3EB6A

Structure of the ciap2 ring domain bound to ubch5b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
b'DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Baculoviral IAP repeat-containing protein 3
publication title Structures of the cIAP2 RING Domain Reveal Conformational Changes Associated with Ubiquitin-conjugating Enzyme (E2) Recruitment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, ligase
total genus 9
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3eb6A00
3MHHA 2KGIA 3N9OA 2KWKA 4CA1A 2KWNA 2ECIA 4FIPA 3DQVR 1WEPA 3N9PA 4N3WA 3U5OA 4NN2A 4AUQB 1WILA 4FK5A 2Y1MA 1JOCA 2UZGA 4FO9A 4R2YA 2KU3A 1WEUA 2JMDA 5G0FA 4X3GA 5TDRA 4LK9A 4GNDA 1ZBDB 4W4UA 4XI1A 1LDKC 2JRJA 2FUUA 3KNVA 2DX8A 2ZETC 2G43A 4MVTA 2VP7A 2QIZA 2XB1A 2BAYA 2LRIC 2VPGA 3SOUA 1E4UA 2M1RA 2VJEA 5TDWA 3O36A 2M3HA 2MUMA 2KWJA 4IC3A 1N87A 2QJ0A 2EGPA 3QZVA 3C5KA 5LCWB 3C6WA 4A4CA 4CCGX 3I2DA 2KREA 5C11A 5I3LA 4IC2A 4AYCA 1Z60A 4I7BA 1LDJB 4R8PK 3GL6A 4YADA 2LDRA 3ZTGA 3EB5A 4AYCB 1WEOA 4WZ3B 2F6JA 1Z6UA 3MHSA 3LQJA 4L7XA 2G6QA 3U5PA 5D1LB 5EYAF 2QICA 1WEMA 4F52B 5LKTA 1X4JA 4I7CA 2PUYA 2C2LA 5D1MB 3ZVYA 3V43A 1FP0A 2KE1A 5B78A 2MA5A 2ECVA 2CSYA 2G45A 2F6NA 4GNEA 4BBQA 5H9MA 2JMJA 5DKAA 2FUIA 5TRBA 2K17A 2L80A 2FSAA 5G05B 1HYJA 2YSMA 4B7YC 2CSZA 1DVPA 3EB6A 3N9NA 2YW8A 4Q6FA 2VJFB 5C13A 1Z2QA 2HDPA 3PUQA 1WIMA 2E6SA 5FEYA 2LXPC 2ECJA 3O35A 2VPDA 2YURA 3RPGC 5J3XA 2YHNA 2L5UA 2VNFA 2VPBA 2PNXA 2RI7A 4UP0A 4TKPB 1V87A 1XWHA 3T7LA 2M85A 4GNFA 1U6GB 3HCUA 2ECNA 2MD7B 3O7AA 2MD8C 5B75A 5H1TA 3RPGB 5LKZA 4S3OC 2LGKA 2KFTA 4ZQLA 2MNZA 2JMIA 4A49A 2XEUA 3NG2A 2YHOA 5LKUA 3T6RA 3ASLA 4QF3A 4WZ0A 2D8SA 1BORA 2VJEB 3VK6A 2MNYA 1WGMA 5TABA 2EA6A 1VYXA 4MSXA 5G04B 3LQIA 3LQHA 2K4DA 4LKAA 3KV5A 4YATA 3ZVZB 5TBNA 2KR4A 2MIQA 3PHDA 5KH7A 5B76A 2MT5A 2AN6A 3N9QA 4B86C 4PPEA 2YUCA 4V3LC 4C9ZA 5FERA 4GB0A 3M99A 1WE9A 4P5OB 2Y1NA 3O37A 2LGVA 4YBMA 1G25A 2C2VS 5B8DA 2K16A 5KH9A 3GV4A 4YAXA 2YU4A 5FB0A 4LLBA 1RMDA 2ECWA 3L11A 5AIUA 4YBTA 4ZUXU 2CT2A 2LGLA 4UI9B 1WESA 5AITA 2MA6A 4BHWA 2YREA 2YT5A 4AVXA 5KH3A 2KGGA 3ZNIA 5H1VA 3ZYQA 2EODA 2NAAA 3HCTA 3HTKC 2KIZA 3DPLR 2F42A 3N9LA 3SHBA 4AP4A 4LJNA 4WZ2A 4O64A 1HYIA 1MM2A 5FB1A 3KV6A 4L58A 3M62A 4I7DA 1VFYA 5H1UA 1X4IA 3L1ZB 1JM7A 4V3KC 3KQIA 4LADB 3U5MA 1MM3A 3SOWA 1JM7B 5D1KB 1WEVA 5B79A 4UP5A 1WEEA 4FJCA 4R7EA 3O70A 3HCSA 1WFKA 2VPEA 2I50A 3LRQA 4YBSA 