0BA 4PPEA 3U5NA 2YHNA 4XI1A 4S3OB 3RPGC 4W4UA 4I7BA 3U5OA 3KV5A 4AVXA 2YURA 3MHSA 2EODA 5TRBA 4MVTA 2KIZA 4N3WA 4WA6A 1X4IA 4BBQA 4N4FA 2K17A 4GB0A 5B8DA 4LADB 2XEUA 3N9MA 5TABA 3ZTGA 3U5MA 2PUYA 3PURA 5G0FA 4AYCB 5D1KB 2KWNA 3PHDA 3I2DA 4YATA 4YABA 2ECWA 2LGLA 2BAYA 2KYUA 2EA6A 5D1MB 4S3OC 3PUQA 3N9PA 2NAAA 4GNDA 4PTBA 2YW8A 2KGGA 2YREA 4WZ2A 3GL6A 5LCWB 5H1VA 4V3KC 3ZVZB 2H0DA 4A4BA 4P5OB 2G6QA 3DPLR 5TDRA 3O70A 2I50A 2L75A 1WE9A 2FUUA 3KNVA 3N9LA 1VYXA 4FIPA 3ZYQA 5AIUA 3ZNIA 4C9ZA 2KWOA 2ECNA 4GNGA 1CHCA 5KH3A 1WENA 2LQ6A 2IDAA 1WESA 2JRJA 5H1TA 2YHOA 5H9MA 2YU4A 4A0CD 2JMJA 2YQMA 2RSDA 2DX8A 3SOWA 2YUCA 1JOCA 3LQHA 2MUMA 1U6GB 5JG6A 3N9OA 2OXQC 2M6MA 3O37A 2F6NA 5B78A 4WZ3B 1V87A 1WGMA 4A49A 2CKLB 2LV9A 4YBTA 4QF3A 4CCGX 4WZ0A 2K4DA 4B86C 1RMDA 2K16A 5FEYA 5KH9A 4A4CA 5FB1A 2MD7B 5I3LA 5G04B 3ZVYA 2F6JA 4AP4A 2MA5A 3T6RA 3M62A 4YC9A 4UP0A 2VJEB 3O34A 3C5KA 1K2FA 1VD4A 2VPGA 2Y43A 2XB1A 2QIZA 2AN6A 2K1JA 3NG2A 2D8SA 3O33A 1WEUA 2VPEA 2FUIA 4QF2A 3DQVR 4O64A 2MD8C 1WEMA 1MM2A 4LLBA 3KQIA 1F62A 4YAXA 2JMIA 2CSYA 2E6SA 2Y1NA 3L1XA 3HTKC 4I7DA 1Z6UA 2ECGA 2CKLA 5DKAA 2ECIA 3SHBA 2HYED 1HYJA 2ECVA 4MSXA 2ECTA 2FSAA 4IC2A 5DINA 3ASLA 1LDJB 3GV4A 4L7XA 4X3GA 3L1ZB 2L5UA 3SOUA 5LKZA 2VJFB 2VNFA 1FP0A 3O7AA 2YSJA 2LXHC 1G25A 3L11A 3LQIA 3U5PA 5FERA 4I7CA
chains in the Genus database with same CATH superfamily
3VK6A 2P57A 5TBNA 3RPGB 2M85A 2LN0A 4V3LC 4FK5A 3ZPVE 3SOXA 3EB6A 5AITA 2YT5A 3M63A 3EB5A 4ZDTA 3IHPA 5D1LB 1Z2QA 4R2YA 2IQJA 2MNYA 3HCSA 2YQLA 5SVIA 1E4UA 4IC3A 2XOZA 2LGVA 1MM3A 1DVPA 5LKXA 2ECJA 2M13A 1WIMA 1N87A 5FB0A 3O36A 2RI7A 4F1PA 2HDPA 2QJ0A 3KV6A 4Q6FA 1WFKA 2ZETC 2CSZA 3LVRE 2KFTA 2LAUA 4LKAA 2VP7A 5B75A 4LJNA 2LRIC 2FD4A 2MNZA 3HCUA 3N9QA 2JMDA 1Z60A 3C6WA 2M3HA 3HCTA 2M1RA 2MIQA 1WEVA 1X4JA 4Z0OA 1WEEA 2EGPA 4UP5A 2LDRA 5C13A 2XOYA 4YADA 2B0OE 2KR4A 5H1UA 4BHWA 2MA6A 2KE1A 2F42A 3M99A 2CONA 1ZBDB 3QZVA 1VFYA 2G43A 2VPBA 2CT2A 1LDKC 2L43A 4GNEA 2CRRA 2H0DB 3RTRB 2LGKA 4F52B 2PNXA 4UI9B 3N9NA 2C2VS 4ZQLA 2VJEA 1IYMA 1WEWA 5B77A 1HYIA 1WEOA 2Y1MA 5C11A 1FBVA 2KREA 3FEHA 3Q1DA 5EYAF 4CA1A 5B79A 4AYCA 2YSMA 2CSVA 2E6RA 3LDYA 2VJFA 2MT5A 4TKPB 5B76A 4YBSA 4OGCA 4L58A 3FANA 5J3XA 1JM7B 