3EB6A

Structure of the ciap2 ring domain bound to ubch5b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Baculoviral IAP repeat-containing protein 3
publication title Structures of the cIAP2 RING Domain Reveal Conformational Changes Associated with Ubiquitin-conjugating Enzyme (E2) Recruitment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, ligase
total genus 9
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3eb6A00
4NN2A 5TDRA 4AUQB 2NAAA 2K17A 4UI9B 4AYCB 3SOWA 5B78A 5LKTA 2ECJA 2KWOA 2YUCA 4A0CD 4S3OC 4QF3A 1U6GB 5TABA 1LDKC 2KIZA 4UP0A 3ZNIA 3L11A 4I7BA 1E4UA 2VNFA 4YABA 3ASLA 2VJFB 3PUQA 1CHCA 1X4JA 4WA6A 4N4FA 3L1XA 1WEVA 4YBSA 3PURA 5KH9A 1F62A 2FSAA 2CKLB 5LKXA 2E6SA 5TDWA 5B79A 2KREA 2LXHC 2QJ0A 2D8SA 5D1KB 4F52B 4B86C 1WESA 2KU3A 2LV9A 2QIZA 3C5KA 4B7YC 2LGVA 2JRJA 2H0DA 2M85A 1HYJA 4V3LC 2K4DA 2LXPC 2YSJA 4A4BA 3EB6A 2G43A 2F6NA 4GNFA 2LN0A 2G45A 4LKAA 3ZVYA 4WZ0A 1WIMA 1VD4A 1WEWA 3M63A 4LLBA 4O64A 1Z60A 3ZPVE 1WEQA 2VPEA 2HDPA 2KWNA 2MD7B 2C2LA 2L5UA 2M6MA 3O37A 4AP4A 4YAXA 3N9LA 1VFYA 1ZBDB 5G04B 5JG6A 3DQVR 2EGPA 2VPDA 3HCUA 2CKLA 5C11A 3KNVA 2HYED 2ECTA 2ECVA 4P5OB 2ECWA 4V3KC 4IC3A 1HYIA 4GNDA 2KFTA 2KWJA 4FK5A 3LRQA 2FUIA 1X4IA 2F42A 3ZPV1 2ECIA 2M1RA 2UZGA 4QF2A 2MA6A 3LQIA 3EB5A 4LADB 3HTKC 2YHNA 3N9NA 3O33A 4TKPB 2YURA 3MHSA 2KE1A 2RI7A 3GL6A 2MUMA 2YQLA 3VK6A 2KR4A 1MM3A 2LGGA 5B77A 2EA6A 4Q6FA 1X4UA 1G25A 5LKUA 5DKAA 5FERA 4I7DA 4CA1A 4WZ2A 3HCSA 3N9QA 5KH7A 2LGKA 4CCGX 2AN6A 5B75A 5AIUA 2FUUA 1Z2QA 4L58A 3T7LA 1MM2A 2KWKA 2L80A 4MSXA 4UP5A 3HCTA 1IYMA 2CT2A 4YBTA 2YQMA 5AITA 1JOCA 5H1UA 2XB1A 3N9MA 4L7XA 4BHWA 2YREA 4YATA 3IHPA 1WILA 4N3WA 1FP0A 2MA5A 1WE9A 4YADA 4YC9A 1Z6UA 5LCWB 2L75A 3V43A 5B76A 2YT5A 3L1ZB 2L0BA 2KGIA 4R7EA 3O35A 5FEYA 3SOXA 2ECGA 3SOUA 4A49A 4ZDTA 2L43A 1LDJB 4FJCA 2QICA 2K16A 2E6RA 2VP7A 4AVXA 5FB0A 5D1MB 5FB1A 3NG2A 1FBVA 2ECNA 3GV4A 5EYAF 1VYXA 4R8PK 5H9MA 3KV5A 4LJNA 1K2FA 4PTBA 5B8DA 3M62A 4GNEA 4S3OB 2LQ6A 2VJEA 3U5NA 2CSYA 4BBQA 