2LXPC

Nmr structure of two domains in ubiquitin ligase gp78, ring and g2br, bound to its conjugating enzyme ube2g
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
AVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 G2
publication title Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lxpC00
2VJEB 4N3WA 2VJFB 3M63A 1WEOA 1WENA 3RPGC 1MM2A 4LJNA 2JMJA 3L1XA 4AYCA 1WFKA 3HCTA 2EGPA 4ZUXU 4TKPB 1WEVA 4GNDA 4Q6FA 5C11A 1HYIA 3C5KA 2CKLB 2E6SA 2AN6A 5LKTA 4YABA 4A0CD 3O36A 2XB1A 4PPEA 2I50A 4YBTA 4P5OB 2LV9A 2Y1NA 4UP5A 2XEUA 4B86C 3LRQA 4IC3A 5LKUA 2JMDA 5C13A 3ZPVE 4CCGX 5B78A 2OXQC 3GV4A 1T1HA 4BHWA 4GNEA 3QZVA 2EODA 2ECNA 4I7DA 2LGVA 2CT2A 2RI7A 2KGIA 4GNFA 1X4JA 4AYCB 2G6QA 3DPLR 1MM3A 2VPBA 4LADB 4CA1A 1WEUA 2MA5A 2KWKA 4GNGA 1E4UA 2L75A 3O34A 2F42A 3GL6A 4XI1A 3N9NA 1Z2QA 3ASLA 1DVPA 3PHDA 5KH9A 4L58A 2BAYA 3N9PA 3N9QA 1WIMA 3IHPA 2ECTA 2MNZA 2F6JA 2VNFA 1WILA 5H9MA 4MVTA 2L43A 2ECWA 4GB0A 4N4FA 4I7BA 3SHBA 2DX8A 2M85A 2KWNA 3LQIA 3HTKC 2FUIA 3SOWA 2HYED 2LN0A 1RMDA 2H0DB 5FB0A 5TRBA 2VP7A 4WZ3B 3ZYQA 4LLBA 2KE1A 2Y43A 4NN2A 2M6MA 2KIZA 2Y1MA 3L1ZB 3DQVR 2LXHC 1WEWA 4FK5A 2YSJA 4F52B 1V87A 3LQHA 1WE9A 2C2VS 5H1VA 1WEEA 3PURA 3VK6A 5JG6A 1JOCA 2KWOA 3EB5A 1U6GB 4A4CA 4LKAA 2MIQA 3NG2A 4FO9A 2E6RA 2CSZA 4B7YC 4R8PK 3FL2A 4FJCA 2YT5A 2F6NA 2YHOA 2H0DA 3U5OA 1Z60A 1VD4A 1JM7A 5D1LB 3KQIA 2M1RA 5TBNA 4X3GA 2G43A 5KH3A 4ZDTA 2L0BA 3I2DA 4YADA 3KV5A 2YYRA 1IYMA 2MD8C 5G0FA 5B77A 4QF2A 3SOUA 3T7LA 3LQJA 2LXPC 2PUYA 4WZ0A 2C2LA 2L80A 5H1UA 3O7AA 3MHHA 4MSXA 3ZPV1 5H1TA 2KR4A 3N9MA 2LGLA 3ZVYA 4S3OB 2VPGA 3O70A 5G04B 4W4UA 1X4UA 3M99A 1FP0A 2QJ0A 1Z6UA 4R7EA 2JRJA 4PTBA 2VPDA 2D8SA 5AITA 2K4DA 2FSAA 2LQ6A 4A49A 4A4BA 2YSMA 1F62A 4I7CA 5B8DA 3ZVZB 2CSYA 4YATA 1JM7B 4LK9A 5B79A 2KU3A 4YBSA 2YURA 3N9OA 3RPGB 2IDAA 2JMIA 1WEMA 1XWHA 5B75A 3ZTGA 2ZETC 4V3LC 1FBVA 2FUUA 2PNXA 4ZQLA 1BORA 2YW8A 5TABA 4BBQA 2ECJA 5D1KB 5KH7A 4WA6A 2MNYA 2YQMA 5FERA 1VYXA 2YU4A 5AIUA 4R2YA 3L11A 5B76A 2L5UA 5G05B 2YQLA 4YBMA 5DKAA 5LKXA 3KV6A 2MD7B 2VPEA 3C6WA 2LGGA 2ECVA 1HYJA 5LCWB 4L7XA 1G25A 5FB1A 5LKZA 4IC2A 3V43A 5TDWA 2K16A 4UI9B 3PUQA 2M3HA 1X4IA 2MA6A 3RTRB 5D1MB 2LDRA 2K17A 1LDJB 2LRIC 2HDPA 2VJEA 3EB6A 5DINA 3MHSA 3ZNIA 2VJFA 2RSDA 1VFYA 5EYAF 2YREA 2YUCA 4FIPA 2KWJA 4O64A 3T6RA 4YAXA 2NAAA 2QICA 4YC9A 3N9LA 2QIZA 3U5NA 2EA6A 5I3LA 2G45A 4S3OC 2K1JA 2KGGA 3U5PA 3HCSA 2CKLA 2KFTA 3KNVA 3U5MA 2YHNA 2KREA 4UP0A 2UZGA 1N87A 1K2FA 5J3XA 1WEPA 3HCUA 3SOXA 2KYUA 5FEYA 4AUQB 4AP4A 1WESA 1WEQA 2LGKA 3O33A 3M62A 4WZ2A 3O35A 4QF3A 4C9ZA 5TDRA 2MUMA 4V3KC 1WGMA 2ECIA 4AVXA 1CHCA 2ECGA 1ZBDB 2MT5A 3O37A 1LDKC