1JM7A 4NN2A 3M7KA 1X4UA 1T1HA 4FO9A 4ZUXU 5K3QA 2YYRA 3O47A 2KGIA 2QICA 3T7LA 1XWHA 2VPDA 2DSMA 2LXPC 2L80A 3LQJA 3LVQE 3MHHA 2KWJA 3O35A 4R7EA 1BORA 3V43A 4GNFA 3LRQA 3FL2A 3FJUB 4FJCA 3FAOA 2KWKA 5LKUA 3ZPV1 1WILA 2KU3A 4YBMA 1WEQA 2LGGA 1MBMA 4LK9A 5G05B 5KH7A 1WEPA 4B7YC 2C2LA 4R8PK 1DCQA 5LKTA 3FM8C 5TDWA 2UZGA 4AUQB 2JM3A 2G45A 2L0BA 4PPEA 3U5NA 2YHNA 4XI1A 4S3OB 2EGMA 3RPGC 4W4UA 4I7BA 3U5OA 3KV5A 4AVXA 2YURA 3MHSA 2RR4A 2EODA 5TRBA 4MVTA 2KIZA 4N3WA 4WA6A 1X4IA 4BBQA 4N4FA 2K17A 4GB0A 5B8DA 4LADB 2XEUA 2KKYA 3E2DA 3N9MA 5TABA 3ZTGA 3U5MA 2PUYA 3PURA 5G0FA 4AYCB 5D1KB 2KWNA 3H7HA 3PHDA 3I2DA 4YATA 4YABA 2ECWA 2LGLA 5SVXA 2BAYA 2KYUA 2EA6A 5D1MB 5SVIB 4S3OC 3PUQA 3N9PA 2NAAA 2EXUA 4GNDA 4PTBA 2YW8A 2KGGA 2YREA 4WZ2A 3GL6A 5LCWB 5H1VA 4V3KC 3ZVZB 2H0DA 4H9DA 4A4BA 4P5OB 2G6QA 3DPLR 5TDRA 3O70A 2I50A 2L75A 1WE9A 2FUUA 3KNVA 3N9LA 1VYXA 4Z0RA 4FIPA 3ZYQA 5AIUA 3ZNIA 2OWAA 2D8UA 4C9ZA 2L7PA 2KKXA 2KWOA 2CRWA 2ECNA 4GNGA 1CHCA 5KH3A 1WENA 2LQ6A 3MDBC 2IDAA 1WESA 2JRJA 5H1TA 2YHOA 5H9MA 2YU4A 4A0CD 2JMJA 4QQ4A 2YQMA 2RSDA 3T9KA 2DX8A 3SOWA 2YUCA 1JOCA 3LQHA 2MUMA 1U6GB 5JG6A 3N9OA 2OXQC 2M6MA 3O37A 2F6NA 5B78A 4WZ3B 1V87A 1WGMA 3DWDA 4A49A 2CKLB 2LV9A 4YBTA 4QF3A 4CCGX 4WZ0A 2K4DA 4B86C 3DDTA 1RMDA 2K16A 5FEYA 2XOCA 3JUEA 5KH9A 4A4CA 5FB1A 2MD7B 2YVRA 3LJUX 5I3LA 5SVYA 5G04B 3ZVYA 2F6JA 4AP4A 2FFWA 2MA5A 3T6RA 3M62A 4YC9A 4UP0A 2VJEB 3O34A 3C5KA 1K2FA 1VD4A 2VPGA 2Y43A 2XB1A 2QIZA 2AN6A 2K1JA 3NG2A 2D8SA 3O33A 1WEUA 2VPEA 2FUIA 3SUBA 4QF2A 3DQVR 4O64A 4O62A 2MD8C 3PLWA 1WEMA 1MM2A 4LLBA 3KQIA 1F62A 3KDEC 4YAXA 2JMIA 2CSYA 2E6SA 2DJAA 2Y1NA 3L1XA 3HTKC 4I7DA 1Z6UA 2ECGA 2CKLA 5DKAA 2ECIA 3SHBA 2HYED 1HYJA 2ECVA 4MSXA 2ECTA 2FSAA 4IC2A 5DINA 3ASLA 1LDJB 2E61A 3GV4A 4L7XA 4X3GA 3L1ZB 2L5UA 4OGEA 3SOUA 5LKZA 2MKEA 2VJFB 2VNFA 1FP0A 3O7AA 2YSJA 2LXHC 2XP0A 1G25A 3L11A 3LQIA 3U5PA 5FERA 4I7CA 2JUNA
chains in the Genus database with same CATH topology