3U5PA 3KV6A 2CSZA 2XEUA 2G6QA 4FIPA 2MT5A 2I50A 5D1LB 3FL2A 3ZVZB 5TBNA 2YHOA 2Y1MA 3ZTGA 3O34A 1RMDA 2OXQC 3PHDA 3O36A 2JMJA 2BAYA 5H1VA 3U5OA 5C13A 1JM7B 2MNZA 2LGLA 1WGMA 3T6RA 3KQIA 2C2VS 3ZYQA 2LDRA 3N9OA 2IDAA 2JMIA 5KH3A 1WFKA 5LKZA 3C6WA 4YBMA 4MVTA 4I7CA 3DPLR 5H1TA 5I3LA 3M99A 2YU4A 1WEEA 2VJEB 2K1JA 3SHBA 5J3XA 4GNGA 4IC2A 3LQHA 3QZVA 2PUYA 3I2DA 2KGGA 4X3GA 4WZ3B 5G0FA 2YSMA 2ZETC 4ZUXU 2JMDA 3MHHA 3RPGB 2YW8A 2VPBA 4GB0A 1WENA 2F6JA 2DX8A 1BORA 2YYRA 2LRIC 2KYUA 3U5MA 2Y43A 4AYCA 5G05B 5TRBA 1T1HA 1N87A 3RTRB 2RSDA 3N9PA 1XWHA 2PNXA 2VPGA 3RPGC 4W4UA 2M3HA 4XI1A 4LK9A 1JM7A 2Y1NA 2MD8C 1DVPA 4C9ZA 2EODA 1WEPA 3O70A 2MNYA 1WEUA 3O7AA 2VJFA 4ZQLA 4R2YA 3LQJA 1WEMA 2MIQA 5DINA 1V87A 4FO9A 4PPEA 4A4CA 1WEOA 2H0DB
chains in the Genus database with same CATH superfamily
4NN2A 5TDRA 4AUQB 2NAAA 2K17A 1DCQA 4UI9B 4AYCB 3SOWA 5B78A 5LKTA 2ECJA 2KWOA 2YUCA 4A0CD 4S3OC 4QF3A 1U6GB 2XOZA 5TABA 1LDKC 2KIZA 4UP0A 3ZNIA 3L11A 4I7BA 1E4UA 2M13A 2VNFA 4YABA 3ASLA 2VJFB 3PUQA 2CRRA 1CHCA 2JUNA 1X4JA 4WA6A 4N4FA 3FJUB 3L1XA 1WEVA 4YBSA 3PURA 5KH9A 1F62A 2FSAA 2CKLB 5LKXA 2E6SA 5TDWA 5B79A 2KREA 2LXHC 2QJ0A 2D8SA 5D1KB 2MKEA 4F52B 4B86C 1WESA 2KU3A 2LV9A 2QIZA 3C5KA 4B7YC 2LGVA 2JRJA 2H0DA 2M85A 1HYJA 4OGEA 4V3LC 2DJAA 2K4DA 2LXPC 2YSJA 4A4BA 3EB6A 2G43A 2F6NA 4GNFA 2P57A 2LN0A 2B0OE 2G45A 4LKAA 3ZVYA 1MBMA 3O47A 4WZ0A 1WIMA 1VD4A 1WEWA 3M63A 4LLBA 3FANA 2EXUA 1Z60A 4O64A 3ZPVE 1WEQA 2VPEA 2HDPA 2KWNA 2MD7B 2C2LA 2L5UA 2M6MA 3O37A 4AP4A 3T9KA 4YAXA 3N9LA 1VFYA 1ZBDB 5G04B 5JG6A 3SUBA 3DQVR 2EGPA 2VPDA 3HCUA 2CKLA 5C11A 3KNVA 2HYED 2ECTA 2ECVA 4P5OB 2ECWA 4V3KC 4IC3A 1HYIA 4GNDA 2KFTA 2KWJA 4FK5A 3LRQA 2FUIA 1X4IA 2F42A 3ZPV1 4F1PA 2ECIA 2M1RA 2UZGA 4QF2A 2MA6A 3LQIA 3EB5A 5SVXA 4LADB 3HTKC 2YHNA 3N9NA 3O33A 4TKPB 2YURA 2CRWA 3MHSA 2KE1A 2RI7A 3GL6A 2MUMA 2YQLA 3VK6A 2L7PA 2KR4A 1MM3A 2LGGA 5B77A 2EA6A 4Q6FA 1X4UA 1G25A 5LKUA 5DKAA 2YVRA 5FERA 4I7DA 4CA1A 4WZ2A 3HCSA 3FM8C 3N9QA 5KH7A 2LGKA 4CCGX 2AN6A 5B75A 