chains in the Genus database with same CATH superfamily
2VJEB 4N3WA 2VJFB 3M63A 1WEOA 1WENA 3RPGC 1MM2A 4LJNA 2JMJA 2JM3A 3L1XA 2EGMA 3PLWA 4AYCA 1WFKA 3HCTA 2EGPA 4ZUXU 4TKPB 1WEVA 4GNDA 4Q6FA 5C11A 1HYIA 4O62A 3C5KA 2CKLB 2E6SA 2AN6A 5LKTA 4YABA 2XOYA 4A0CD 2CSVA 3O36A 2XB1A 4PPEA 2EXUA 2I50A 4YBTA 4P5OB 2LV9A 2L7PA 2Y1NA 4UP5A 2XEUA 4B86C 3LRQA 4IC3A 5LKUA 4OGEA 2JMDA 5C13A 3SUBA 3ZPVE 4CCGX 5B78A 2OXQC 3GV4A 1T1HA 4BHWA 5SVYA 4GNEA 3QZVA 2EODA 2ECNA 4I7DA 2LGVA 2CT2A 2RI7A 2KGIA 4GNFA 1X4JA 4AYCB 2G6QA 3DPLR 1MM3A 2VPBA 4LADB 3FEHA 4CA1A 1WEUA 2MA5A 2KKXA 2KWKA 4GNGA 1E4UA 2L75A 3O34A 3Q1DA 2F42A 2FFWA 3GL6A 4XI1A 3E2DA 3N9NA 1DCQA 1Z2QA 3ASLA 1DVPA 3PHDA 5KH9A 4L58A 2BAYA 3N9PA 3N9QA 1WIMA 3IHPA 2ECTA 2MNZA 2F6JA 4QQ4A 2VNFA 1WILA 5H9MA 4MVTA 2L43A 2ECWA 4GB0A 2OWAA 4N4FA 3LVRE 4I7BA 3SHBA 2DX8A 2M85A 2KWNA 3LQIA 3HTKC 2FUIA 2LAUA 3SOWA 2HYED 2LN0A 1RMDA 2FD4A 2H0DB 5FB0A 5TRBA 2VP7A 4WZ3B 3ZYQA 4LLBA 2KE1A 2Y43A 4NN2A 4H9DA 2M6MA 2E61A 2KIZA 2Y1MA 3H7HA 3L1ZB 3DQVR 2LXHC 1WEWA 4FK5A 2YSJA 4F52B 1V87A 3LQHA 1WE9A 2RR4A 2C2VS 5H1VA 1WEEA 3PURA 3VK6A 3LDYA 5JG6A 1JOCA 3MDBC 2KWOA 3EB5A 1U6GB 4A4CA 4LKAA 2MIQA 3NG2A 5K3QA 4FO9A 2E6RA 3FM8C 2CSZA 4B7YC 4R8PK 3FL2A 4FJCA 2YT5A 2F6NA 2YHOA 2H0DA 3U5OA 1Z60A 1VD4A 4OGCA 1JM7A 5D1LB 3KQIA 2M1RA 5TBNA 4X3GA 2G43A 5KH3A 4ZDTA 2KKYA 2JUNA 2L0BA 3I2DA 4YADA 3KV5A 2YYRA 1IYMA 2MD8C 5G0FA 5B77A 4QF2A 3SOUA 3LJUX 3T7LA 3LQJA 2LXPC 2PUYA 4WZ0A 2C2LA 2L80A 2XOZA 5H1UA 3O7AA 3MHHA 4MSXA 3ZPV1 3M7KA 5H1TA 2KR4A 3N9MA 2LGLA 3ZVYA 4S3OB 2VPGA 3O70A 5G04B 4W4UA 1X4UA 3M99A 2XP0A 2B0OE 1FP0A 2QJ0A 1Z6UA 4R7EA 2JRJA 4PTBA 2VPDA 2D8SA 5AITA 2K4DA 2FSAA 5SVIA 2LQ6A 4A49A 1MBMA 4A4BA 2YSMA 1F62A 4I7CA 5B8DA 3ZVZB 2MKEA 2D8UA 2CSYA 4YATA 1JM7B 4LK9A 5B79A 2KU3A 3KDEC 4YBSA 2YURA 3N9OA 3RPGB 2IDAA 4F1PA 2JMIA 1WEMA 1XWHA 5B75A 3ZTGA 2ZETC 3FANA 4V3LC 1FBVA 3DDTA 2FUUA 2PNXA 4ZQLA 1BORA 2YW8A 5TABA 4BBQA 2ECJA 5D1KB 5KH7A 4Z0RA 4WA6A 2MNYA 2YQMA 5FERA 1VYXA 2YU4A 5AIUA 4R2YA 3L11A 5B76A 2L5UA 5G05B 2YQLA 4YBMA 2CRWA 5DKAA 5LKXA 3KV6A 5SVXA 5SVIB 3O47A 2MD7B 2VPEA 3C6WA 2LGGA 2ECVA 1HYJA 