1FBVA 2KWOA 4GNGA 2L43A 4YC9A 1VD4A 2LQ6A 3FL2A 2Y43A 5DINA 4ZDTA 2IDAA 2E6RA 4S3OB 1WEQA 2YYRA 4PTBA 4WA6A 2ECGA 2L75A 3L1XA 3ZPV1 5JG6A 1F62A 2YQLA 5LKXA 2OXQC 1T1HA 3SOXA 4A4BA 3M63A 3PURA 4N4FA 2RSDA 2M6MA 2YSJA 5B77A 3O33A 2K1JA 2LGGA 3U5NA 2LV9A 3IHPA 2L0BA 3RTRB 1WENA 1K2FA 3N9MA 2CKLA 2H0DA 4YABA 4QF2A 1IYMA 3ZPVE 2YQMA 2VJFA 2LXHC 3O34A 1WEWA 1X4UA 2HYED 1CHCA 2CKLB 2H0DB 4A0CD 2LN0A 2ECTA 2KYUA
chains in the Genus database with same CATH superfamily
3MHHA 2KGIA 3N9OA 2KWKA 4CA1A 2KWNA 2B0OE 2ECIA 4FIPA 3DQVR 1WEPA 3N9PA 4N3WA 3U5OA 4NN2A 4AUQB 1WILA 4FK5A 2Y1MA 3FJUB 3LJUX 1JOCA 2UZGA 4FO9A 4R2YA 3FM8C 2XP0A 2KU3A 1WEUA 2JMDA 5G0FA 4X3GA 5TDRA 4LK9A 4GNDA 1ZBDB 4W4UA 4XI1A 3LDYA 1LDKC 4Z0OA 2JRJA 2FUUA 3Q1DA 3KNVA 3H7HA 2DX8A 3O47A 2ZETC 2G43A 4MVTA 2VP7A 2QIZA 2XB1A 2BAYA 2LRIC 2VPGA 2XOYA 3SOUA 1E4UA 2M1RA 2VJEA 5TDWA 2L7PA 3O36A 2KKYA 2M3HA 2MUMA 2KWJA 4IC3A 1N87A 2QJ0A 2EGPA 4OGCA 3QZVA 3C5KA 3PLWA 5LCWB 2CSVA 3C6WA 4F1PA 3M7KA 4A4CA 4CCGX 3I2DA 2KREA 5C11A 5I3LA 4IC2A 4AYCA 1Z60A 4I7BA 1LDJB 4R8PK 3GL6A 4YADA 2LDRA 3ZTGA 3EB5A 4AYCB 4H9DA 1WEOA 4WZ3B 2F6JA 1Z6UA 3MHSA 3LQJA 4L7XA 2G6QA 3U5PA 5D1LB 5EYAF 2QICA 1WEMA 4F52B 5LKTA 2EGMA 2YVRA 1X4JA 4I7CA 2PUYA 2C2LA 5D1MB 3ZVYA 2DJAA 3V43A 1FP0A 2KE1A 5B78A 2RR4A 2MA5A 2ECVA 2CSYA 2G45A 2F6NA 4GNEA 4BBQA 5H9MA 2JMJA 5DKAA 2FUIA 2JM3A 5TRBA 2K17A 2L80A 2M13A 2FSAA 5G05B 1HYJA 2YSMA 4B7YC 2CSZA 1DVPA 3EB6A 3N9NA 2YW8A 4Q6FA 2VJFB 5C13A 1Z2QA 2HDPA 3PUQA 1WIMA 3KDEC 2E6SA 5FEYA 2LXPC 2ECJA 3O35A 2VPDA 5K3QA 2YURA 3RPGC 5J3XA 5SVYA 2YHNA 2L5UA 2VNFA 2VPBA 2PNXA 2RI7A 4UP0A 4TKPB 1V87A 1XWHA 3T7LA 4Z0RA 2M85A 4GNFA 2DSMA 1U6GB 3HCUA 2ECNA 2MD7B 3O7AA 2MD8C 5B75A 5H1TA 3RPGB 5LKZA 4S3OC 2LGKA 2KFTA 3LVQE 2EXUA 4ZQLA 2MNZA 2JMIA 4A49A 2XEUA 3NG2A 2YHOA 5LKUA 3MDBC 3T6RA 2P57A 3ASLA 4QF3A 4WZ0A 2D8SA 2FD4A 1BORA 2VJEB 3VK6A 2MNYA 1WGMA 5TABA 2EA6A 1VYXA 2JUNA 4MSXA 5G04B 3LQIA 3LQHA 2K4DA 4LKAA 3KV5A 4YATA 3ZVZB 5TBNA 2XOCA 2KR4A 2MIQA 3PHDA 5KH7A 5B76A 2MT5A 2AN6A 3LVRE 3N9QA 4B86C 4PPEA 2YUCA 4V3LC 4C9ZA 3JUEA 5FERA 4GB0A 2OWAA 3M99A 1WE9A 4P5OB 2Y1NA 3O37A 2LGVA 4YBMA 1G25A 2C2VS 5B8DA 2K16A 5KH9A 2IQJA 3GV4A 4YAXA 2YU4A 5FB0A 4LLBA 1RMDA 2ECWA 3L11A 5AIUA 4YBTA 4ZUXU 2CT2A 2LGLA 4UI9B 1WESA 2CONA 2MA6A 5AITA 4BHWA 2FFWA 3FEHA 2YREA 2YT5A 4AVXA 5KH3A 2KGGA 3ZNIA 3E2DA 5H1VA 3ZYQA 2EODA 2NAAA 3HCTA 3HTKC 2KIZA 2D8UA 3DPLR 