3H7HA

Crystal structure of the human transcription elongation factor dsif, hspt4/hspt5 (176-273)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
MGALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor SPT4
publication title Crystal structure of the human transcription elongation factor DSIF hSpt4 subunit in complex with the hSpt5 dimerization interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 33
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06093 Spt4 Spt4/RpoE2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.210 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3h7hA01
2EXUA 3H7HA
chains in the Genus database with same CATH superfamily
4P5OB 4GB0A 2VJFA 2ECTA 3T7LA 4QF3A 4AP4A 2UZGA 2KWJA 3ZVZB 4AYCB 3JUEA 2CRRA 1LDKC 3O36A 3LJUX 4TKPB 4Z0RA 2KKXA 2MA6A 4Z0OA 5D1LB 3MHHA 3DPLR 3O70A 3HCTA 2I50A 5TDWA 2PUYA 4PTBA 5AITA 4PPEA 2YUCA 3Q1DA 3MHSA 4YADA 3U5OA 2L80A 2JUNA 2K4DA 3L11A 4UP5A 5AIUA 4BBQA 1Z6UA 2HYED 2XOZA 1ZBDB 2B0OE 3PUQA 2E6RA 4I7CA 2YW8A 4W4UA 4OGCA 2VJEA 4R7EA 2RI7A 2LGGA 2RR4A 5G04B 4UP0A 2YSMA 2M1RA 2YYRA 2K1JA 2KGGA 3SHBA 4YC9A 4WZ0A 3ZVYA 2HDPA 3O37A 1DCQA 2YURA 4YATA 4B86C 2G45A 2RSDA 5J3XA 3KV5A 4WA6A 4ZUXU 3LQHA 2Y1NA 2L43A 3M63A 1G25A 2M13A 1E4UA 2EA6A 1MM2A 4F1PA 1WEEA 2YQLA 3SOXA 5D1KB 2LAUA 5TABA 4AYCA 2ECVA 3M99A 2E61A 1T1HA 4I7BA 1X4UA 2DJAA 1IYMA 3ZTGA 2LGKA 4L58A 2YHNA 2D8SA 3QZVA 3O33A 3ASLA 3N9NA 5K3QA 3FL2A 3LQJA 3N9QA 3LRQA 1WEWA 3KNVA 2JMJA 1X4IA 4OGEA 4CCGX 2BAYA 4N4FA 2ECIA 2QIZA 4Q6FA 5B77A 3SOWA 1FBVA 2P57A 3PHDA 5C13A 2D8UA 1WGMA 1WESA 3O7AA 3O34A 3DDTA 5B75A 2VP7A 3T9KA 2LRIC 2CRWA 4WZ3B 3RTRB 5FERA 1WE9A 5B78A 5H1TA 2KKYA 4S3OB 4N3WA 1BORA 2L0BA 1VYXA 3MDBC 1Z2QA 4S3OC 5SVIB 2YQMA 5FB1A 4FK5A 2H0DB 2XOYA 5I3LA 2F6NA 2C2LA 3FJUB 2EGPA 5H1VA 4GNFA 2LN0A 3C5KA 2KWOA 3NG2A 4UI9B 2VPGA 2KU3A 2LGLA 2FFWA 5TDRA 2EXUA 4BHWA 2K16A 2JMDA 4YABA 5H9MA 2KWKA 4YBTA 2CKLB 5LKTA 1VFYA 2ECGA 1X4JA 3DQVR 2FSAA 4A4BA 2JM3A 2FUIA 4MSXA 4R8PK 2L5UA 3HCUA 4GNDA 4ZQLA 4X3GA 3KV6A 5KH3A 4GNEA 2FUUA 3RPGC 2CONA 4CA1A 2CSZA 5SVYA 1WEQA 1MM3A 1Z60A 1DVPA 2K17A 5DINA 2F6JA 4V3KC 3H7HA 3N9PA 3M7KA 1VD4A 2YHOA 2G6QA 5TBNA 1WEMA 2KWNA 2AN6A 5B76A 