5LCWB 4L7XA 1G25A 5FB1A 5LKZA 4IC2A 3V43A 5TDWA 2K16A 4UI9B 3PUQA 3T9KA 2M3HA 1X4IA 2MA6A 3RTRB 5D1MB 2LDRA 2XOCA 2K17A 1LDJB 3JUEA 2LRIC 2HDPA 2CRRA 2VJEA 2IQJA 3EB6A 5DINA 3MHSA 3ZNIA 2VJFA 2RSDA 1VFYA 5EYAF 2YREA 2YUCA 4FIPA 2KWJA 4O64A 3T6RA 4YAXA 2NAAA 2QICA 4YC9A 3N9LA 2QIZA 2P57A 3U5NA 2EA6A 2CONA 5I3LA 2G45A 4S3OC 2K1JA 2KGGA 3FJUB 3LVQE 3U5PA 2YVRA 3HCSA 2CKLA 2KFTA 3KNVA 3U5MA 2YHNA 2KREA 2DJAA 4UP0A 2UZGA 1N87A 1K2FA 1WEPA 3HCUA 5FEYA 2KYUA 5J3XA 3FAOA 3SOXA 4AUQB 4AP4A 1WESA 1WEQA 2LGKA 3O33A 3M62A 4WZ2A 3O35A 4Z0OA 4QF3A 2DSMA 2M13A 4C9ZA 5TDRA 2MUMA 4V3KC 3DWDA 1WGMA 2ECIA 4AVXA 1CHCA 2ECGA 1ZBDB 2MT5A 3O37A 1LDKC
chains in the Genus database with same CATH topology
2VJEB 4N3WA 2VJFB 3M63A 1WEOA 1WENA 3RPGC 1MM2A 4LJNA 2JMJA 3L1XA 4AYCA 1WFKA 3HCTA 2EGPA 4ZUXU 4TKPB 1WEVA 4GNDA 4Q6FA 5C11A 1HYIA 3C5KA 2CKLB 2E6SA 2AN6A 5LKTA 4YABA 4A0CD 3O36A 2XB1A 4PPEA 2I50A 4YBTA 4P5OB 2LV9A 2Y1NA 4UP5A 2XEUA 4B86C 3LRQA 4IC3A 5LKUA 2JMDA 5C13A 3ZPVE 4CCGX 5B78A 2OXQC 3GV4A 1T1HA 4BHWA 4GNEA 3QZVA 2EODA 2ECNA 4I7DA 2LGVA 2CT2A 2RI7A 2KGIA 4GNFA 1X4JA 4AYCB 2G6QA 3DPLR 1MM3A 2VPBA 4LADB 4CA1A 1WEUA 2MA5A 2KWKA 4GNGA 1E4UA 2L75A 3O34A 2F42A 3GL6A 4XI1A 3N9NA 1Z2QA 3ASLA 1DVPA 3PHDA 5KH9A 4L58A 2BAYA 3N9PA 3N9QA 1WIMA 3IHPA 2ECTA 2MNZA 2F6JA 2VNFA 1WILA 5H9MA 4MVTA 2L43A 2ECWA 4GB0A 4N4FA 4I7BA 3SHBA 2DX8A 2M85A 2KWNA 3LQIA 3HTKC 2FUIA 3SOWA 2HYED 2LN0A 1RMDA 2H0DB 5FB0A 5TRBA 2VP7A 4WZ3B 3ZYQA 4LLBA 2KE1A 2Y43A 4NN2A 2M6MA 2KIZA 2Y1MA 3L1ZB 3DQVR 2LXHC 1WEWA 4FK5A 2YSJA 4F52B 1V87A 3LQHA 1WE9A 2C2VS 5H1VA 1WEEA 3PURA 3VK6A 5JG6A 1JOCA 2KWOA 3EB5A 1U6GB 4A4CA 4LKAA 2MIQA 3NG2A 4FO9A 2E6RA 2CSZA 4B7YC 4R8PK 3FL2A 4FJCA 2YT5A 2F6NA 2YHOA 2H0DA 3U5OA 1Z60A 1VD4A 1JM7A 5D1LB 3KQIA 2M1RA 5TBNA 4X3GA 2G43A 5KH3A 4ZDTA 2L0BA 3I2DA 4YADA 3KV5A 2YYRA 1IYMA 2MD8C 5G0FA 5B77A 4QF2A 3SOUA 3T7LA 3LQJA 2LXPC 2PUYA 4WZ0A 2C2LA 2L80A 5H1UA 3O7AA 3MHHA 4MSXA 3ZPV1 5H1TA 2KR4A 3N9MA 2LGLA 3ZVYA 4S3OB 2VPGA 3O70A 5G04B 4W4UA 1X4UA 3M99A 1FP0A 2QJ0A 1Z6UA 4R7EA 2JRJA 4PTBA 2VPDA 2D8SA 5AITA 2K4DA 2FSAA 2LQ6A 4A49A 4A4BA 2YSMA 1F62A 4I7CA 5B8DA 3ZVZB 2CSYA 4YATA 1JM7B 4LK9A 5B79A 2KU3A 4YBSA 2YURA 3N9OA 3RPGB 2IDAA 2JMIA 1WEMA 1XWHA 5B75A 3ZTGA 2ZETC 4V3LC 1FBVA 2FUUA 2PNXA 4ZQLA 1BORA 2YW8A 5TABA 4BBQA 2ECJA 5D1KB 5KH7A 4WA6A 2MNYA 2YQMA 5FERA 1VYXA 2YU4A 5AIUA 4R2YA 3L11A 5B76A 2L5UA 5G05B 2YQLA 4YBMA 5DKAA 5LKXA 3KV6A 2MD7B 2VPEA 3C6WA 2LGGA 2ECVA 1HYJA 5LCWB 4L7XA 1G25A 5FB1A 5LKZA 4IC2A 3V43A 5TDWA 2K16A 4UI9B 3PUQA 2M3HA 1X4IA 2MA6A 3RTRB 5D1MB 2LDRA 2K17A 1LDJB 2LRIC 2HDPA 2VJEA 3EB6A 5DINA 3MHSA 3ZNIA 2VJFA 2RSDA 1VFYA 5EYAF 2YREA 2YUCA 4FIPA 2KWJA 4O64A 3T6RA 4YAXA 2NAAA 2QICA 4YC9A 3N9LA 2QIZA 3U5NA 2EA6A 5I3LA 2G45A 4S3OC 2K1JA 2KGGA 3U5PA 3HCSA 2CKLA 2KFTA 3KNVA 3U5MA 2YHNA 2KREA 4UP0A 2UZGA 1N87A 1K2FA 5J3XA 1WEPA 3HCUA 3SOXA 2KYUA 5FEYA 4AUQB 4AP4A 1WESA 1WEQA 2LGKA 3O33A 3M62A 4WZ2A 3O35A 4QF3A 4C9ZA 5TDRA 2MUMA 4V3KC 1WGMA 2ECIA 4AVXA 1CHCA 2ECGA 1ZBDB 2MT5A 3O37A 1LDKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE B;  4N3W A;  2VJF B;  3M63 A;  1WEO A;  1WEN A;  3RPG C;  1MM2 A;  4LJN A;  2JMJ A;  3L1X A;  4AYC A;  1WFK A;  3HCT A;  2EGP A;  4ZUX U;  4TKP B;  1WEV A;  4GND A;  4Q6F A;  5C11 A;  1HYI A;  3C5K A;  2CKL B;  2E6S A;  2AN6 A;  5LKT A;  4YAB A;  4A0C D;  3O36 A;  2XB1 A;  4PPE A;  2I50 A;  4YBT A;  4P5O B;  2LV9 A;  2Y1N A;  4UP5 A;  2XEU A;  4B86 C;  3LRQ A;  4IC3 A;  5LKU A;  2JMD A;  5C13 A;  3ZPV E;  4CCG X;  5B78 A;  2OXQ C;  3GV4 A;  1T1H A;  4BHW A;  4GNE A;  3QZV A;  2EOD A;  2ECN A;  4I7D A;  2LGV A;  2CT2 A;  2RI7 A;  2KGI A;  4GNF A;  1X4J A;  4AYC B;  2G6Q A;  3DPL R;  1MM3 A;  2VPB A;  4LAD B;  4CA1 A;  1WEU A;  2MA5 A;  2KWK A;  4GNG A;  1E4U A;  2L75 A;  3O34 A;  2F42 A;  3GL6 A;  4XI1 A;  3N9N A;  1Z2Q A;  3ASL A;  1DVP A;  3PHD A;  5KH9 A;  4L58 A;  2BAY A;  3N9P A;  3N9Q A;  1WIM A;  3IHP A;  2ECT A;  2MNZ A;  2F6J A;  2VNF A;  1WIL A;  5H9M A;  4MVT A;  2L43 A;  2ECW A;  4GB0 A;  4N4F A;  4I7B A;  3SHB A;  2DX8 A;  2M85 A;  2KWN A;  3LQI A;  3HTK C;  2FUI A;  3SOW A;  2HYE D;  2LN0 A;  1RMD A;  2H0D B;  5FB0 A;  5TRB A;  2VP7 A;  4WZ3 B;  3ZYQ A;  4LLB A;  2KE1 A;  2Y43 A;  4NN2 A;  2M6M A;  2KIZ A;  2Y1M A;  3L1Z B;  3DQV R;  2LXH C;  1WEW A;  4FK5 A;  2YSJ A;  4F52 B;  1V87 A;  3LQH A;  1WE9 A;  2C2V S;  5H1V A;  1WEE A;  3PUR A;  3VK6 A;  5JG6 A;  1JOC A;  2KWO A;  3EB5 A;  1U6G B;  4A4C A;  4LKA A;  2MIQ A;  3NG2 A;  4FO9 A;  2E6R A;  2CSZ A;  4B7Y C;  4R8P K;  3FL2 A;  4FJC A;  2YT5 A;  2F6N A;  2YHO A;  2H0D A;  3U5O A;  1Z60 A;  1VD4 A;  1JM7 A;  5D1L B;  3KQI A;  2M1R A;  5TBN A;  4X3G A;  2G43 A;  5KH3 A;  4ZDT A;  2L0B A;  3I2D A;  4YAD A;  3KV5 A;  2YYR A;  