3H7HA

Crystal structure of the human transcription elongation factor dsif, hspt4/hspt5 (176-273)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
MGALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human transcription elongation factor DSIF hSpt4 subunit in complex with the hSpt5 dimerization interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription elongation factor SPT4
total genus 33
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06093 Spt4 Spt4/RpoE2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.210 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3h7hA01
2EXUA 3H7HA
chains in the Genus database with same CATH superfamily
5LKXA 3M99A 3N9QA 3SHBA 4B7YC 2LAUA 2D8SA 1X4IA 4R8PK 2AN6A 1WE9A 4R7EA 3ZPVE 2HDPA 2LXPC 1E4UA 3LQIA 1VFYA 3M62A 3GL6A 3DDTA 3RTRB 2MIQA 2C2VS 3ASLA 2LRIC 3MDBC 2Y43A 3DQVR 3PHDA 2YSMA 3Q1DA 3FM8C 2OWAA 3FEHA 3E2DA 2E6SA 2L5UA 4OGEA 3LJUX 5FEYA 4GNGA 5B78A 4YABA 1CHCA 4YBTA 2KKXA 5H1UA 1VYXA 3L11A 1FP0A 5B76A 4PPEA 2M85A 5KH7A 4YBMA 1LDJB 4O64A 5LCWB 4YBSA 4FO9A 2DSMA 2KREA 2QIZA 2F42A 4ZUXU 2FSAA 2JMJA 2DX8A 1WFKA 1G25A 2D8UA 3KQIA 4LKAA 2YHNA 4S3OC 2LGLA 3GV4A 2QICA 2KWOA 1X4JA 2KE1A 2IQJA 4GB0A 2LN0A 3RPGB 2YQMA 1LDKC 2MD8C 2YUCA 4LADB 2L80A 5B75A 4FJCA 4LLBA 3C5KA 1ZBDB 3U5PA 4QF2A 2OXQC 2FD4A 5B77A 5LKUA 4QF3A 4NN2A 4QQ4A 3FL2A 2VJFA 3LVRE 3KV5A 2VJFB 3C6WA 1BORA 5FB0A 3SOXA 1DVPA 1X4UA 4I7BA 4L58A 4P5OB 4AVXA 2MKEA 3L1XA 4YATA 5H1VA 4C9ZA 2MNYA 2G43A 3O35A 4PTBA 2YHOA 5LKTA 4Z0RA 2KR4A 2M1RA 2G45A 4LJNA 5C13A 2JRJA 2CSZA 5DINA 1WESA 4UI9B 3RPGC 2YU4A 3U5MA 4CA1A 1WEOA 4LK9A 3LQJA 4BBQA 2XB1A 2VJEB 3O36A 2L43A 2L0BA 2H0DA 1WILA 2MA6A 2JUNA 2ECJA 2KWJA 2DJAA 1JM7A 1U6GB 2I50A 3N9LA 4A4CA 2HYED 3LRQA 2K16A 2M3HA 3FANA 4AUQB 2CONA 2LGGA 5SVYA 2XOZA 3HTKC 2LV9A 4N3WA 3MHSA 3VK6A 2QJ0A 4W4UA 2FFWA 4L7XA 4UP0A 4IC2A 4WZ0A 5DKAA 3H7HA 2LGVA 2YT5A 5TDWA 3N9NA 5AIUA 2IDAA 4ZQLA 3O7AA 3M7KA 2YSJA 4I7CA 2LXHC 2RR4A 4R2YA 4TKPB 3LQHA 2E6RA 2L75A 5KH3A 4Q6FA 1K2FA 3HCUA 4GNFA 1JM7B 1Z60A 3EB6A 3U5OA 2KU3A 4B86C 3N9MA 2M13A 5AITA 3SOUA 5D1KB 2RSDA 1Z2QA 3SUBA 2YVRA 2CSYA 5J3XA 5JG6A 3O34A 3I2DA 2C2LA 5D1MB 4A49A 1HYIA 3MHHA 3DWDA 4V3LC 