5AIUA 2FUUA 1Z2QA 4L58A 3T7LA 1MM2A 3FEHA 2KWKA 2L80A 3Q1DA 4MSXA 4UP5A 2RR4A 3HCTA 1IYMA 2KKXA 2CT2A 4YBTA 2YQMA 4Z0OA 3MDBC 5AITA 5K3QA 1JOCA 5H1UA 2XB1A 3N9MA 3DDTA 4L7XA 4BHWA 2YREA 4YATA 3IHPA 3LDYA 1WILA 4N3WA 1FP0A 2MA5A 3LVQE 1WE9A 4QQ4A 4YADA 4YC9A 1Z6UA 5LCWB 2L75A 3V43A 5B76A 2YT5A 3L1ZB 2L0BA 2KGIA 4R7EA 3O35A 5FEYA 3SOXA 2ECGA 3SOUA 2EGMA 4A49A 4ZDTA 2L43A 1LDJB 4FJCA 2QICA 2K16A 5SVIA 2E6RA 2VP7A 4AVXA 5FB0A 3PLWA 5D1MB 5FB1A 3NG2A 1FBVA 2ECNA 3GV4A 5EYAF 2DSMA 1VYXA 4R8PK 5H9MA 3KV5A 4LJNA 1K2FA 4PTBA 5B8DA 3M62A 4GNEA 4S3OB 2LQ6A 2VJEA 3U5NA 2CSYA 4BBQA 3U5PA 3KV6A 2CSZA 3KDEC 2XEUA 2G6QA 4FIPA 2CONA 2MT5A 2I50A 5D1LB 3FL2A 3ZVZB 5TBNA 2YHOA 2Y1MA 4H9DA 3ZTGA 3M7KA 2IQJA 2JM3A 3O34A 1RMDA 2OXQC 3PHDA 3O36A 2JMJA 2BAYA 5H1VA 5SVIB 3U5OA 5C13A 4OGCA 1JM7B 2E61A 2MNZA 2LGLA 1WGMA 3T6RA 2FFWA 3KQIA 2C2VS 3ZYQA 2LDRA 3N9OA 2IDAA 2JMIA 5KH3A 1WFKA 5LKZA 3C6WA 3FAOA 4YBMA 4MVTA 4I7CA 3DWDA 3DPLR 5H1TA 5I3LA 3M99A 2YU4A 1WEEA 2KKYA 2VJEB 2K1JA 3SHBA 5J3XA 4GNGA 4IC2A 3LQHA 3QZVA 2PUYA 2XOYA 3I2DA 2KGGA 4X3GA 4WZ3B 5G0FA 3JUEA 2YSMA 2ZETC 4ZUXU 2JMDA 3MHHA 2D8UA 2FD4A 4Z0RA 3RPGB 3H7HA 2YW8A 2VPBA 4GB0A 1WENA 2F6JA 2DX8A 3LJUX 1BORA 2YYRA 2LRIC 2KYUA 2CSVA 3U5MA 2Y43A 2XOCA 4AYCA 5G05B 5TRBA 1T1HA 1N87A 3RTRB 2RSDA 3N9PA 1XWHA 2PNXA 2VPGA 3RPGC 4O62A 4W4UA 2M3HA 4XI1A 4LK9A 1JM7A 2Y1NA 2MD8C 1DVPA 4C9ZA 2EODA 1WEPA 3O70A 2MNYA 1WEUA 3O7AA 3LVRE 2VJFA 4ZQLA 5SVYA 4R2YA 3LQJA 1WEMA 2XP0A 3E2DA 2OWAA 2MIQA 5DINA 1V87A 4FO9A 4PPEA 4A4CA 2LAUA 1WEOA 2H0DB
chains in the Genus database with same CATH topology
4NN2A 5TDRA 4AUQB 2NAAA 2K17A 4UI9B 4AYCB 3SOWA 5B78A 5LKTA 2ECJA 2KWOA 2YUCA 4A0CD 4S3OC 4QF3A 1U6GB 5TABA 1LDKC 2KIZA 4UP0A 3ZNIA 3L11A 4I7BA 1E4UA 2VNFA 4YABA 3ASLA 2VJFB 3PUQA 1CHCA 1X4JA 4WA6A 4N4FA 3L1XA 1WEVA 4YBSA 3PURA 5KH9A 1F62A 2FSAA 2CKLB 5LKXA 2E6SA 5TDWA 5B79A 2KREA 2LXHC 2QJ0A 2D8SA 5D1KB 4F52B 4B86C 1WESA 2KU3A 2LV9A 2QIZA 3C5KA 4B7YC 2LGVA 2JRJA 2H0DA 2M85A 1HYJA 4V3LC 2K4DA 