3VK6A 5TBNA 3RPGB 2M85A 2LN0A 4V3LC 4FK5A 3ZPVE 3SOXA 3EB6A 5AITA 2YT5A 3M63A 3EB5A 4ZDTA 3IHPA 5D1LB 1Z2QA 4R2YA 2MNYA 3HCSA 2YQLA 1E4UA 4IC3A 2LGVA 1MM3A 1DVPA 5LKXA 2ECJA 1WIMA 1N87A 5FB0A 3O36A 2RI7A 2HDPA 2QJ0A 3KV6A 4Q6FA 1WFKA 2ZETC 2CSZA 2KFTA 4LKAA 2VP7A 5B75A 4LJNA 2LRIC 2MNZA 3HCUA 3N9QA 2JMDA 1Z60A 3C6WA 2M3HA 3HCTA 2M1RA 2MIQA 1WEVA 1X4JA 1WEEA 2EGPA 4UP5A 2LDRA 5C13A 4YADA 2KR4A 5H1UA 4BHWA 2MA6A 2KE1A 2F42A 3M99A 1ZBDB 3QZVA 1VFYA 2G43A 2VPBA 2CT2A 1LDKC 2L43A 4GNEA 2H0DB 3RTRB 2LGKA 4F52B 2PNXA 4UI9B 3N9NA 2C2VS 4ZQLA 2VJEA 1IYMA 1WEWA 5B77A 1HYIA 1WEOA 2Y1MA 5C11A 1FBVA 2KREA 5EYAF 4CA1A 5B79A 4AYCA 2YSMA 2E6RA 2VJFA 2MT5A 4TKPB 5B76A 4YBSA 4L58A 5J3XA 1JM7B 1JM7A 4NN2A 1X4UA 1T1HA 4FO9A 4ZUXU 2YYRA 2KGIA 2QICA 3T7LA 1XWHA 2VPDA 2LXPC 2L80A 3LQJA 3MHHA 2KWJA 3O35A 4R7EA 1BORA 3V43A 4GNFA 3LRQA 3FL2A 4FJCA 2KWKA 5LKUA 3ZPV1 1WILA 2KU3A 4YBMA 1WEQA 2LGGA 4LK9A 5G05B 5KH7A 1WEPA 4B7YC 2C2LA 4R8PK 5LKTA 5TDWA 2UZGA 4AUQB 2G45A 2L0BA 4PPEA 3U5NA 2YHNA 4XI1A 4S3OB 3RPGC 4W4UA 4I7BA 3U5OA 3KV5A 4AVXA 2YURA 3MHSA 2EODA 5TRBA 4MVTA 2KIZA 4N3WA 4WA6A 1X4IA 4BBQA 4N4FA 2K17A 4GB0A 5B8DA 4LADB 2XEUA 3N9MA 5TABA 3ZTGA 3U5MA 2PUYA 3PURA 5G0FA 4AYCB 5D1KB 2KWNA 3PHDA 3I2DA 4YATA 4YABA 2ECWA 2LGLA 2BAYA 2KYUA 2EA6A 5D1MB 4S3OC 3PUQA 3N9PA 2NAAA 4GNDA 4PTBA 2YW8A 2KGGA 2YREA 4WZ2A 3GL6A 5LCWB 5H1VA 4V3KC 3ZVZB 2H0DA 4A4BA 4P5OB 2G6QA 3DPLR 5TDRA 3O70A 2I50A 2L75A 1WE9A 2FUUA 3KNVA 3N9LA 1VYXA 4FIPA 3ZYQA 5AIUA 3ZNIA 4C9ZA 2KWOA 2ECNA 4GNGA 1CHCA 5KH3A 1WENA 2LQ6A 2IDAA 1WESA 2JRJA 5H1TA 2YHOA 5H9MA 2YU4A 4A0CD 2JMJA 2YQMA 2RSDA 2DX8A 3SOWA 2YUCA 1JOCA 3LQHA 2MUMA 1U6GB 5JG6A 3N9OA 2OXQC 2M6MA 3O37A 2F6NA 5B78A 4WZ3B 1V87A 1WGMA 4A49A 2CKLB 2LV9A 4YBTA 4QF3A 4CCGX 4WZ0A 2K4DA 4B86C 1RMDA 2K16A 5FEYA 5KH9A 4A4CA 5FB1A 2MD7B 5I3LA 5G04B 3ZVYA 2F6JA 4AP4A 2MA5A 3T6RA 3M62A 4YC9A 4UP0A 2VJEB 3O34A 3C5KA 1K2FA 1VD4A 2VPGA 2Y43A 2XB1A 2QIZA 2AN6A 2K1JA 3NG2A 2D8SA 3O33A 1WEUA 2VPEA 2FUIA 4QF2A 3DQVR 4O64A 2MD8C 1WEMA 1MM2A 4LLBA 3KQIA 1F62A 4YAXA 2JMIA 2CSYA 2E6SA 2Y1NA 3L1XA 3HTKC 4I7DA 1Z6UA 2ECGA 2CKLA 5DKAA 2ECIA 3SHBA 2HYED 1HYJA 2ECVA 4MSXA 2ECTA 2FSAA 4IC2A 5DINA 3ASLA 1LDJB 3GV4A 4L7XA 4X3GA 3L1ZB 2L5UA 3SOUA 5LKZA 2VJFB 2VNFA 1FP0A 3O7AA 2YSJA 2LXHC 1G25A 3L11A 3LQIA 3U5PA 5FERA 4I7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VK6 A;  5TBN A;  3RPG B;  2M85 A;  2LN0 A;  4V3L C;  4FK5 A;  3ZPV E;  3SOX A;  3EB6 A;  5AIT A;  2YT5 A;  3M63 A;  