4A0CD 5I3LA 2YQLA 2CRWA 1Z6UA 3HCSA 3L1ZB 3ZNIA 3SOWA 1FBVA 3HCTA 2RI7A 4IC3A 3O37A 2BAYA 2ECIA 2ECGA 2KFTA 2MNZA 1IYMA 2E61A 2M6MA 2CRRA 2G6QA 2VJEA 4AYCA 2K4DA 4CCGX 4N4FA 4ZDTA 2VPGA 4F1PA 2EXUA 2H0DB 5B8DA 4F52B 2EODA 3ZTGA 4A4BA 2YURA 2KKYA 2PNXA 2ECVA 2F6JA 5C11A 1VD4A 2JMDA 4WA6A 4UP5A 1WEEA 4WZ2A 5TDRA 3O70A 4H9DA 1N87A 3FJUB 5KH9A 3V43A 2KWKA 2MT5A 2KGGA 4I7DA 2K17A 4XI1A 3T9KA 2B0OE 3PURA 4V3KC 2VP7A 3N9OA 3KNVA 5TBNA 3LVQE 3PLWA 1HYJA 3ZYQA 5SVXA 4GNDA 3IHPA 2LQ6A 2LGKA 2CKLB 1JOCA 2EA6A 2KIZA 5EYAF 2FUIA 4MSXA 1V87A 2ECNA 1WIMA 2XOCA 3ZVYA 5SVIB 1F62A 5FERA 2VPEA 1WEVA 1WEUA 2EGMA 2ZETC 2VPBA 2ECTA 2P57A 2F6NA 4FIPA 4X3GA 2YW8A 1MM3A 1WENA 4FK5A 5G05B 2VPDA 2XP0A 4YADA 4BHWA 3ZVZB 2FUUA 3LDYA 3M63A 2VNFA 3KV6A 4MVTA 4GNEA 2NAAA 5LKZA 5TABA 1WEWA 2ECWA 5H1TA 2CSVA 4OGCA 1WEPA 1T1HA 2KWNA 2JMIA 3O47A 5G04B 1RMDA 4YC9A 2EGPA 2L7PA 1MBMA 2YYRA 2MA5A 4WZ3B 2JM3A 2YREA 2MUMA 3U5NA 1WGMA 4YAXA 2KGIA 1WEMA 5G0FA 1XWHA 3NG2A 4AP4A 5K3QA 3N9PA 3O33A 4Z0OA 2Y1MA 2MD7B 5H9MA 2KYUA 2UZGA 3EB5A 3QZVA 2XEUA 2LDRA 3JUEA 2CT2A 2Y1NA 1DCQA 3FAOA 3PUQA 1WEQA 2PUYA 2K1JA 4O62A 2CKLA 2XOYA 5D1LB 3T7LA 3KDEC 5B79A 3ZPV1 5SVIA 5TRBA 3DPLR 1MM2A 4AYCB 3T6RA 4S3OB 5FB1A
chains in the Genus database with same CATH topology
3FM8C 2EGMA 2FD4A 2OWAA 3FEHA 3SUBA 2YVRA 3E2DA 2P57A 3LVQE 3PLWA 4OGCA 4QQ4A 1DCQA 2IQJA 5SVXA 3LVRE 2FFWA 2LAUA 5K3QA 2XP0A 4OGEA 2D8UA 2E61A 4H9DA 4Z0OA 2CRRA 3LJUX 3FJUB 3O47A 4O62A 3DWDA 3H7HA 3LDYA 2XOYA 4F1PA 2JUNA 3KDEC 2EXUA 3DDTA 2DJAA 2KKXA 2L7PA 2CRWA 5SVIA 3MDBC 3T9KA 2MKEA 2B0OE 2XOCA 3M7KA 5SVIB 2JM3A 2M13A 2YREA 3JUEA 4Z0RA 2KKYA 2CSVA 2CONA 2RR4A 5SVYA 3Q1DA 2XOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXU A;  3H7H A; 
#chains in the Genus database with same CATH topology
 5LKX A;  3M99 A;  3N9Q A;  3SHB A;  4B7Y C;  2LAU A;  2D8S A;  1X4I A;  4R8P K;  2AN6 A;  1WE9 A;  4R7E A;  3ZPV E;  2HDP A;  2LXP C;  1E4U A;  3LQI A;  1VFY A;  3M62 A;  3GL6 A;  3DDT A;  3RTR B;  2MIQ A;  2C2V S;  3ASL A;  2LRI C;  3MDB C;  2Y43 A;  3DQV R;  3PHD A;  2YSM A;  3Q1D A;  3FM8 C;  2OWA A;  3FEH A;  3E2D A;  2E6S A;  2L5U A;  4OGE A;  3LJU X;  5FEY A;  4GNG A;  5B78 