2LXPC 2YSJA 4A4BA 3EB6A 2G43A 2F6NA 4GNFA 2LN0A 2G45A 4LKAA 3ZVYA 4WZ0A 1WIMA 1VD4A 1WEWA 3M63A 4LLBA 4O64A 1Z60A 3ZPVE 1WEQA 2VPEA 2HDPA 2KWNA 2MD7B 2C2LA 2L5UA 2M6MA 3O37A 4AP4A 4YAXA 3N9LA 1VFYA 1ZBDB 5G04B 5JG6A 3DQVR 2EGPA 2VPDA 3HCUA 2CKLA 5C11A 3KNVA 2HYED 2ECTA 2ECVA 4P5OB 2ECWA 4V3KC 4IC3A 1HYIA 4GNDA 2KFTA 2KWJA 4FK5A 3LRQA 2FUIA 1X4IA 2F42A 3ZPV1 2ECIA 2M1RA 2UZGA 4QF2A 2MA6A 3LQIA 3EB5A 4LADB 3HTKC 2YHNA 3N9NA 3O33A 4TKPB 2YURA 3MHSA 2KE1A 2RI7A 3GL6A 2MUMA 2YQLA 3VK6A 2KR4A 1MM3A 2LGGA 5B77A 2EA6A 4Q6FA 1X4UA 1G25A 5LKUA 5DKAA 5FERA 4I7DA 4CA1A 4WZ2A 3HCSA 3N9QA 5KH7A 2LGKA 4CCGX 2AN6A 5B75A 5AIUA 2FUUA 1Z2QA 4L58A 3T7LA 1MM2A 2KWKA 2L80A 4MSXA 4UP5A 3HCTA 1IYMA 2CT2A 4YBTA 2YQMA 5AITA 1JOCA 5H1UA 2XB1A 3N9MA 4L7XA 4BHWA 2YREA 4YATA 3IHPA 1WILA 4N3WA 1FP0A 2MA5A 1WE9A 4YADA 4YC9A 1Z6UA 5LCWB 2L75A 3V43A 5B76A 2YT5A 3L1ZB 2L0BA 2KGIA 4R7EA 3O35A 5FEYA 3SOXA 2ECGA 3SOUA 4A49A 4ZDTA 2L43A 1LDJB 4FJCA 2QICA 2K16A 2E6RA 2VP7A 4AVXA 5FB0A 5D1MB 5FB1A 3NG2A 1FBVA 2ECNA 3GV4A 5EYAF 1VYXA 4R8PK 5H9MA 3KV5A 4LJNA 1K2FA 4PTBA 5B8DA 3M62A 4GNEA 4S3OB 2LQ6A 2VJEA 3U5NA 2CSYA 4BBQA 3U5PA 3KV6A 2CSZA 2XEUA 2G6QA 4FIPA 2MT5A 2I50A 5D1LB 3FL2A 3ZVZB 5TBNA 2YHOA 2Y1MA 3ZTGA 3O34A 1RMDA 2OXQC 3PHDA 3O36A 2JMJA 2BAYA 5H1VA 3U5OA 5C13A 1JM7B 2MNZA 2LGLA 1WGMA 3T6RA 3KQIA 2C2VS 3ZYQA 2LDRA 3N9OA 2IDAA 2JMIA 5KH3A 1WFKA 5LKZA 3C6WA 4YBMA 4MVTA 4I7CA 3DPLR 5H1TA 5I3LA 3M99A 2YU4A 1WEEA 2VJEB 2K1JA 3SHBA 5J3XA 4GNGA 4IC2A 3LQHA 3QZVA 2PUYA 3I2DA 2KGGA 4X3GA 4WZ3B 5G0FA 2YSMA 2ZETC 4ZUXU 2JMDA 3MHHA 3RPGB 2YW8A 2VPBA 4GB0A 1WENA 2F6JA 2DX8A 1BORA 2YYRA 2LRIC 2KYUA 3U5MA 2Y43A 4AYCA 5G05B 5TRBA 1T1HA 1N87A 3RTRB 2RSDA 3N9PA 1XWHA 2PNXA 2VPGA 3RPGC 4W4UA 2M3HA 4XI1A 4LK9A 1JM7A 2Y1NA 2MD8C 1DVPA 4C9ZA 2EODA 1WEPA 3O70A 2MNYA 1WEUA 3O7AA 2VJFA 4ZQLA 4R2YA 3LQJA 1WEMA 2MIQA 5DINA 1V87A 4FO9A 4PPEA 4A4CA 1WEOA 2H0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NN2 A;  5TDR A;  4AUQ B;  2NAA A;  2K17 A;  4UI9 B;  