3EB5 A;  4ZDT A;  3IHP A;  5D1L B;  1Z2Q A;  4R2Y A;  2MNY A;  3HCS A;  2YQL A;  1E4U A;  4IC3 A;  2LGV A;  1MM3 A;  1DVP A;  5LKX A;  2ECJ A;  1WIM A;  1N87 A;  5FB0 A;  3O36 A;  2RI7 A;  2HDP A;  2QJ0 A;  3KV6 A;  4Q6F A;  1WFK A;  2ZET C;  2CSZ A;  2KFT A;  4LKA A;  2VP7 A;  5B75 A;  4LJN A;  2LRI C;  2MNZ A;  3HCU A;  3N9Q A;  2JMD A;  1Z60 A;  3C6W A;  2M3H A;  3HCT A;  2M1R A;  2MIQ A;  1WEV A;  1X4J A;  1WEE A;  2EGP A;  4UP5 A;  2LDR A;  5C13 A;  4YAD A;  2KR4 A;  5H1U A;  4BHW A;  2MA6 A;  2KE1 A;  2F42 A;  3M99 A;  1ZBD B;  3QZV A;  1VFY A;  2G43 A;  2VPB A;  2CT2 A;  1LDK C;  2L43 A;  4GNE A;  2H0D B;  3RTR B;  2LGK A;  4F52 B;  2PNX A;  4UI9 B;  3N9N A;  2C2V S;  4ZQL A;  2VJE A;  1IYM A;  1WEW A;  5B77 A;  1HYI A;  1WEO A;  2Y1M A;  5C11 A;  1FBV A;  2KRE A;  5EYA F;  4CA1 A;  5B79 A;  4AYC A;  2YSM A;  2E6R A;  2VJF A;  2MT5 A;  4TKP B;  5B76 A;  4YBS A;  4L58 A;  5J3X A;  1JM7 B;  1JM7 A;  4NN2 A;  1X4U A;  1T1H A;  4FO9 A;  4ZUX U;  2YYR A;  2KGI A;  2QIC A;  3T7L A;  1XWH A;  2VPD A;  2LXP C;  2L80 A;  3LQJ A;  3MHH A;  2KWJ A;  3O35 A;  4R7E A;  1BOR A;  3V43 A;  4GNF A;  3LRQ A;  3FL2 A;  4FJC A;  2KWK A;  5LKU A;  3ZPV 1;  1WIL A;  2KU3 A;  4YBM A;  1WEQ A;  2LGG A;  4LK9 A;  5G05 B;  5KH7 A;  1WEP A;  4B7Y C;  2C2L A;  4R8P K;  5LKT A;  5TDW A;  2UZG A;  4AUQ B;  2G45 A;  2L0B A;  4PPE A;  3U5N A;  2YHN A;  4XI1 A;  4S3O B;  3RPG C;  4W4U A;  4I7B A;  3U5O A;  3KV5 A;  4AVX A;  2YUR A;  3MHS A;  2EOD A;  5TRB A;  4MVT A;  2KIZ A;  4N3W A;  4WA6 A;  1X4I A;  4BBQ A;  4N4F A;  2K17 A;  4GB0 A;  5B8D A;  4LAD B;  2XEU A;  3N9M A;  5TAB A;  3ZTG A;  3U5M A;  2PUY A;  3PUR A;  5G0F A;  4AYC B;  5D1K B;  2KWN A;  3PHD A;  3I2D A;  4YAT A;  4YAB A;  2ECW A;  2LGL A;  2BAY A;  2KYU A;  2EA6 A;  5D1M B;  4S3O C;  3PUQ A;  3N9P A;  2NAA A;  4GND A;  4PTB A;  2YW8 A;  2KGG A;  2YRE A;  4WZ2 A;  3GL6 A;  5LCW B;  5H1V A;  4V3K C;  3ZVZ B;  2H0D A;  4A4B A;  4P5O B;  2G6Q A;  3DPL R;  5TDR A;  3O70 A;  2I50 A;  2L75 A;  1WE9 A;  2FUU A;  3KNV A;  3N9L A;  1VYX A;  4FIP A;  3ZYQ A;  5AIU A;  3ZNI A;  4C9Z A;  2KWO A;  2ECN A;  4GNG A;  1CHC A;  5KH3 A;  1WEN A;  2LQ6 A;  2IDA A;  1WES A;  