1IYM A;  2MD8 C;  5G0F A;  5B77 A;  4QF2 A;  3SOU A;  3T7L A;  3LQJ A;  2LXP C;  2PUY A;  4WZ0 A;  2C2L A;  2L80 A;  5H1U A;  3O7A A;  3MHH A;  4MSX A;  3ZPV 1;  5H1T A;  2KR4 A;  3N9M A;  2LGL A;  3ZVY A;  4S3O B;  2VPG A;  3O70 A;  5G04 B;  4W4U A;  1X4U A;  3M99 A;  1FP0 A;  2QJ0 A;  1Z6U A;  4R7E A;  2JRJ A;  4PTB A;  2VPD A;  2D8S A;  5AIT A;  2K4D A;  2FSA A;  2LQ6 A;  4A49 A;  4A4B A;  2YSM A;  1F62 A;  4I7C A;  5B8D A;  3ZVZ B;  2CSY A;  4YAT A;  1JM7 B;  4LK9 A;  5B79 A;  2KU3 A;  4YBS A;  2YUR A;  3N9O A;  3RPG B;  2IDA A;  2JMI A;  1WEM A;  1XWH A;  5B75 A;  3ZTG A;  2ZET C;  4V3L C;  1FBV A;  2FUU A;  2PNX A;  4ZQL A;  1BOR A;  2YW8 A;  5TAB A;  4BBQ A;  2ECJ A;  5D1K B;  5KH7 A;  4WA6 A;  2MNY A;  2YQM A;  5FER A;  1VYX A;  2YU4 A;  5AIU A;  4R2Y A;  3L11 A;  5B76 A;  2L5U A;  5G05 B;  2YQL A;  4YBM A;  5DKA A;  5LKX A;  3KV6 A;  2MD7 B;  2VPE A;  3C6W A;  2LGG A;  2ECV A;  1HYJ A;  5LCW B;  4L7X A;  1G25 A;  5FB1 A;  5LKZ A;  4IC2 A;  3V43 A;  5TDW A;  2K16 A;  4UI9 B;  3PUQ A;  2M3H A;  1X4I A;  2MA6 A;  3RTR B;  5D1M B;  2LDR A;  2K17 A;  1LDJ B;  2LRI C;  2HDP A;  2VJE A;  3EB6 A;  5DIN A;  3MHS A;  3ZNI A;  2VJF A;  2RSD A;  1VFY A;  5EYA F;  2YRE A;  2YUC A;  4FIP A;  2KWJ A;  4O64 A;  3T6R A;  4YAX A;  2NAA A;  2QIC A;  4YC9 A;  3N9L A;  2QIZ A;  3U5N A;  2EA6 A;  5I3L A;  2G45 A;  4S3O C;  2K1J A;  2KGG A;  3U5P A;  3HCS A;  2CKL A;  2KFT A;  3KNV A;  3U5M A;  2YHN A;  2KRE A;  4UP0 A;  2UZG A;  1N87 A;  1K2F A;  5J3X A;  1WEP A;  3HCU A;  3SOX A;  2KYU A;  5FEY A;  4AUQ B;  4AP4 A;  1WES A;  1WEQ A;  2LGK A;  3O33 A;  3M62 A;  4WZ2 A;  3O35 A;  4QF3 A;  4C9Z A;  5TDR A;  2MUM A;  4V3K C;  1WGM A;  2ECI A;  4AVX A;  1CHC A;  2ECG A;  1ZBD B;  2MT5 A;  3O37 A;  1LDK C; 
#chains in the Genus database with same CATH topology
 2VJE B;  4N3W A;  2VJF B;  3M63 A;  1WEO A;  1WEN A;  3RPG C;  1MM2 A;  4LJN A;  2JMJ A;  2JM3 A;  3L1X A;  2EGM A;  3PLW A;  4AYC A;  1WFK A;  3HCT A;  2EGP A;  4ZUX U;  4TKP B;  1WEV A;  4GND A;  4Q6F A;  5C11 A;  1HYI A;  4O62 A;  3C5K A;  2CKL B;  2E6S A;  2AN6 A;  5LKT A;  4YAB A;  2XOY A;  4A0C D;  2CSV A;  3O36 A;  2XB1 A;  4PPE A;  2EXU A;  2I50 A;  4YBT A;  4P5O B;  2LV9 A;  2L7P A;  2Y1N A;  4UP5 A;  2XEU A;  4B86 C;  3LRQ A;  4IC3 A;  5LKU A;  4OGE A;  2JMD A;  5C13 A;  3SUB A;  3ZPV E;  4CCG X;  5B78 A;  2OXQ C;  3GV4 A;  1T1H A;  4BHW A;  5SVY A;  4GNE A;  3QZV A;  2EOD A;  2ECN A;  4I7D A;  2LGV A;  2CT2 A;  2RI7 A;  2KGI A;  4GNF A;  1X4J A;  4AYC B;  2G6Q A;  3DPL R;  1MM3 A;  2VPB A;  4LAD B;  3FEH A;  4CA1 A;  1WEU A;  2MA5 A;  2KKX A;  2KWK A;  4GNG A;  1E4U A;  2L75 A;  3O34 A;  3Q1D A;  2F42 A;  2FFW A;  3GL6 A;  4XI1 A;  3E2D A;  3N9N A;  1DCQ A;  1Z2Q A;  3ASL A;  1DVP A;  3PHD A;  5KH9 A;  4L58 A;  2BAY A;  3N9P A;  3N9Q A;  1WIM A;  3IHP A;  2ECT A;  2MNZ A;  2F6J A;  4QQ4 A;  2VNF A;  1WIL A;  5H9M A;  4MVT A;  2L43 A;  2ECW A;  4GB0 A;  2OWA A;  4N4F A;  3LVR E;  4I7B A;  3SHB A;  2DX8 A;  2M85 A;  2KWN A;  3LQI A;  3HTK C;  2FUI A;  2LAU A;  3SOW A;  2HYE D;  2LN0 A;  1RMD A;  2FD4 A;  2H0D B;  5FB0 A;  5TRB A;  2VP7 A;  4WZ3 B;  3ZYQ A;  4LLB A;  2KE1 A;  2Y43 A;  4NN2 A;  4H9D A;  2M6M A;  2E61 A;  2KIZ A;  2Y1M A;  3H7H A;  3L1Z B;  3DQV R;  2LXH C;  1WEW A;  4FK5 A;  2YSJ A;  4F52 B;  1V87 A;  3LQH A;  1WE9 A;  2RR4 A;  2C2V S;  5H1V A;  1WEE A;  3PUR A;  3VK6 A;  3LDY A;  5JG6 A;  1JOC A;  3MDB C;  2KWO A;  3EB5 A;  1U6G B;  4A4C A;  4LKA A;  2MIQ A;  3NG2 A;  5K3Q A;  4FO9 A;  2E6R A;  3FM8 C;  2CSZ A;  4B7Y C;  4R8P K;  3FL2 A;  4FJC A;  2YT5 A;  2F6N A;  2YHO A;  2H0D A;  3U5O A;  1Z60 A;  1VD4 A;  4OGC A;  1JM7 A;  5D1L B;  3KQI A;  2M1R A;  5TBN A;  4X3G A;  2G43 A;  5KH3 A;  4ZDT A;  2KKY A;  2JUN A;  2L0B A;  3I2D A;  4YAD A;  3KV5 A;  2YYR A;  1IYM A;  2MD8 C;  5G0F A;  5B77 A;  4QF2 A;  3SOU A;  3LJU X;  3T7L A;  3LQJ A;  2LXP C;  2PUY A;  4WZ0 A;  2C2L A;  2L80 A;  2XOZ A;  5H1U A;  3O7A A;  3MHH A;  4MSX A;  3ZPV 1;  3M7K A;  5H1T A;  2KR4 A;  3N9M A;  2LGL A;  3ZVY A;  4S3O B;  2VPG A;  3O70 A;  5G04 B;  4W4U A;  1X4U A;  3M99 A;  2XP0 A;  2B0O E;  1FP0 A;  2QJ0 A;  1Z6U A;  4R7E A;  2JRJ A;  4PTB A;  2VPD A;  2D8S A;  5AIT A;  2K4D A;  2FSA A;  5SVI A;  2LQ6 A;  4A49 A;  1MBM A;  4A4B A;  2YSM A;  1F62 A;  4I7C A;  5B8D A;  3ZVZ B;  2MKE A;  2D8U A;  2CSY A;  4YAT A;  1JM7 B;  4LK9 A;  5B79 A;  2KU3 A;  3KDE C;  4YBS A;  2YUR A;  3N9O A;  3RPG B;  2IDA A;  4F1P A;  2JMI A;  1WEM A;  1XWH A;  5B75 A;  3ZTG A;  2ZET C;  3FAN A;  4V3L C;  1FBV A;  3DDT A;  2FUU A;  2PNX A;  4ZQL A;  1BOR A;  2YW8 A;  5TAB A;  4BBQ A;  2ECJ A;  5D1K B;  5KH7 A;  4Z0R A;  4WA6 A;  2MNY A;  2YQM A;  5FER A;  1VYX A;  2YU4 A;  5AIU A;  