4AYC B;  3SOW A;  5B78 A;  5LKT A;  2ECJ A;  2KWO A;  2YUC A;  4A0C D;  4S3O C;  4QF3 A;  1U6G B;  5TAB A;  1LDK C;  2KIZ A;  4UP0 A;  3ZNI A;  3L11 A;  4I7B A;  1E4U A;  2VNF A;  4YAB A;  3ASL A;  2VJF B;  3PUQ A;  1CHC A;  1X4J A;  4WA6 A;  4N4F A;  3L1X A;  1WEV A;  4YBS A;  3PUR A;  5KH9 A;  1F62 A;  2FSA A;  2CKL B;  5LKX A;  2E6S A;  5TDW A;  5B79 A;  2KRE A;  2LXH C;  2QJ0 A;  2D8S A;  5D1K B;  4F52 B;  4B86 C;  1WES A;  2KU3 A;  2LV9 A;  2QIZ A;  3C5K A;  4B7Y C;  2LGV A;  2JRJ A;  2H0D A;  2M85 A;  1HYJ A;  4V3L C;  2K4D A;  2LXP C;  2YSJ A;  4A4B A;  3EB6 A;  2G43 A;  2F6N A;  4GNF A;  2LN0 A;  2G45 A;  4LKA A;  3ZVY A;  4WZ0 A;  1WIM A;  1VD4 A;  1WEW A;  3M63 A;  4LLB A;  4O64 A;  1Z60 A;  3ZPV E;  1WEQ A;  2VPE A;  2HDP A;  2KWN A;  2MD7 B;  2C2L A;  2L5U A;  2M6M A;  3O37 A;  4AP4 A;  4YAX A;  3N9L A;  1VFY A;  1ZBD B;  5G04 B;  5JG6 A;  3DQV R;  2EGP A;  2VPD A;  3HCU A;  2CKL A;  5C11 A;  3KNV A;  2HYE D;  2ECT A;  2ECV A;  4P5O B;  2ECW A;  4V3K C;  4IC3 A;  1HYI A;  4GND A;  2KFT A;  2KWJ A;  4FK5 A;  3LRQ A;  2FUI A;  1X4I A;  2F42 A;  3ZPV 1;  2ECI A;  2M1R A;  2UZG A;  4QF2 A;  2MA6 A;  3LQI A;  3EB5 A;  4LAD B;  3HTK C;  2YHN A;  3N9N A;  3O33 A;  4TKP B;  2YUR A;  3MHS A;  2KE1 A;  2RI7 A;  3GL6 A;  2MUM A;  2YQL A;  3VK6 A;  2KR4 A;  1MM3 A;  2LGG A;  5B77 A;  2EA6 A;  4Q6F A;  1X4U A;  1G25 A;  5LKU A;  5DKA A;  5FER A;  4I7D A;  4CA1 A;  4WZ2 A;  3HCS A;  3N9Q A;  5KH7 A;  2LGK A;  4CCG X;  2AN6 A;  5B75 A;  5AIU A;  2FUU A;  1Z2Q A;  4L58 A;  3T7L A;  1MM2 A;  2KWK A;  2L80 A;  4MSX A;  4UP5 A;  3HCT A;  1IYM A;  2CT2 A;  4YBT A;  2YQM A;  5AIT A;  1JOC A;  5H1U A;  2XB1 A;  3N9M A;  4L7X A;  4BHW A;  2YRE A;  4YAT A;  3IHP A;  1WIL A;  4N3W A;  1FP0 A;  2MA5 A;  1WE9 A;  4YAD A;  4YC9 A;  1Z6U A;  5LCW B;  2L75 A;  3V43 A;  5B76 A;  2YT5 A;  3L1Z B;  2L0B A;  2KGI A;  4R7E A;  3O35 A;  5FEY A;  3SOX A;  2ECG A;  3SOU A;  4A49 A;  4ZDT A;  2L43 A;  1LDJ B;  4FJC A;  2QIC A;  