2JRJ A;  5H1T A;  2YHO A;  5H9M A;  2YU4 A;  4A0C D;  2JMJ A;  2YQM A;  2RSD A;  2DX8 A;  3SOW A;  2YUC A;  1JOC A;  3LQH A;  2MUM A;  1U6G B;  5JG6 A;  3N9O A;  2OXQ C;  2M6M A;  3O37 A;  2F6N A;  5B78 A;  4WZ3 B;  1V87 A;  1WGM A;  4A49 A;  2CKL B;  2LV9 A;  4YBT A;  4QF3 A;  4CCG X;  4WZ0 A;  2K4D A;  4B86 C;  1RMD A;  2K16 A;  5FEY A;  5KH9 A;  4A4C A;  5FB1 A;  2MD7 B;  5I3L A;  5G04 B;  3ZVY A;  2F6J A;  4AP4 A;  2MA5 A;  3T6R A;  3M62 A;  4YC9 A;  4UP0 A;  2VJE B;  3O34 A;  3C5K A;  1K2F A;  1VD4 A;  2VPG A;  2Y43 A;  2XB1 A;  2QIZ A;  2AN6 A;  2K1J A;  3NG2 A;  2D8S A;  3O33 A;  1WEU A;  2VPE A;  2FUI A;  4QF2 A;  3DQV R;  4O64 A;  2MD8 C;  1WEM A;  1MM2 A;  4LLB A;  3KQI A;  1F62 A;  4YAX A;  2JMI A;  2CSY A;  2E6S A;  2Y1N A;  3L1X A;  3HTK C;  4I7D A;  1Z6U A;  2ECG A;  2CKL A;  5DKA A;  2ECI A;  3SHB A;  2HYE D;  1HYJ A;  2ECV A;  4MSX A;  2ECT A;  2FSA A;  4IC2 A;  5DIN A;  3ASL A;  1LDJ B;  3GV4 A;  4L7X A;  4X3G A;  3L1Z B;  2L5U A;  3SOU A;  5LKZ A;  2VJF B;  2VNF A;  1FP0 A;  3O7A A;  2YSJ A;  2LXH C;  1G25 A;  3L11 A;  3LQI A;  3U5P A;  5FER A;  4I7C A; 
#chains in the Genus database with same CATH topology
 3VK6 A;  2P57 A;  5TBN A;  3RPG B;  2M85 A;  2LN0 A;  4V3L C;  4FK5 A;  3ZPV E;  3SOX A;  3EB6 A;  5AIT A;  2YT5 A;  3M63 A;  3EB5 A;  4ZDT A;  3IHP A;  5D1L B;  1Z2Q A;  4R2Y A;  2IQJ A;  2MNY A;  3HCS A;  2YQL A;  5SVI A;  1E4U A;  4IC3 A;  2XOZ A;  2LGV A;  1MM3 A;  1DVP A;  5LKX A;  2ECJ A;  2M13 A;  1WIM A;  1N87 A;  5FB0 A;  3O36 A;  2RI7 A;  4F1P A;  2HDP A;  2QJ0 A;  3KV6 A;  4Q6F A;  1WFK A;  2ZET C;  2CSZ A;  3LVR E;  2KFT A;  2LAU A;  4LKA A;  2VP7 A;  5B75 A;  4LJN A;  2LRI C;  2FD4 A;  2MNZ A;  3HCU A;  3N9Q A;  2JMD A;  1Z60 A;  3C6W A;  2M3H A;  3HCT A;  2M1R A;  2MIQ A;  1WEV A;  1X4J A;  4Z0O A;  1WEE A;  2EGP A;  4UP5 A;  2LDR A;  5C13 A;  2XOY A;  4YAD A;  2B0O E;  2KR4 A;  5H1U A;  4BHW A;  2MA6 A;  2KE1 A;  2F42 A;  3M99 A;  2CON A;  1ZBD B;  3QZV A;  1VFY A;  2G43 A;  2VPB A;  2CT2 A;  1LDK C;  2L43 A;  4GNE A;  2CRR A;  2H0D B;  3RTR B;  2LGK A;  4F52 B;  2PNX A;  4UI9 B;  3N9N A;  2C2V S;  4ZQL A;  2VJE A;  1IYM A;  1WEW A;  5B77 A;  1HYI A;  1WEO