2F42A 3N9LA 3SHBA 4AP4A 4LJNA 4WZ2A 4O64A 1HYIA 1MM2A 5FB1A 3KV6A 4L58A 3M62A 4I7DA 1VFYA 5H1UA 1DCQA 1X4IA 3T9KA 3L1ZB 1JM7A 4V3KC 3KQIA 2CRWA 2KKXA 4LADB 3DWDA 3U5MA 1MM3A 3SOWA 1JM7B 3SUBA 5D1KB 1WEVA 5B79A 4UP5A 1WEEA 4FJCA 4R7EA 3DDTA 3O70A 3HCSA 1WFKA 2MKEA 2VPEA 2I50A 3LRQA 4YBSA 1FBVA 2KWOA 4GNGA 2L43A 4QQ4A 4YC9A 1VD4A 2LQ6A 3FL2A 2Y43A 5DINA 4ZDTA 2IDAA 2E6RA 2XOZA 2LAUA 4S3OB 3FANA 1WEQA 2YYRA 4PTBA 2ECGA 2L75A 4WA6A 3L1XA 3ZPV1 5JG6A 1F62A 2YQLA 5LKXA 1MBMA 2OXQC 1T1HA 4O62A 3SOXA 4A4BA 5SVXA 3M63A 3PURA 4N4FA 2RSDA 2M6MA 2YSJA 5B77A 3O33A 2K1JA 2CRRA 2LGGA 3U5NA 2LV9A 3IHPA 5SVIA 2L0BA 3RTRB 1WENA 4OGEA 1K2FA 3N9MA 5SVIB 2CKLA 2H0DA 4YABA 4QF2A 1IYMA 3FAOA 3ZPVE 2YQMA 2VJFA 2LXHC 3O34A 1WEWA 2E61A 1X4UA 2HYED 1CHCA 2CKLB 2H0DB 4A0CD 2LN0A 2ECTA 2KYUA
chains in the Genus database with same CATH topology
3MHHA 2KGIA 3N9OA 2KWKA 4CA1A 2KWNA 2ECIA 4FIPA 3DQVR 1WEPA 3N9PA 4N3WA 3U5OA 4NN2A 4AUQB 1WILA 4FK5A 2Y1MA 1JOCA 2UZGA 4FO9A 4R2YA 2KU3A 1WEUA 2JMDA 5G0FA 4X3GA 5TDRA 4LK9A 4GNDA 1ZBDB 4W4UA 4XI1A 1LDKC 2JRJA 2FUUA 3KNVA 2DX8A 2ZETC 2G43A 4MVTA 2VP7A 2QIZA 2XB1A 2BAYA 2LRIC 2VPGA 3SOUA 1E4UA 2M1RA 2VJEA 5TDWA 3O36A 2M3HA 2MUMA 2KWJA 4IC3A 1N87A 2QJ0A 2EGPA 3QZVA 3C5KA 5LCWB 3C6WA 4A4CA 4CCGX 3I2DA 2KREA 5C11A 5I3LA 4IC2A 4AYCA 1Z60A 4I7BA 1LDJB 4R8PK 3GL6A 4YADA 2LDRA 3ZTGA 3EB5A 4AYCB 1WEOA 4WZ3B 2F6JA 1Z6UA 3MHSA 3LQJA 4L7XA 2G6QA 3U5PA 5D1LB 5EYAF 2QICA 1WEMA 4F52B 5LKTA 1X4JA 4I7CA 2PUYA 2C2LA 5D1MB 3ZVYA 3V43A 1FP0A 2KE1A 5B78A 2MA5A 2ECVA 2CSYA 2G45A 2F6NA 4GNEA 4BBQA 5H9MA 2JMJA 5DKAA 2FUIA 5TRBA 2K17A 2L80A 2FSAA 5G05B 1HYJA 2YSMA 4B7YC 2CSZA 1DVPA 3EB6A 3N9NA 2YW8A 4Q6FA 2VJFB 5C13A 1Z2QA 2HDPA 3PUQA 1WIMA 2E6SA 5FEYA 2LXPC 2ECJA 3O35A 2VPDA 2YURA 3RPGC 5J3XA 2YHNA 2L5UA 2VNFA 2VPBA 2PNXA 2RI7A 4UP0A 4TKPB 1V87A 1XWHA 3T7LA 2M85A 4GNFA 1U6GB 3HCUA 2ECNA 2MD7B 3O7AA 2MD8C 5B75A 5H1TA 3RPGB 5LKZA 4S3OC 2LGKA 2KFTA 4ZQLA 2MNZA 2JMIA 4A49A 2XEUA 3NG2A 2YHOA 5LKUA 3T6RA 3ASLA 4QF3A 4WZ0A 2D8SA 1BORA 2VJEB 3VK6A 2MNYA 1WGMA 5TABA 2EA6A 1VYXA 4MSXA 5G04B 3LQIA 3LQHA 2K4DA 4LKAA 3KV5A 4YATA 3ZVZB 5TBNA 2KR4A 2MIQA 3PHDA 5KH7A 5B76A 2MT5A 2AN6A 3N9QA 4B86C 4PPEA 2YUCA 4V3LC 4C9ZA 5FERA 4GB0A 3M99A 1WE9A 4P5OB 2Y1NA 3O37A 2LGVA 4YBMA 1G25A 2C2VS 5B8DA 2K16A 5KH9A 3GV4A 4YAXA 2YU4A 5FB0A 4LLBA 1RMDA 2ECWA 3L11A 5AIUA 4YBTA 4ZUXU 2CT2A 2LGLA 4UI9B 1WESA 5AITA 