2K16 A;  2E6R A;  2VP7 A;  4AVX A;  5FB0 A;  5D1M B;  5FB1 A;  3NG2 A;  1FBV A;  2ECN A;  3GV4 A;  5EYA F;  1VYX A;  4R8P K;  5H9M A;  3KV5 A;  4LJN A;  1K2F A;  4PTB A;  5B8D A;  3M62 A;  4GNE A;  4S3O B;  2LQ6 A;  2VJE A;  3U5N A;  2CSY A;  4BBQ A;  3U5P A;  3KV6 A;  2CSZ A;  2XEU A;  2G6Q A;  4FIP A;  2MT5 A;  2I50 A;  5D1L B;  3FL2 A;  3ZVZ B;  5TBN A;  2YHO A;  2Y1M A;  3ZTG A;  3O34 A;  1RMD A;  2OXQ C;  3PHD A;  3O36 A;  2JMJ A;  2BAY A;  5H1V A;  3U5O A;  5C13 A;  1JM7 B;  2MNZ A;  2LGL A;  1WGM A;  3T6R A;  3KQI A;  2C2V S;  3ZYQ A;  2LDR A;  3N9O A;  2IDA A;  2JMI A;  5KH3 A;  1WFK A;  5LKZ A;  3C6W A;  4YBM A;  4MVT A;  4I7C A;  3DPL R;  5H1T A;  5I3L A;  3M99 A;  2YU4 A;  1WEE A;  2VJE B;  2K1J A;  3SHB A;  5J3X A;  4GNG A;  4IC2 A;  3LQH A;  3QZV A;  2PUY A;  3I2D A;  2KGG A;  4X3G A;  4WZ3 B;  5G0F A;  2YSM A;  2ZET C;  4ZUX U;  2JMD A;  3MHH A;  3RPG B;  2YW8 A;  2VPB A;  4GB0 A;  1WEN A;  2F6J A;  2DX8 A;  1BOR A;  2YYR A;  2LRI C;  2KYU A;  3U5M A;  2Y43 A;  4AYC A;  5G05 B;  5TRB A;  1T1H A;  1N87 A;  3RTR B;  2RSD A;  3N9P A;  1XWH A;  2PNX A;  2VPG A;  3RPG C;  4W4U A;  2M3H A;  4XI1 A;  4LK9 A;  1JM7 A;  2Y1N A;  2MD8 C;  1DVP A;  4C9Z A;  2EOD A;  1WEP A;  3O70 A;  2MNY A;  1WEU A;  3O7A A;  2VJF A;  4ZQL A;  4R2Y A;  3LQJ A;  1WEM A;  2MIQ A;  5DIN A;  1V87 A;  4FO9 A;  4PPE A;  4A4C A;  1WEO A;  2H0D B; 
#chains in the Genus database with same CATH topology
 4NN2 A;  5TDR A;  4AUQ B;  2NAA A;  2K17 A;  1DCQ A;  4UI9 B;  4AYC B;  3SOW A;  5B78 A;  5LKT A;  2ECJ A;  2KWO A;  2YUC A;  4A0C D;  4S3O C;  4QF3 A;  1U6G B;  2XOZ A;  5TAB A;  1LDK C;  2KIZ A;  4UP0 A;  3ZNI A;  3L11 A;  4I7B A;  1E4U A;  2M13 A;  2VNF A;  4YAB A;  3ASL A;  2VJF B;  3PUQ A;  2CRR A;  1CHC A;  2JUN A;  1X4J A;  4WA6 A;  4N4F A;  3FJU B;  3L1X A;  1WEV A;  4YBS A;  3PUR A;  5KH9 A;  1F62 A;  2FSA A;  2CKL B;  5LKX A;  2E6S A;  5TDW A;  5B79 A;  2KRE A;  2LXH C;  2QJ0 A;  2D8S A;  5D1K B;  2MKE A;  4F52 