4R2Y A;  3L11 A;  5B76 A;  2L5U A;  5G05 B;  2YQL A;  4YBM A;  2CRW A;  5DKA A;  5LKX A;  3KV6 A;  5SVX A;  5SVI B;  3O47 A;  2MD7 B;  2VPE A;  3C6W A;  2LGG A;  2ECV A;  1HYJ A;  5LCW B;  4L7X A;  1G25 A;  5FB1 A;  5LKZ A;  4IC2 A;  3V43 A;  5TDW A;  2K16 A;  4UI9 B;  3PUQ A;  3T9K A;  2M3H A;  1X4I A;  2MA6 A;  3RTR B;  5D1M B;  2LDR A;  2XOC A;  2K17 A;  1LDJ B;  3JUE A;  2LRI C;  2HDP A;  2CRR A;  2VJE A;  2IQJ A;  3EB6 A;  5DIN A;  3MHS A;  3ZNI A;  2VJF A;  2RSD A;  1VFY A;  5EYA F;  2YRE A;  2YUC A;  4FIP A;  2KWJ A;  4O64 A;  3T6R A;  4YAX A;  2NAA A;  2QIC A;  4YC9 A;  3N9L A;  2QIZ A;  2P57 A;  3U5N A;  2EA6 A;  2CON A;  5I3L A;  2G45 A;  4S3O C;  2K1J A;  2KGG A;  3FJU B;  3LVQ E;  3U5P A;  2YVR A;  3HCS A;  2CKL A;  2KFT A;  3KNV A;  3U5M A;  2YHN A;  2KRE A;  2DJA A;  4UP0 A;  2UZG A;  1N87 A;  1K2F A;  1WEP A;  3HCU A;  5FEY A;  2KYU A;  5J3X A;  3FAO A;  3SOX A;  4AUQ B;  4AP4 A;  1WES A;  1WEQ A;  2LGK A;  3O33 A;  3M62 A;  4WZ2 A;  3O35 A;  4Z0O A;  4QF3 A;  2DSM A;  2M13 A;  4C9Z A;  5TDR A;  2MUM A;  4V3K C;  3DWD A;  1WGM A;  2ECI A;  4AVX A;  1CHC A;  2ECG A;  1ZBD B;  2MT5 A;  3O37 A;  1LDK C; 
#chains in the Genus database with same CATH homology
 2VJE B;  4N3W A;  2VJF B;  3M63 A;  1WEO A;  1WEN A;  3RPG C;  1MM2 A;  4LJN A;  2JMJ A;  3L1X A;  4AYC A;  1WFK A;  3HCT A;  2EGP A;  4ZUX U;  4TKP B;  1WEV A;  4GND A;  4Q6F A;  5C11 A;  1HYI A;  3C5K A;  2CKL B;  2E6S A;  2AN6 A;  5LKT A;  4YAB A;  4A0C D;  3O36 A;  2XB1 A;  4PPE A;  2I50 A;  4YBT A;  4P5O B;  2LV9 A;  2Y1N A;  4UP5 A;  2XEU A;  4B86 C;  3LRQ A;  4IC3 A;  5LKU A;  2JMD A;  5C13 A;  3ZPV E;  4CCG X;  5B78 A;  2OXQ C;  3GV4 A;  1T1H A;  4BHW A;  4GNE A;  3QZV A;  2EOD A;  2ECN A;  4I7D A;  2LGV A;  2CT2 A;  2RI7 A;  2KGI A;  4GNF A;  1X4J A;  4AYC B;  2G6Q A;  3DPL R;  1MM3 A;  2VPB A;  4LAD B;  4CA1 A;  1WEU A;  2MA5 A;  2KWK A;  4GNG A;  1E4U A;  2L75 A;  3O34 A;  2F42 A;  3GL6 A;  4XI1 A;  3N9N A;  1Z2Q A;  3ASL A;  1DVP A;  3PHD A;  5KH9 A;  4L58 A;  2BAY A;  3N9P A;  3N9Q A;  1WIM A;  3IHP A;  2ECT A;  2MNZ A;  2F6J A;  2VNF A;  1WIL A;  5H9M A;  4MVT A;  2L43 A;  2ECW A;  4GB0 A;  4N4F A;  4I7B A;  3SHB A;  2DX8 A;  2M85 A;  2KWN A;  3LQI A;  3HTK C;  2FUI A;  3SOW A;  2HYE D;  2LN0 A;  1RMD A;  2H0D B;  5FB0 A;  5TRB A;  2VP7 A;  4WZ3 B;  3ZYQ A;  4LLB A;  