2MA6A 4BHWA 2YREA 2YT5A 4AVXA 5KH3A 2KGGA 3ZNIA 5H1VA 3ZYQA 2EODA 2NAAA 3HCTA 3HTKC 2KIZA 3DPLR 2F42A 3N9LA 3SHBA 4AP4A 4LJNA 4WZ2A 4O64A 1HYIA 1MM2A 5FB1A 3KV6A 4L58A 3M62A 4I7DA 1VFYA 5H1UA 1X4IA 3L1ZB 1JM7A 4V3KC 3KQIA 4LADB 3U5MA 1MM3A 3SOWA 1JM7B 5D1KB 1WEVA 5B79A 4UP5A 1WEEA 4FJCA 4R7EA 3O70A 3HCSA 1WFKA 2VPEA 2I50A 3LRQA 4YBSA 1FBVA 2KWOA 4GNGA 2L43A 4YC9A 1VD4A 2LQ6A 3FL2A 2Y43A 5DINA 4ZDTA 2IDAA 2E6RA 4S3OB 1WEQA 2YYRA 4PTBA 4WA6A 2ECGA 2L75A 3L1XA 3ZPV1 5JG6A 1F62A 2YQLA 5LKXA 2OXQC 1T1HA 3SOXA 4A4BA 3M63A 3PURA 4N4FA 2RSDA 2M6MA 2YSJA 5B77A 3O33A 2K1JA 2LGGA 3U5NA 2LV9A 3IHPA 2L0BA 3RTRB 1WENA 1K2FA 3N9MA 2CKLA 2H0DA 4YABA 4QF2A 1IYMA 3ZPVE 2YQMA 2VJFA 2LXHC 3O34A 1WEWA 1X4UA 2HYED 1CHCA 2CKLB 2H0DB 4A0CD 2LN0A 2ECTA 2KYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH A;  2KGI A;  3N9O A;  2KWK A;  4CA1 A;  2KWN A;  2ECI A;  4FIP A;  3DQV R;  1WEP A;  3N9P A;  4N3W A;  3U5O A;  4NN2 A;  4AUQ B;  1WIL A;  4FK5 A;  2Y1M A;  1JOC A;  2UZG A;  4FO9 A;  4R2Y A;  2KU3 A;  1WEU A;  2JMD A;  5G0F A;  4X3G A;  5TDR A;  4LK9 A;  4GND A;  1ZBD B;  4W4U A;  4XI1 A;  1LDK C;  2JRJ A;  2FUU A;  3KNV A;  2DX8 A;  2ZET C;  2G43 A;  4MVT A;  2VP7 A;  2QIZ A;  2XB1 A;  2BAY A;  2LRI C;  2VPG A;  3SOU A;  1E4U A;  2M1R A;  2VJE A;  5TDW A;  3O36 A;  2M3H A;  2MUM A;  2KWJ A;  4IC3 A;  1N87 A;  2QJ0 A;  2EGP A;  3QZV A;  3C5K A;  5LCW B;  3C6W A;  4A4C A;  4CCG X;  3I2D A;  2KRE A;  5C11 A;  5I3L A;  4IC2 A;  4AYC A;  1Z60 A;  4I7B A;  1LDJ B;  4R8P K;  3GL6 A;  4YAD A;  2LDR A;  3ZTG A;  3EB5 A;  4AYC B;  1WEO A;  4WZ3 B;  2F6J A;  1Z6U A;  3MHS A;  3LQJ A;  4L7X A;  2G6Q A;  3U5P A;  5D1L B;  5EYA F;  2QIC A;  1WEM A;  4F52 B;  5LKT A;  1X4J A;  4I7C A;  2PUY A;  2C2L A;  5D1M B;  3ZVY A;  3V43 A;  1FP0 A;  2KE1 A;  5B78 A;  2MA5 A;  2ECV A;  2CSY A;  2G45 A;  2F6N A;  4GNE A;  4BBQ A;  5H9M A;  2JMJ A;  5DKA A;  2FUI A;  5TRB A;  2K17 A;  2L80 A;  2FSA A;  5G05 B;  1HYJ A;  2YSM A;  4B7Y C;  2CSZ A;  1DVP A;  3EB6 A;  3N9N A;  2YW8 A;  4Q6F A;  2VJF B;  5C13 A;  1Z2Q A;  2HDP A;  3PUQ A;  1WIM A;  2E6S A;  5FEY A;  2LXP C;  2ECJ A;  3O35 A;  2VPD A;  2YUR A;  3RPG C;  5J3X A;  2YHN A;  2L5U A;  2VNF A;  2VPB A;  2PNX A;  2RI7 A;  4UP0 A;  4TKP B;  1V87 A;  1XWH A;  3T7L A;  2M85 A;  4GNF A;  1U6G B;  3HCU A;  2ECN A;  2MD7 B;  3O7A A;  2MD8 C;  5B75 A;  5H1T A;  3RPG B;  5LKZ A;  4S3O C;  2LGK A;  2KFT A;  4ZQL A;  2MNZ A;  2JMI A;  4A49 A;  2XEU A;  3NG2 A;  2YHO A;  5LKU A;  3T6R A;  3ASL A;  4QF3 A;  4WZ0 A;  2D8S A;  1BOR A;  2VJE B;  3VK6 A;  2MNY A;  1WGM A;  5TAB A;  2EA6 A;  1VYX A;  4MSX A;  5G04 B;  3LQI A;  3LQH A;  2K4D A;  4LKA A;  3KV5 A;  4YAT A;  3ZVZ B;  5TBN A;  2KR4 A;  2MIQ A;  3PHD A;  5KH7 A;  5B76 A;  2MT5 A;  2AN6 A;  3N9Q A;  4B86 C;  4PPE A;  2YUC A;  4V3L C;  4C9Z A;  5FER A;  4GB0 A;  3M99 A;  1WE9 A;  4P5O B;  2Y1N A;  3O37 A;  2LGV A;  4YBM A;  1G25 A;  2C2V S;  5B8D A;  2K16 A;  5KH9 A;  3GV4 A;  4YAX A;  2YU4 A;  5FB0 A;  4LLB A;  1RMD A;  2ECW A;  3L11 A;  5AIU A;  4YBT A;  4ZUX U;  2CT2 A;  2LGL A;  4UI9 B;  1WES A;  5AIT A;  2MA6 A;  4BHW A;  2YRE A;  2YT5 A;  4AVX A;  5KH3 A;  2KGG A;  3ZNI A;  5H1V A;  3ZYQ A;  2EOD A;  2NAA A;  3HCT A;  3HTK C;  2KIZ A;  3DPL R;  2F42 A;  3N9L A;  3SHB A;  4AP4 A;  4LJN A;  4WZ2 A;  4O64 A;  1HYI A;  1MM2 A;  5FB1 A;  3KV6 A;  4L58 A;  3M62 A;  4I7D A;  1VFY A;  5H1U A;  1X4I A;  3L1Z B;  1JM7 A;  4V3K C;  3KQI A;  4LAD B;  3U5M A;  1MM3 A;  3SOW A;  1JM7 B;  5D1K B;  1WEV A;  5B79 A;  4UP5 A;  1WEE A;  4FJC A;  4R7E A;  3O70 A;  3HCS A;  1WFK A;  2VPE A;  2I50 A;  3LRQ A;  4YBS A;  1FBV A;  2KWO A;  4GNG A;  2L43 A;  4YC9 A;  1VD4 A;  2LQ6 A;  3FL2 A;  2Y43 A;  5DIN A;  4ZDT A;  2IDA A;  2E6R A;  4S3O B;  1WEQ A;  2YYR A;  4PTB A;  4WA6 A;  2ECG A;  2L75 A;  3L1X A;  3ZPV 1;  5JG6 A;  1F62 A;  2YQL A;  5LKX A;  2OXQ C;  1T1H A;  3SOX A;  4A4B A;  3M63 A;  3PUR A;  4N4F A;  2RSD A;  2M6M A;  2YSJ A;  5B77 A;  3O33 A;  2K1J A;  2LGG A;  3U5N A;  2LV9 A;  3IHP A;  2L0B A;  3RTR B;  1WEN A;  1K2F A;  3N9M A;  2CKL A;  2H0D A;  4YAB A;  4QF2 A;  1IYM A;  3ZPV E;  2YQM A;  2VJF A;  2LXH C;  3O34 A;  1WEW A;  1X4U A;  2HYE D;  1CHC A;  2CKL B;  2H0D B;  4A0C D;  2LN0 A;  2ECT A;  2KYU A; 
#chains in the Genus database with same CATH topology
 3MHH A;  2KGI A;  3N9O A;  2KWK A;  4CA1 A;  2KWN A;  2B0O E;  2ECI A;  4FIP A;  3DQV R;  1WEP A;  3N9P A;  4N3W A;  3U5O A;  4NN2 A;  4AUQ B;  1WIL A;  4FK5 A;  2Y1M A;  3FJU B;  3LJU X;  1JOC A;  2UZG A;  4FO9 A;  4R2Y A;  3FM8 C;  2XP0 A;  2KU3 A;  1WEU A;  2JMD A;  5G0F A;  4X3G A;  5TDR A;  4LK9 A;  4GND A;  1ZBD B;  4W4U A;  4XI1 A;  3LDY A;  1LDK C;  4Z0O A;  2JRJ A;  2FUU A;  3Q1D A;  3KNV A;  3H7H A;  2DX8 A;  3O47 A;  2ZET C;  2G43 