B;  4B86 C;  1WES A;  2KU3 A;  2LV9 A;  2QIZ A;  3C5K A;  4B7Y C;  2LGV A;  2JRJ A;  2H0D A;  2M85 A;  1HYJ A;  4OGE A;  4V3L C;  2DJA A;  2K4D A;  2LXP C;  2YSJ A;  4A4B A;  3EB6 A;  2G43 A;  2F6N A;  4GNF A;  2P57 A;  2LN0 A;  2B0O E;  2G45 A;  4LKA A;  3ZVY A;  1MBM A;  3O47 A;  4WZ0 A;  1WIM A;  1VD4 A;  1WEW A;  3M63 A;  4LLB A;  3FAN A;  2EXU A;  1Z60 A;  4O64 A;  3ZPV E;  1WEQ A;  2VPE A;  2HDP A;  2KWN A;  2MD7 B;  2C2L A;  2L5U A;  2M6M A;  3O37 A;  4AP4 A;  3T9K A;  4YAX A;  3N9L A;  1VFY A;  1ZBD B;  5G04 B;  5JG6 A;  3SUB A;  3DQV R;  2EGP A;  2VPD A;  3HCU A;  2CKL A;  5C11 A;  3KNV A;  2HYE D;  2ECT A;  2ECV A;  4P5O B;  2ECW A;  4V3K C;  4IC3 A;  1HYI A;  4GND A;  2KFT A;  2KWJ A;  4FK5 A;  3LRQ A;  2FUI A;  1X4I A;  2F42 A;  3ZPV 1;  4F1P A;  2ECI A;  2M1R A;  2UZG A;  4QF2 A;  2MA6 A;  3LQI A;  3EB5 A;  5SVX A;  4LAD B;  3HTK C;  2YHN A;  3N9N A;  3O33 A;  4TKP B;  2YUR A;  2CRW A;  3MHS A;  2KE1 A;  2RI7 A;  3GL6 A;  2MUM A;  2YQL A;  3VK6 A;  2L7P A;  2KR4 A;  1MM3 A;  2LGG A;  5B77 A;  2EA6 A;  4Q6F A;  1X4U A;  1G25 A;  5LKU A;  5DKA A;  2YVR A;  5FER A;  4I7D A;  4CA1 A;  4WZ2 A;  3HCS A;  3FM8 C;  3N9Q A;  5KH7 A;  2LGK A;  4CCG X;  2AN6 A;  5B75 A;  5AIU A;  2FUU A;  1Z2Q A;  4L58 A;  3T7L A;  1MM2 A;  3FEH A;  2KWK A;  2L80 A;  3Q1D A;  4MSX A;  4UP5 A;  2RR4 A;  3HCT A;  1IYM A;  2KKX A;  2CT2 A;  4YBT A;  2YQM A;  4Z0O A;  3MDB C;  5AIT A;  5K3Q A;  1JOC A;  5H1U A;  2XB1 A;  3N9M A;  3DDT A;  4L7X A;  4BHW A;  2YRE A;  4YAT A;  3IHP A;  3LDY A;  1WIL A;  4N3W A;  1FP0 A;  2MA5 A;  3LVQ E;  1WE9 A;  4QQ4 A;  4YAD A;  4YC9 A;  1Z6U A;  5LCW B;  2L75 A;  3V43 A;  5B76 A;  2YT5 A;  3L1Z B;  2L0B A;  2KGI A;  4R7E A;  3O35 A;  5FEY A;  3SOX A;  2ECG A;  3SOU A;  2EGM A;  4A49 A;  4ZDT A;  2L43 A;  1LDJ B;  4FJC A;  2QIC A;  2K16 A;  5SVI A;  2E6R A;  2VP7 A;  4AVX A;  5FB0 A;  3PLW A;  5D1M B;  5FB1 A;  3NG2 A;  1FBV A;  2ECN A;  3GV4 A;  5EYA F;  2DSM A;  1VYX A;  4R8P K;  