4R2YA 2CSVA 3VK6A 3ZNIA 2FD4A 2MD7B 2XP0A 5LKUA 2MNZA 1N87A 3I2DA 2VPDA 2Y43A 2G43A 2Y1MA 3L1XA 5EYAF 4A4CA 4A49A 3EB6A 3DWDA 3SOUA 4GNGA 3FAOA 3M62A 1XWHA 5JG6A 4IC3A 3HCSA 2MIQA 1F62A 4F52B 2KR4A 2F42A 1WIMA 4IC2A 5SVIA 3O47A 5B79A 4A0CD 1WEUA 2H0DA 3ZPVE 4LADB 5KH9A 2OXQC 2OWAA 1WEVA 4I7DA 4XI1A 5TRBA 3IHPA 1LDJB 2DX8A 2MUMA 2YT5A 4O64A 3LQIA 5LCWB 2KIZA 2MNYA 5LKXA 2PNXA 2CKLA 2M85A 1JM7B 4YAXA 5D1MB 4FO9A 1HYIA 3N9LA 3E2DA 2LV9A 5G0FA 3V43A 4LJNA 4QF2A 5H1UA 2JRJA 2L75A 3SUBA 4O62A 3PURA 2EGMA 4WZ2A 3O35A 2ECNA 1HYJA 2KREA 4YBSA 2M3HA 3FEHA 2CT2A 2XEUA 2MKEA 2MT5A 3ZYQA 2EODA 5C11A 4LK9A 2IDAA 2LQ6A 2XB1A 2VPBA 2VJFB 1WEOA 2KE1A 4L7XA 3RPGB 5KH7A 5FEYA 3PLWA 2YSJA 4LKAA 1WILA 3ZPV1 5SVXA 2ECWA 2QICA 2E6SA 1U6GB 4AVXA 5G05B 3T6RA 2KFTA 2YVRA 1RMDA 3FM8C 2LXHC 1FP0A 1MBMA 2LGVA 2XOCA 4H9DA 2ECJA 2JMIA 1WENA 2VPEA 3GV4A 4FIPA 5DKAA 4AUQB 3U5PA 1WEPA 2VNFA 4ZDTA 2L7PA 3EB5A 2IQJA 2NAAA 3C6WA 4MVTA 2VJEB 5FB0A 5LKZA 4LLBA 2CSYA 2YREA 3KQIA 3LVRE 3KDEC 5B8DA 1K2FA 2YU4A 3HTKC 4NN2A 3LVQE 1JM7A 1JOCA 2KGIA 3N9MA 2C2VS 4C9ZA 2ZETC 4FJCA 1V87A 3L1ZB 2KYUA 3N9OA 2QJ0A 2LDRA 2LXPC 4QQ4A 3GL6A 2MA5A 4YBMA 2MD8C 3LDYA 3U5MA 3U5NA 3FANA 2DSMA 4B7YC 2M6MA 1WFKA 1CHCA 4V3LC
chains in the Genus database with same CATH topology
3FEHA 2KKYA 5SVIA 2IQJA 2RR4A 3O47A 2FFWA 2MKEA 2EXUA 4QQ4A 2DJAA 3E2DA 3Q1DA 4OGEA 3MDBC 2JUNA 2YVRA 2M13A 3H7HA 3LVRE 2YREA 2P57A 3FM8C 2OWAA 3JUEA 3KDEC 3M7KA 2CRRA 2D8UA 3LVQE 5SVIB 3LJUX 2XOCA 2JM3A 2KKXA 2XOZA 3DDTA 3DWDA 4H9DA 4Z0RA 2XOYA 4Z0OA 2B0OE 3LDYA 3SUBA 4F1PA 1DCQA 3T9KA 5K3QA 4O62A 4OGCA 2CSVA 2CRWA 3FJUB 3PLWA 2EGMA 2LAUA 2FD4A 2CONA 5SVYA 2XP0A 2E61A 2L7PA 5SVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXU A;  3H7H A; 
#chains in the Genus database with same CATH topology
 4P5O B;  4GB0 A;  2VJF A;  2ECT A;  3T7L A;  4QF3 A;  4AP4 A;  2UZG A;  2KWJ A;  3ZVZ B;  4AYC B;  3JUE A;  2CRR A;  1LDK C;  3O36 A;  3LJU X;  4TKP B;  4Z0R A;  2KKX A;  2MA6 A;  4Z0O A;  5D1L B;  3MHH A;  3DPL R;  3O70 A;  3HCT A;  2I50 A;  5TDW A;  2PUY A;  4PTB A;  5AIT A;  4PPE A;  2YUC A;  3Q1D A;  3MHS A;  4YAD A;  3U5O A;  2L80 A;  2JUN A;  2K4D A;  3L11 A;  4UP5 A;  