A;  4MVT A;  2VP7 A;  2QIZ A;  2XB1 A;  2BAY A;  2LRI C;  2VPG A;  2XOY A;  3SOU A;  1E4U A;  2M1R A;  2VJE A;  5TDW A;  2L7P A;  3O36 A;  2KKY A;  2M3H A;  2MUM A;  2KWJ A;  4IC3 A;  1N87 A;  2QJ0 A;  2EGP A;  4OGC A;  3QZV A;  3C5K A;  3PLW A;  5LCW B;  2CSV A;  3C6W A;  4F1P A;  3M7K A;  4A4C A;  4CCG X;  3I2D A;  2KRE A;  5C11 A;  5I3L A;  4IC2 A;  4AYC A;  1Z60 A;  4I7B A;  1LDJ B;  4R8P K;  3GL6 A;  4YAD A;  2LDR A;  3ZTG A;  3EB5 A;  4AYC B;  4H9D A;  1WEO A;  4WZ3 B;  2F6J A;  1Z6U A;  3MHS A;  3LQJ A;  4L7X A;  2G6Q A;  3U5P A;  5D1L B;  5EYA F;  2QIC A;  1WEM A;  4F52 B;  5LKT A;  2EGM A;  2YVR A;  1X4J A;  4I7C A;  2PUY A;  2C2L A;  5D1M B;  3ZVY A;  2DJA A;  3V43 A;  1FP0 A;  2KE1 A;  5B78 A;  2RR4 A;  2MA5 A;  2ECV A;  2CSY A;  2G45 A;  2F6N A;  4GNE A;  4BBQ A;  5H9M A;  2JMJ A;  5DKA A;  2FUI A;  2JM3 A;  5TRB A;  2K17 A;  2L80 A;  2M13 A;  2FSA A;  5G05 B;  1HYJ A;  2YSM A;  4B7Y C;  2CSZ A;  1DVP A;  3EB6 A;  3N9N A;  2YW8 A;  4Q6F A;  2VJF B;  5C13 A;  1Z2Q A;  2HDP A;  3PUQ A;  1WIM A;  3KDE C;  2E6S A;  5FEY A;  2LXP C;  2ECJ A;  3O35 A;  2VPD A;  5K3Q A;  2YUR A;  3RPG C;  5J3X A;  5SVY A;  2YHN A;  2L5U A;  2VNF A;  2VPB A;  2PNX A;  2RI7 A;  4UP0 A;  4TKP B;  1V87 A;  1XWH A;  3T7L A;  4Z0R A;  2M85 A;  4GNF A;  2DSM A;  1U6G B;  3HCU A;  2ECN A;  2MD7 B;  3O7A A;  2MD8 C;  5B75 A;  5H1T A;  3RPG B;  5LKZ A;  4S3O C;  2LGK A;  2KFT A;  3LVQ E;  2EXU A;  4ZQL A;  2MNZ A;  2JMI A;  4A49 A;  2XEU A;  3NG2 A;  2YHO A;  5LKU A;  3MDB C;  3T6R A;  2P57 A;  3ASL A;  4QF3 A;  4WZ0 A;  2D8S A;  2FD4 A;  1BOR A;  2VJE B;  3VK6 A;  2MNY A;  1WGM A;  5TAB A;  2EA6 A;  1VYX A;  2JUN A;  4MSX A;  5G04 B;  3LQI A;  3LQH A;  2K4D A;  4LKA A;  3KV5 A;  4YAT A;  3ZVZ B;  5TBN A;  2XOC A;  2KR4 A;  2MIQ A;  3PHD A;  5KH7 A;  5B76 A;  2MT5 A;  2AN6 A;  3LVR E;  3N9Q A;  4B86 C;  4PPE A;  2YUC A;  4V3L C;  4C9Z A;  3JUE A;  5FER A;  4GB0 A;  2OWA A;  3M99 A;  1WE9 A;  4P5O B;  2Y1N A;  3O37 A;  2LGV A;  4YBM A;  1G25 A;  2C2V S;  5B8D A;  2K16 A;  5KH9 A;  2IQJ A;  3GV4 A;  4YAX A;  2YU4 A;  5FB0 A;  4LLB A;  1RMD A;  2ECW A;  3L11 A;  5AIU A;  4YBT A;  4ZUX U;  2CT2 A;  2LGL A;  4UI9 B;  1WES A;  2CON A;  2MA6 A;  5AIT A;  4BHW A;  2FFW A;  3FEH A;  2YRE A;  2YT5 A;  4AVX A;  5KH3 A;  2KGG A;  3ZNI A;  3E2D A;  5H1V A;  3ZYQ A;  2EOD A;  2NAA A;  3HCT A;  3HTK C;  2KIZ A;  2D8U A;  3DPL R;  2F42 A;  3N9L A;  3SHB A;  4AP4 A;  4LJN A;  4WZ2 A;  4O64 A;  1HYI A;  1MM2 A;  5FB1 A;  3KV6 A;  4L58 A;  3M62 A;  4I7D A;  1VFY A;  5H1U A;  1DCQ A;  1X4I A;  3T9K A;  3L1Z B;  1JM7 A;  4V3K C;  3KQI A;  2CRW A;  2KKX A;  4LAD B;  3DWD A;  3U5M A;  1MM3 A;  3SOW A;  1JM7 B;  3SUB A;  5D1K B;  1WEV A;  5B79 A;  4UP5 A;  1WEE A;  4FJC A;  4R7E A;  3DDT A;  3O70 A;  3HCS A;  1WFK A;  2MKE A;  2VPE A;  2I50 A;  3LRQ A;  4YBS A;  1FBV A;  2KWO A;  4GNG A;  2L43 A;  4QQ4 A;  4YC9 A;  1VD4 A;  2LQ6 A;  3FL2 A;  2Y43 A;  5DIN A;  4ZDT A;  2IDA A;  2E6R A;  2XOZ A;  2LAU A;  4S3O B;  3FAN A;  1WEQ A;  2YYR A;  4PTB A;  2ECG A;  2L75 A;  4WA6 A;  3L1X A;  3ZPV 1;  5JG6 A;  1F62 A;  2YQL A;  5LKX A;  1MBM A;  2OXQ C;  1T1H A;  4O62 A;  3SOX A;  4A4B A;  5SVX A;  3M63 A;  3PUR A;  4N4F A;  2RSD A;  2M6M A;  2YSJ A;  5B77 A;  3O33 A;  2K1J A;  2CRR A;  2LGG A;  3U5N A;  2LV9 A;  3IHP A;  5SVI A;  2L0B A;  3RTR B;  1WEN A;  4OGE A;  1K2F A;  3N9M A;  5SVI B;  2CKL A;  2H0D A;  4YAB A;  4QF2 A;  1IYM A;  3FAO A;  3ZPV E;  2YQM A;  2VJF A;  2LXH C;  3O34 A;  1WEW A;  2E61 A;  1X4U A;  2HYE D;  1CHC A;  2CKL B;  2H0D B;  4A0C D;  2LN0 A;  2ECT A;  2KYU A; 
#chains in the Genus database with same CATH homology
 3MHH A;  2KGI A;  3N9O A;  2KWK A;  4CA1 A;  2KWN A;  2ECI A;  4FIP A;  3DQV R;  1WEP A;  3N9P A;  4N3W A;  3U5O A;  4NN2 A;  4AUQ B;  1WIL A;  4FK5 A;  2Y1M A;  1JOC A;  2UZG A;  4FO9 A;  4R2Y A;  2KU3 A;  1WEU A;  2JMD A;  5G0F A;  4X3G A;  5TDR A;  4LK9 A;  4GND A;  1ZBD B;  4W4U A;  4XI1 A;  1LDK C;  2JRJ A;  2FUU A;  3KNV A;  2DX8 A;  2ZET C;  2G43 A;  4MVT A;  2VP7 A;  2QIZ A;  2XB1 A;  2BAY A;  2LRI C;  2VPG A;  3SOU A;  1E4U A;  2M1R A;  2VJE A;  5TDW A;  3O36 A;  2M3H A;  2MUM A;  2KWJ A;  4IC3 A;  1N87 A;  2QJ0 A;  2EGP A;  3QZV A;  3C5K A;  5LCW B;  3C6W A;  4A4C A;  4CCG X;  3I2D A;  2KRE A;  5C11 A;  5I3L A;  4IC2 A;  4AYC A;  1Z60 A;  4I7B A;  1LDJ B;  4R8P K;  3GL6 A;  4YAD A;  2LDR A;  3ZTG A;  3EB5 A;  4AYC B;  1WEO A;  4WZ3 B;  2F6J A;  1Z6U A;  3MHS A;  3LQJ A;  4L7X A;  2G6Q A;  3U5P A;  5D1L B;  5EYA F;  2QIC A;  1WEM A;  4F52 B;  5LKT A;  1X4J A;  4I7C A;  2PUY A;  2C2L A;  5D1M B;  3ZVY A;  3V43 A;  1FP0 A;  2KE1 A;  5B78 A;  2MA5 A;  2ECV A;  2CSY A;  2G45 A;  2F6N A;  4GNE A;  4BBQ A;  5H9M A;  2JMJ A;  5DKA A;  2FUI A;  5TRB A;  2K17 