A;  2Y1M A;  5C11 A;  1FBV A;  2KRE A;  3FEH A;  3Q1D A;  5EYA F;  4CA1 A;  5B79 A;  4AYC A;  2YSM A;  2CSV A;  2E6R A;  3LDY A;  2VJF A;  2MT5 A;  4TKP B;  5B76 A;  4YBS A;  4OGC A;  4L58 A;  3FAN A;  5J3X A;  1JM7 B;  1JM7 A;  4NN2 A;  3M7K A;  1X4U A;  1T1H A;  4FO9 A;  4ZUX U;  5K3Q A;  2YYR A;  3O47 A;  2KGI A;  2QIC A;  3T7L A;  1XWH A;  2VPD A;  2DSM A;  2LXP C;  2L80 A;  3LQJ A;  3LVQ E;  3MHH A;  2KWJ A;  3O35 A;  4R7E A;  1BOR A;  3V43 A;  4GNF A;  3LRQ A;  3FL2 A;  3FJU B;  4FJC A;  3FAO A;  2KWK A;  5LKU A;  3ZPV 1;  1WIL A;  2KU3 A;  4YBM A;  1WEQ A;  2LGG A;  1MBM A;  4LK9 A;  5G05 B;  5KH7 A;  1WEP A;  4B7Y C;  2C2L A;  4R8P K;  1DCQ A;  5LKT A;  3FM8 C;  5TDW A;  2UZG A;  4AUQ B;  2JM3 A;  2G45 A;  2L0B A;  4PPE A;  3U5N A;  2YHN A;  4XI1 A;  4S3O B;  2EGM A;  3RPG C;  4W4U A;  4I7B A;  3U5O A;  3KV5 A;  4AVX A;  2YUR A;  3MHS A;  2RR4 A;  2EOD A;  5TRB A;  4MVT A;  2KIZ A;  4N3W A;  4WA6 A;  1X4I A;  4BBQ A;  4N4F A;  2K17 A;  4GB0 A;  5B8D A;  4LAD B;  2XEU A;  2KKY A;  3E2D A;  3N9M A;  5TAB A;  3ZTG A;  3U5M A;  2PUY A;  3PUR A;  5G0F A;  4AYC B;  5D1K B;  2KWN A;  3H7H A;  3PHD A;  3I2D A;  4YAT A;  4YAB A;  2ECW A;  2LGL A;  5SVX A;  2BAY A;  2KYU A;  2EA6 A;  5D1M B;  5SVI B;  4S3O C;  3PUQ A;  3N9P A;  2NAA A;  2EXU A;  4GND A;  4PTB A;  2YW8 A;  2KGG A;  2YRE A;  4WZ2 A;  3GL6 A;  5LCW B;  5H1V A;  4V3K C;  3ZVZ B;  2H0D A;  4H9D A;  4A4B A;  4P5O B;  2G6Q A;  3DPL R;  5TDR A;  3O70 A;  2I50 A;  2L75 A;  1WE9 A;  2FUU A;  3KNV A;  3N9L A;  1VYX A;  4Z0R A;  4FIP A;  3ZYQ A;  5AIU A;  3ZNI A;  2OWA A;  2D8U A;  4C9Z A;  2L7P A;  2KKX A;  2KWO A;  2CRW A;  2ECN A;  4GNG A;  1CHC A;  5KH3 A;  1WEN A;  2LQ6 A;  3MDB C;  2IDA A;  1WES A;  2JRJ A;  5H1T A;  2YHO A;  5H9M A;  2YU4 A;  4A0C D;  2JMJ A;  4QQ4 A;  2YQM A;  2RSD A;  3T9K A;  2DX8 A;  3SOW A;  2YUC A;  1JOC A;  3LQH A;  2MUM A;  1U6G B;  5JG6 A;  3N9O A;  2OXQ C;  2M6M A;  3O37 A;  2F6N A;  5B78 A;  4WZ3 B;  1V87 A;  1WGM A;  3DWD A;  4A49 A;  2CKL B;  2LV9 A;  4YBT A;  4QF3 A;  4CCG X;  4WZ0 A;  2K4D A;  4B86 C;  3DDT A;  1RMD A;  2K16 A;  5FEY A;  2XOC A;  3JUE A;  5KH9 A;  4A4C A;  5FB1 A;  2MD7 B;  2YVR A;  3LJU