5AIU A;  4BBQ A;  1Z6U A;  2HYE D;  2XOZ A;  1ZBD B;  2B0O E;  3PUQ A;  2E6R A;  4I7C A;  2YW8 A;  4W4U A;  4OGC A;  2VJE A;  4R7E A;  2RI7 A;  2LGG A;  2RR4 A;  5G04 B;  4UP0 A;  2YSM A;  2M1R A;  2YYR A;  2K1J A;  2KGG A;  3SHB A;  4YC9 A;  4WZ0 A;  3ZVY A;  2HDP A;  3O37 A;  1DCQ A;  2YUR A;  4YAT A;  4B86 C;  2G45 A;  2RSD A;  5J3X A;  3KV5 A;  4WA6 A;  4ZUX U;  3LQH A;  2Y1N A;  2L43 A;  3M63 A;  1G25 A;  2M13 A;  1E4U A;  2EA6 A;  1MM2 A;  4F1P A;  1WEE A;  2YQL A;  3SOX A;  5D1K B;  2LAU A;  5TAB A;  4AYC A;  2ECV A;  3M99 A;  2E61 A;  1T1H A;  4I7B A;  1X4U A;  2DJA A;  1IYM A;  3ZTG A;  2LGK A;  4L58 A;  2YHN A;  2D8S A;  3QZV A;  3O33 A;  3ASL A;  3N9N A;  5K3Q A;  3FL2 A;  3LQJ A;  3N9Q A;  3LRQ A;  1WEW A;  3KNV A;  2JMJ A;  1X4I A;  4OGE A;  4CCG X;  2BAY A;  4N4F A;  2ECI A;  2QIZ A;  4Q6F A;  5B77 A;  3SOW A;  1FBV A;  2P57 A;  3PHD A;  5C13 A;  2D8U A;  1WGM A;  1WES A;  3O7A A;  3O34 A;  3DDT A;  5B75 A;  2VP7 A;  3T9K A;  2LRI C;  2CRW A;  4WZ3 B;  3RTR B;  5FER A;  1WE9 A;  5B78 A;  5H1T A;  2KKY A;  4S3O B;  4N3W A;  1BOR A;  2L0B A;  1VYX A;  3MDB C;  1Z2Q A;  4S3O C;  5SVI B;  2YQM A;  5FB1 A;  4FK5 A;  2H0D B;  2XOY A;  5I3L A;  2F6N A;  2C2L A;  3FJU B;  2EGP A;  5H1V A;  4GNF A;  2LN0 A;  3C5K A;  2KWO A;  3NG2 A;  4UI9 B;  2VPG A;  2KU3 A;  2LGL A;  2FFW A;  5TDR A;  2EXU A;  4BHW A;  2K16 A;  2JMD A;  4YAB A;  5H9M A;  2KWK A;  4YBT A;  2CKL B;  5LKT A;  1VFY A;  2ECG A;  1X4J A;  3DQV R;  2FSA A;  4A4B A;  2JM3 A;  2FUI A;  4MSX A;  4R8P K;  2L5U A;  3HCU A;  4GND A;  4ZQL A;  4X3G A;  3KV6 A;  5KH3 A;  4GNE A;  2FUU A;  3RPG C;  2CON A;  4CA1 A;  2CSZ A;  5SVY A;  1WEQ A;  1MM3 A;  1Z60 A;  1DVP A;  2K17 A;  5DIN A;  2F6J A;  4V3K C;  3H7H A;  3N9P A;  3M7K A;  1VD4 A;  2YHO A;  2G6Q A;  5TBN A;  1WEM A;  2KWN A;  2AN6 A;  5B76 A;  4R2Y A;  2CSV A;  3VK6 A;  3ZNI A;  2FD4 A;  2MD7 B;  2XP0 A;  5LKU A;  2MNZ A;  1N87 A;  3I2D A;  2VPD A;  2Y43 A;  2G43 A;  2Y1M A;  3L1X A;  5EYA F;  4A4C A;  4A49 A;  3EB6 A;  3DWD A;  3SOU A;  4GNG A;  3FAO A;  3M62 A;  1XWH A;  5JG6 A;  4IC3 A;  3HCS A;  2MIQ A;  1F62 A;  4F52 B;  2KR4 A;  2F42 A;  1WIM A;  4IC2 A;  5SVI A;  