A;  4YAB A;  1CHC A;  4YBT A;  2KKX A;  5H1U A;  1VYX A;  3L11 A;  1FP0 A;  5B76 A;  4PPE A;  2M85 A;  5KH7 A;  4YBM A;  1LDJ B;  4O64 A;  5LCW B;  4YBS A;  4FO9 A;  2DSM A;  2KRE A;  2QIZ A;  2F42 A;  4ZUX U;  2FSA A;  2JMJ A;  2DX8 A;  1WFK A;  1G25 A;  2D8U A;  3KQI A;  4LKA A;  2YHN A;  4S3O C;  2LGL A;  3GV4 A;  2QIC A;  2KWO A;  1X4J A;  2KE1 A;  2IQJ A;  4GB0 A;  2LN0 A;  3RPG B;  2YQM A;  1LDK C;  2MD8 C;  2YUC A;  4LAD B;  2L80 A;  5B75 A;  4FJC A;  4LLB A;  3C5K A;  1ZBD B;  3U5P A;  4QF2 A;  2OXQ C;  2FD4 A;  5B77 A;  5LKU A;  4QF3 A;  4NN2 A;  4QQ4 A;  3FL2 A;  2VJF A;  3LVR E;  3KV5 A;  2VJF B;  3C6W A;  1BOR A;  5FB0 A;  3SOX A;  1DVP A;  1X4U A;  4I7B A;  4L58 A;  4P5O B;  4AVX A;  2MKE A;  3L1X A;  4YAT A;  5H1V A;  4C9Z A;  2MNY A;  2G43 A;  3O35 A;  4PTB A;  2YHO A;  5LKT A;  4Z0R A;  2KR4 A;  2M1R A;  2G45 A;  4LJN A;  5C13 A;  2JRJ A;  2CSZ A;  5DIN A;  1WES A;  4UI9 B;  3RPG C;  2YU4 A;  3U5M A;  4CA1 A;  1WEO A;  4LK9 A;  3LQJ A;  4BBQ A;  2XB1 A;  2VJE B;  3O36 A;  2L43 A;  2L0B A;  2H0D A;  1WIL A;  2MA6 A;  2JUN A;  2ECJ A;  2KWJ A;  2DJA A;  1JM7 A;  1U6G B;  2I50 A;  3N9L A;  4A4C A;  2HYE D;  3LRQ A;  2K16 A;  2M3H A;  3FAN A;  4AUQ B;  2CON A;  2LGG A;  5SVY A;  2XOZ A;  3HTK C;  2LV9 A;  4N3W A;  3MHS A;  3VK6 A;  2QJ0 A;  4W4U A;  2FFW A;  4L7X A;  4UP0 A;  4IC2 A;  4WZ0 A;  5DKA A;  3H7H A;  2LGV A;  2YT5 A;  5TDW A;  3N9N A;  5AIU A;  2IDA A;  4ZQL A;  3O7A A;  3M7K A;  2YSJ A;  4I7C A;  2LXH C;  2RR4 A;  4R2Y A;  4TKP B;  3LQH A;  2E6R A;  2L75 A;  5KH3 A;  4Q6F A;  1K2F A;  3HCU A;  4GNF A;  1JM7 B;  1Z60 A;  3EB6 A;  3U5O A;  2KU3 A;  4B86 C;  3N9M A;  2M13 A;  5AIT A;  3SOU A;  5D1K B;  2RSD A;  1Z2Q A;  3SUB A;  2YVR A;  2CSY A;  5J3X A;  5JG6 A;  3O34 A;  3I2D A;  2C2L A;  5D1M B;  4A49 A;  1HYI A;  3MHH A;  3DWD A;  4V3L C;  4A0C D;  5I3L A;  2YQL A;  2CRW A;  1Z6U A;  3HCS A;  3L1Z B;  3ZNI A;  3SOW A;  1FBV A;  3HCT A;  2RI7 A;  4IC3 A;  3O37 A;  2BAY A;  2ECI A;  2ECG A;  2KFT A;  2MNZ A;  1IYM A;  2E61 A;  2M6M A;  2CRR A;  2G6Q A;  2VJE A;  4AYC A;  2K4D A;  4CCG X;  4N4F A;  4ZDT A;  2VPG A;  4F1P A;  2EXU A;  2H0D B;  5B8D A;  4F52 B;  