X;  5I3L A;  5SVY A;  5G04 B;  3ZVY A;  2F6J A;  4AP4 A;  2FFW A;  2MA5 A;  3T6R A;  3M62 A;  4YC9 A;  4UP0 A;  2VJE B;  3O34 A;  3C5K A;  1K2F A;  1VD4 A;  2VPG A;  2Y43 A;  2XB1 A;  2QIZ A;  2AN6 A;  2K1J A;  3NG2 A;  2D8S A;  3O33 A;  1WEU A;  2VPE A;  2FUI A;  3SUB A;  4QF2 A;  3DQV R;  4O64 A;  4O62 A;  2MD8 C;  3PLW A;  1WEM A;  1MM2 A;  4LLB A;  3KQI A;  1F62 A;  3KDE C;  4YAX A;  2JMI A;  2CSY A;  2E6S A;  2DJA A;  2Y1N A;  3L1X A;  3HTK C;  4I7D A;  1Z6U A;  2ECG A;  2CKL A;  5DKA A;  2ECI A;  3SHB A;  2HYE D;  1HYJ A;  2ECV A;  4MSX A;  2ECT A;  2FSA A;  4IC2 A;  5DIN A;  3ASL A;  1LDJ B;  2E61 A;  3GV4 A;  4L7X A;  4X3G A;  3L1Z B;  2L5U A;  4OGE A;  3SOU A;  5LKZ A;  2MKE A;  2VJF B;  2VNF A;  1FP0 A;  3O7A A;  2YSJ A;  2LXH C;  2XP0 A;  1G25 A;  3L11 A;  3LQI A;  3U5P A;  5FER A;  4I7C A;  2JUN A; 
#chains in the Genus database with same CATH homology
 3VK6 A;  5TBN A;  3RPG B;  2M85 A;  2LN0 A;  4V3L C;  4FK5 A;  3ZPV E;  3SOX A;  3EB6 A;  5AIT A;  2YT5 A;  3M63 A;  3EB5 A;  4ZDT A;  3IHP A;  5D1L B;  1Z2Q A;  4R2Y A;  2MNY A;  3HCS A;  2YQL A;  1E4U A;  4IC3 A;  2LGV A;  1MM3 A;  1DVP A;  5LKX A;  2ECJ A;  1WIM A;  1N87 A;  5FB0 A;  3O36 A;  2RI7 A;  2HDP A;  2QJ0 A;  3KV6 A;  4Q6F A;  1WFK A;  2ZET C;  2CSZ A;  2KFT A;  4LKA A;  2VP7 A;  5B75 A;  4LJN A;  2LRI C;  2MNZ A;  3HCU A;  3N9Q A;  2JMD A;  1Z60 A;  3C6W A;  2M3H A;  3HCT A;  2M1R A;  2MIQ A;  1WEV A;  1X4J A;  1WEE A;  2EGP A;  4UP5 A;  2LDR A;  5C13 A;  4YAD A;  2KR4 A;  5H1U A;  4BHW A;  2MA6 A;  2KE1 A;  2F42 A;  3M99 A;  1ZBD B;  3QZV A;  1VFY A;  2G43 A;  2VPB A;  2CT2 A;  1LDK C;  2L43 A;  4GNE A;  2H0D B;  3RTR B;  2LGK A;  4F52 B;  2PNX A;  4UI9 B;  3N9N A;  2C2V S;  4ZQL A;  2VJE A;  1IYM A;  1WEW A;  5B77 A;  1HYI A;  1WEO A;  2Y1M A;  5C11 A;  1FBV A;  2KRE A;  5EYA F;  4CA1 A;  5B79 A;  4AYC A;  2YSM A;  2E6R A;  2VJF A;  2MT5 A;  4TKP B;  5B76 A;  4YBS A;  4L58 A;  5J3X A;  1JM7 B;  1JM7 A;  4NN2 A;  1X4U A;  1T1H A;  4FO9 A;  4ZUX U;  2YYR A;  2KGI A;  2QIC A;  3T7L A;  1XWH A;  2VPD A;  2LXP C;  2L80 A;  3LQJ A;  3MHH A;  2KWJ A;  3O35 A;  4R7E A;  1BOR A;  3V43 A;  4GNF A;  3LRQ A;  3FL2 A;  4FJC A;  2KWK