2KE1 A;  2Y43 A;  4NN2 A;  2M6M A;  2KIZ A;  2Y1M A;  3L1Z B;  3DQV R;  2LXH C;  1WEW A;  4FK5 A;  2YSJ A;  4F52 B;  1V87 A;  3LQH A;  1WE9 A;  2C2V S;  5H1V A;  1WEE A;  3PUR A;  3VK6 A;  5JG6 A;  1JOC A;  2KWO A;  3EB5 A;  1U6G B;  4A4C A;  4LKA A;  2MIQ A;  3NG2 A;  4FO9 A;  2E6R A;  2CSZ A;  4B7Y C;  4R8P K;  3FL2 A;  4FJC A;  2YT5 A;  2F6N A;  2YHO A;  2H0D A;  3U5O A;  1Z60 A;  1VD4 A;  1JM7 A;  5D1L B;  3KQI A;  2M1R A;  5TBN A;  4X3G A;  2G43 A;  5KH3 A;  4ZDT A;  2L0B A;  3I2D A;  4YAD A;  3KV5 A;  2YYR A;  1IYM A;  2MD8 C;  5G0F A;  5B77 A;  4QF2 A;  3SOU A;  3T7L A;  3LQJ A;  2LXP C;  2PUY A;  4WZ0 A;  2C2L A;  2L80 A;  5H1U A;  3O7A A;  3MHH A;  4MSX A;  3ZPV 1;  5H1T A;  2KR4 A;  3N9M A;  2LGL A;  3ZVY A;  4S3O B;  2VPG A;  3O70 A;  5G04 B;  4W4U A;  1X4U A;  3M99 A;  1FP0 A;  2QJ0 A;  1Z6U A;  4R7E A;  2JRJ A;  4PTB A;  2VPD A;  2D8S A;  5AIT A;  2K4D A;  2FSA A;  2LQ6 A;  4A49 A;  4A4B A;  2YSM A;  1F62 A;  4I7C A;  5B8D A;  3ZVZ B;  2CSY A;  4YAT A;  1JM7 B;  4LK9 A;  5B79 A;  2KU3 A;  4YBS A;  2YUR A;  3N9O A;  3RPG B;  2IDA A;  2JMI A;  1WEM A;  1XWH A;  5B75 A;  3ZTG A;  2ZET C;  4V3L C;  1FBV A;  2FUU A;  2PNX A;  4ZQL A;  1BOR A;  2YW8 A;  5TAB A;  4BBQ A;  2ECJ A;  5D1K B;  5KH7 A;  4WA6 A;  2MNY A;  2YQM A;  5FER A;  1VYX A;  2YU4 A;  5AIU A;  4R2Y A;  3L11 A;  5B76 A;  2L5U A;  5G05 B;  2YQL A;  4YBM A;  5DKA A;  5LKX A;  3KV6 A;  2MD7 B;  2VPE A;  3C6W A;  2LGG A;  2ECV A;  1HYJ A;  5LCW B;  4L7X A;  1G25 A;  5FB1 A;  5LKZ A;  4IC2 A;  3V43 A;  5TDW A;  2K16 A;  4UI9 B;  3PUQ A;  2M3H A;  1X4I A;  2MA6 A;  3RTR B;  5D1M B;  2LDR A;  2K17 A;  1LDJ B;  2LRI C;  2HDP A;  2VJE A;  3EB6 A;  5DIN A;  3MHS A;  3ZNI A;  2VJF A;  2RSD A;  1VFY A;  5EYA F;  2YRE A;  2YUC A;  4FIP A;  2KWJ A;  4O64 A;  3T6R A;  4YAX A;  2NAA A;  2QIC A;  4YC9 A;  3N9L A;  2QIZ A;  3U5N A;  2EA6 A;  5I3L A;  2G45 A;  4S3O C;  2K1J A;  2KGG A;  3U5P A;  3HCS A;  2CKL A;  2KFT A;  3KNV A;  3U5M A;  2YHN A;  2KRE A;  4UP0 A;  2UZG A;  1N87 A;  1K2F A;  5J3X A;  1WEP A;  3HCU A;  3SOX A;  2KYU A;  5FEY A;  4AUQ B;  4AP4 A;  1WES A;  1WEQ A;  2LGK A;  3O33 A;  3M62 A;  4WZ2 A;  3O35 A;  4QF3 A;  4C9Z A;  5TDR A;  2MUM A;  4V3K C;  1WGM A;  2ECI A;  4AVX A;  1CHC A;  2ECG A;  1ZBD B;  2MT5 A;  3O37 A;  1LDK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...