2EOD A;  3ZTG A;  4A4B A;  2YUR A;  2KKY A;  2PNX A;  2ECV A;  2F6J A;  5C11 A;  1VD4 A;  2JMD A;  4WA6 A;  4UP5 A;  1WEE A;  4WZ2 A;  5TDR A;  3O70 A;  4H9D A;  1N87 A;  3FJU B;  5KH9 A;  3V43 A;  2KWK A;  2MT5 A;  2KGG A;  4I7D A;  2K17 A;  4XI1 A;  3T9K A;  2B0O E;  3PUR A;  4V3K C;  2VP7 A;  3N9O A;  3KNV A;  5TBN A;  3LVQ E;  3PLW A;  1HYJ A;  3ZYQ A;  5SVX A;  4GND A;  3IHP A;  2LQ6 A;  2LGK A;  2CKL B;  1JOC A;  2EA6 A;  2KIZ A;  5EYA F;  2FUI A;  4MSX A;  1V87 A;  2ECN A;  1WIM A;  2XOC A;  3ZVY A;  5SVI B;  1F62 A;  5FER A;  2VPE A;  1WEV A;  1WEU A;  2EGM A;  2ZET C;  2VPB A;  2ECT A;  2P57 A;  2F6N A;  4FIP A;  4X3G A;  2YW8 A;  1MM3 A;  1WEN A;  4FK5 A;  5G05 B;  2VPD A;  2XP0 A;  4YAD A;  4BHW A;  3ZVZ B;  2FUU A;  3LDY A;  3M63 A;  2VNF A;  3KV6 A;  4MVT A;  4GNE A;  2NAA A;  5LKZ A;  5TAB A;  1WEW A;  2ECW A;  5H1T A;  2CSV A;  4OGC A;  1WEP A;  1T1H A;  2KWN A;  2JMI A;  3O47 A;  5G04 B;  1RMD A;  4YC9 A;  2EGP A;  2L7P A;  1MBM A;  2YYR A;  2MA5 A;  4WZ3 B;  2JM3 A;  2YRE A;  2MUM A;  3U5N A;  1WGM A;  4YAX A;  2KGI A;  1WEM A;  5G0F A;  1XWH A;  3NG2 A;  4AP4 A;  5K3Q A;  3N9P A;  3O33 A;  4Z0O A;  2Y1M A;  2MD7 B;  5H9M A;  2KYU A;  2UZG A;  3EB5 A;  3QZV A;  2XEU A;  2LDR A;  3JUE A;  2CT2 A;  2Y1N A;  1DCQ A;  3FAO A;  3PUQ A;  1WEQ A;  2PUY A;  2K1J A;  4O62 A;  2CKL A;  2XOY A;  5D1L B;  3T7L A;  3KDE C;  5B79 A;  3ZPV 1;  5SVI A;  5TRB A;  3DPL R;  1MM2 A;  4AYC B;  3T6R A;  4S3O B;  5FB1 A; 
#chains in the Genus database with same CATH homology
 3FM8 C;  2EGM A;  2FD4 A;  2OWA A;  3FEH A;  3SUB A;  2YVR A;  3E2D A;  2P57 A;  3LVQ E;  3PLW A;  4OGC A;  4QQ4 A;  1DCQ A;  2IQJ A;  5SVX A;  3LVR E;  2FFW A;  2LAU A;  5K3Q A;  2XP0 A;  4OGE A;  2D8U A;  2E61 A;  4H9D A;  4Z0O A;  2CRR A;  3LJU X;  3FJU B;  3O47 A;  4O62 A;  3DWD A;  3H7H A;  3LDY A;  2XOY A;  4F1P A;  2JUN A;  3KDE C;  2EXU A;  3DDT A;  2DJA A;  2KKX A;  2L7P A;  2CRW A;  5SVI A;  3MDB C;  3T9K A;  2MKE A;  2B0O E;  2XOC A;  3M7K A;  5SVI B;  2JM3 A;  2M13 A;  2YRE A;  3JUE A;  4Z0R A;  2KKY A;  2CSV A;  2CON A;  2RR4 A;  5SVY A;  3Q1D A;  2XOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...