A;  2L80 A;  2FSA A;  5G05 B;  1HYJ A;  2YSM A;  4B7Y C;  2CSZ A;  1DVP A;  3EB6 A;  3N9N A;  2YW8 A;  4Q6F A;  2VJF B;  5C13 A;  1Z2Q A;  2HDP A;  3PUQ A;  1WIM A;  2E6S A;  5FEY A;  2LXP C;  2ECJ A;  3O35 A;  2VPD A;  2YUR A;  3RPG C;  5J3X A;  2YHN A;  2L5U A;  2VNF A;  2VPB A;  2PNX A;  2RI7 A;  4UP0 A;  4TKP B;  1V87 A;  1XWH A;  3T7L A;  2M85 A;  4GNF A;  1U6G B;  3HCU A;  2ECN A;  2MD7 B;  3O7A A;  2MD8 C;  5B75 A;  5H1T A;  3RPG B;  5LKZ A;  4S3O C;  2LGK A;  2KFT A;  4ZQL A;  2MNZ A;  2JMI A;  4A49 A;  2XEU A;  3NG2 A;  2YHO A;  5LKU A;  3T6R A;  3ASL A;  4QF3 A;  4WZ0 A;  2D8S A;  1BOR A;  2VJE B;  3VK6 A;  2MNY A;  1WGM A;  5TAB A;  2EA6 A;  1VYX A;  4MSX A;  5G04 B;  3LQI A;  3LQH A;  2K4D A;  4LKA A;  3KV5 A;  4YAT A;  3ZVZ B;  5TBN A;  2KR4 A;  2MIQ A;  3PHD A;  5KH7 A;  5B76 A;  2MT5 A;  2AN6 A;  3N9Q A;  4B86 C;  4PPE A;  2YUC A;  4V3L C;  4C9Z A;  5FER A;  4GB0 A;  3M99 A;  1WE9 A;  4P5O B;  2Y1N A;  3O37 A;  2LGV A;  4YBM A;  1G25 A;  2C2V S;  5B8D A;  2K16 A;  5KH9 A;  3GV4 A;  4YAX A;  2YU4 A;  5FB0 A;  4LLB A;  1RMD A;  2ECW A;  3L11 A;  5AIU A;  4YBT A;  4ZUX U;  2CT2 A;  2LGL A;  4UI9 B;  1WES A;  5AIT A;  2MA6 A;  4BHW A;  2YRE A;  2YT5 A;  4AVX A;  5KH3 A;  2KGG A;  3ZNI A;  5H1V A;  3ZYQ A;  2EOD A;  2NAA A;  3HCT A;  3HTK C;  2KIZ A;  3DPL R;  2F42 A;  3N9L A;  3SHB A;  4AP4 A;  4LJN A;  4WZ2 A;  4O64 A;  1HYI A;  1MM2 A;  5FB1 A;  3KV6 A;  4L58 A;  3M62 A;  4I7D A;  1VFY A;  5H1U A;  1X4I A;  3L1Z B;  1JM7 A;  4V3K C;  3KQI A;  4LAD B;  3U5M A;  1MM3 A;  3SOW A;  1JM7 B;  5D1K B;  1WEV A;  5B79 A;  4UP5 A;  1WEE A;  4FJC A;  4R7E A;  3O70 A;  3HCS A;  1WFK A;  2VPE A;  2I50 A;  3LRQ A;  4YBS A;  1FBV A;  2KWO A;  4GNG A;  2L43 A;  4YC9 A;  1VD4 A;  2LQ6 A;  3FL2 A;  2Y43 A;  5DIN A;  4ZDT A;  2IDA A;  2E6R A;  4S3O B;  1WEQ A;  2YYR A;  4PTB A;  4WA6 A;  2ECG A;  2L75 A;  3L1X A;  3ZPV 1;  5JG6 A;  1F62 A;  2YQL A;  5LKX A;  2OXQ C;  1T1H A;  3SOX A;  4A4B A;  3M63 A;  3PUR A;  4N4F A;  2RSD A;  2M6M A;  2YSJ A;  5B77 A;  3O33 A;  2K1J A;  2LGG A;  3U5N A;  2LV9 A;  3IHP A;  2L0B A;  3RTR B;  1WEN A;  1K2F A;  3N9M A;  2CKL A;  2H0D A;  4YAB A;  4QF2 A;  1IYM A;  3ZPV E;  2YQM A;  2VJF A;  2LXH C;  3O34 A;  1WEW A;  1X4U A;  2HYE D;  1CHC A;  2CKL B;  2H0D B;  4A0C D;  2LN0 A;  2ECT A;  2KYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...