A;  5LKU A;  3ZPV 1;  1WIL A;  2KU3 A;  4YBM A;  1WEQ A;  2LGG A;  4LK9 A;  5G05 B;  5KH7 A;  1WEP A;  4B7Y C;  2C2L A;  4R8P K;  5LKT A;  5TDW A;  2UZG A;  4AUQ B;  2G45 A;  2L0B A;  4PPE A;  3U5N A;  2YHN A;  4XI1 A;  4S3O B;  3RPG C;  4W4U A;  4I7B A;  3U5O A;  3KV5 A;  4AVX A;  2YUR A;  3MHS A;  2EOD A;  5TRB A;  4MVT A;  2KIZ A;  4N3W A;  4WA6 A;  1X4I A;  4BBQ A;  4N4F A;  2K17 A;  4GB0 A;  5B8D A;  4LAD B;  2XEU A;  3N9M A;  5TAB A;  3ZTG A;  3U5M A;  2PUY A;  3PUR A;  5G0F A;  4AYC B;  5D1K B;  2KWN A;  3PHD A;  3I2D A;  4YAT A;  4YAB A;  2ECW A;  2LGL A;  2BAY A;  2KYU A;  2EA6 A;  5D1M B;  4S3O C;  3PUQ A;  3N9P A;  2NAA A;  4GND A;  4PTB A;  2YW8 A;  2KGG A;  2YRE A;  4WZ2 A;  3GL6 A;  5LCW B;  5H1V A;  4V3K C;  3ZVZ B;  2H0D A;  4A4B A;  4P5O B;  2G6Q A;  3DPL R;  5TDR A;  3O70 A;  2I50 A;  2L75 A;  1WE9 A;  2FUU A;  3KNV A;  3N9L A;  1VYX A;  4FIP A;  3ZYQ A;  5AIU A;  3ZNI A;  4C9Z A;  2KWO A;  2ECN A;  4GNG A;  1CHC A;  5KH3 A;  1WEN A;  2LQ6 A;  2IDA A;  1WES A;  2JRJ A;  5H1T A;  2YHO A;  5H9M A;  2YU4 A;  4A0C D;  2JMJ A;  2YQM A;  2RSD A;  2DX8 A;  3SOW A;  2YUC A;  1JOC A;  3LQH A;  2MUM A;  1U6G B;  5JG6 A;  3N9O A;  2OXQ C;  2M6M A;  3O37 A;  2F6N A;  5B78 A;  4WZ3 B;  1V87 A;  1WGM A;  4A49 A;  2CKL B;  2LV9 A;  4YBT A;  4QF3 A;  4CCG X;  4WZ0 A;  2K4D A;  4B86 C;  1RMD A;  2K16 A;  5FEY A;  5KH9 A;  4A4C A;  5FB1 A;  2MD7 B;  5I3L A;  5G04 B;  3ZVY A;  2F6J A;  4AP4 A;  2MA5 A;  3T6R A;  3M62 A;  4YC9 A;  4UP0 A;  2VJE B;  3O34 A;  3C5K A;  1K2F A;  1VD4 A;  2VPG A;  2Y43 A;  2XB1 A;  2QIZ A;  2AN6 A;  2K1J A;  3NG2 A;  2D8S A;  3O33 A;  1WEU A;  2VPE A;  2FUI A;  4QF2 A;  3DQV R;  4O64 A;  2MD8 C;  1WEM A;  1MM2 A;  4LLB A;  3KQI A;  1F62 A;  4YAX A;  2JMI A;  2CSY A;  2E6S A;  2Y1N A;  3L1X A;  3HTK C;  4I7D A;  1Z6U A;  2ECG A;  2CKL A;  5DKA A;  2ECI A;  3SHB A;  2HYE D;  1HYJ A;  2ECV A;  4MSX A;  2ECT A;  2FSA A;  4IC2 A;  5DIN A;  3ASL A;  1LDJ B;  3GV4 A;  4L7X A;  4X3G A;  3L1Z B;  2L5U A;  3SOU A;  5LKZ A;  2VJF B;  2VNF A;  1FP0 A;  3O7A A;  2YSJ A;  2LXH C;  1G25 A;  3L11 A;  3LQI A;  3U5P A;  5FER A;  4I7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...