3O47 A;  5B79 A;  4A0C D;  1WEU A;  2H0D A;  3ZPV E;  4LAD B;  5KH9 A;  2OXQ C;  2OWA A;  1WEV A;  4I7D A;  4XI1 A;  5TRB A;  3IHP A;  1LDJ B;  2DX8 A;  2MUM A;  2YT5 A;  4O64 A;  3LQI A;  5LCW B;  2KIZ A;  2MNY A;  5LKX A;  2PNX A;  2CKL A;  2M85 A;  1JM7 B;  4YAX A;  5D1M B;  4FO9 A;  1HYI A;  3N9L A;  3E2D A;  2LV9 A;  5G0F A;  3V43 A;  4LJN A;  4QF2 A;  5H1U A;  2JRJ A;  2L75 A;  3SUB A;  4O62 A;  3PUR A;  2EGM A;  4WZ2 A;  3O35 A;  2ECN A;  1HYJ A;  2KRE A;  4YBS A;  2M3H A;  3FEH A;  2CT2 A;  2XEU A;  2MKE A;  2MT5 A;  3ZYQ A;  2EOD A;  5C11 A;  4LK9 A;  2IDA A;  2LQ6 A;  2XB1 A;  2VPB A;  2VJF B;  1WEO A;  2KE1 A;  4L7X A;  3RPG B;  5KH7 A;  5FEY A;  3PLW A;  2YSJ A;  4LKA A;  1WIL A;  3ZPV 1;  5SVX A;  2ECW A;  2QIC A;  2E6S A;  1U6G B;  4AVX A;  5G05 B;  3T6R A;  2KFT A;  2YVR A;  1RMD A;  3FM8 C;  2LXH C;  1FP0 A;  1MBM A;  2LGV A;  2XOC A;  4H9D A;  2ECJ A;  2JMI A;  1WEN A;  2VPE A;  3GV4 A;  4FIP A;  5DKA A;  4AUQ B;  3U5P A;  1WEP A;  2VNF A;  4ZDT A;  2L7P A;  3EB5 A;  2IQJ A;  2NAA A;  3C6W A;  4MVT A;  2VJE B;  5FB0 A;  5LKZ A;  4LLB A;  2CSY A;  2YRE A;  3KQI A;  3LVR E;  3KDE C;  5B8D A;  1K2F A;  2YU4 A;  3HTK C;  4NN2 A;  3LVQ E;  1JM7 A;  1JOC A;  2KGI A;  3N9M A;  2C2V S;  4C9Z A;  2ZET C;  4FJC A;  1V87 A;  3L1Z B;  2KYU A;  3N9O A;  2QJ0 A;  2LDR A;  2LXP C;  4QQ4 A;  3GL6 A;  2MA5 A;  4YBM A;  2MD8 C;  3LDY A;  3U5M A;  3U5N A;  3FAN A;  2DSM A;  4B7Y C;  2M6M A;  1WFK A;  1CHC A;  4V3L C; 
#chains in the Genus database with same CATH homology
 3FEH A;  2KKY A;  5SVI A;  2IQJ A;  2RR4 A;  3O47 A;  2FFW A;  2MKE A;  2EXU A;  4QQ4 A;  2DJA A;  3E2D A;  3Q1D A;  4OGE A;  3MDB C;  2JUN A;  2YVR A;  2M13 A;  3H7H A;  3LVR E;  2YRE A;  2P57 A;  3FM8 C;  2OWA A;  3JUE A;  3KDE C;  3M7K A;  2CRR A;  2D8U A;  3LVQ E;  5SVI B;  3LJU X;  2XOC A;  2JM3 A;  2KKX A;  2XOZ A;  3DDT A;  3DWD A;  4H9D A;  4Z0R A;  2XOY A;  4Z0O A;  2B0O E;  3LDY A;  3SUB A;  4F1P A;  1DCQ A;  3T9K A;  5K3Q A;  4O62 A;  4OGC A;  2CSV A;  2CRW A;  3FJU B;  3PLW A;  2EGM A;  2LAU A;  2FD4 A;  2CON A;  5SVY A;  2XP0 A;  2E61 A;  2L7P A;  5SVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...