5H9M A;  3KV5 A;  4LJN A;  1K2F A;  4PTB A;  5B8D A;  3M62 A;  4GNE A;  4S3O B;  2LQ6 A;  2VJE A;  3U5N A;  2CSY A;  4BBQ A;  3U5P A;  3KV6 A;  2CSZ A;  3KDE C;  2XEU A;  2G6Q A;  4FIP A;  2CON A;  2MT5 A;  2I50 A;  5D1L B;  3FL2 A;  3ZVZ B;  5TBN A;  2YHO A;  2Y1M A;  4H9D A;  3ZTG A;  3M7K A;  2IQJ A;  2JM3 A;  3O34 A;  1RMD A;  2OXQ C;  3PHD A;  3O36 A;  2JMJ A;  2BAY A;  5H1V A;  5SVI B;  3U5O A;  5C13 A;  4OGC A;  1JM7 B;  2E61 A;  2MNZ A;  2LGL A;  1WGM A;  3T6R A;  2FFW A;  3KQI A;  2C2V S;  3ZYQ A;  2LDR A;  3N9O A;  2IDA A;  2JMI A;  5KH3 A;  1WFK A;  5LKZ A;  3C6W A;  3FAO A;  4YBM A;  4MVT A;  4I7C A;  3DWD A;  3DPL R;  5H1T A;  5I3L A;  3M99 A;  2YU4 A;  1WEE A;  2KKY A;  2VJE B;  2K1J A;  3SHB A;  5J3X A;  4GNG A;  4IC2 A;  3LQH A;  3QZV A;  2PUY A;  2XOY A;  3I2D A;  2KGG A;  4X3G A;  4WZ3 B;  5G0F A;  3JUE A;  2YSM A;  2ZET C;  4ZUX U;  2JMD A;  3MHH A;  2D8U A;  2FD4 A;  4Z0R A;  3RPG B;  3H7H A;  2YW8 A;  2VPB A;  4GB0 A;  1WEN A;  2F6J A;  2DX8 A;  3LJU X;  1BOR A;  2YYR A;  2LRI C;  2KYU A;  2CSV A;  3U5M A;  2Y43 A;  2XOC A;  4AYC A;  5G05 B;  5TRB A;  1T1H A;  1N87 A;  3RTR B;  2RSD A;  3N9P A;  1XWH A;  2PNX A;  2VPG A;  3RPG C;  4O62 A;  4W4U A;  2M3H A;  4XI1 A;  4LK9 A;  1JM7 A;  2Y1N A;  2MD8 C;  1DVP A;  4C9Z A;  2EOD A;  1WEP A;  3O70 A;  2MNY A;  1WEU A;  3O7A A;  3LVR E;  2VJF A;  4ZQL A;  5SVY A;  4R2Y A;  3LQJ A;  1WEM A;  2XP0 A;  3E2D A;  2OWA A;  2MIQ A;  5DIN A;  1V87 A;  4FO9 A;  4PPE A;  4A4C A;  2LAU A;  1WEO A;  2H0D B; 
#chains in the Genus database with same CATH homology
 4NN2 A;  5TDR A;  4AUQ B;  2NAA A;  2K17 A;  4UI9 B;  4AYC B;  3SOW A;  5B78 A;  5LKT A;  2ECJ A;  2KWO A;  2YUC A;  4A0C D;  4S3O C;  4QF3 A;  1U6G B;  5TAB A;  1LDK C;  2KIZ A;  4UP0 A;  3ZNI A;  3L11 A;  4I7B A;  1E4U A;  2VNF A;  4YAB A;  3ASL A;  2VJF B;  3PUQ A;  1CHC A;  1X4J A;  4WA6 A;  4N4F A;  3L1X A;  1WEV A;  4YBS A;  3PUR A;  5KH9 A;  1F62 A;  2FSA A;  2CKL B;  5LKX A;  2E6S A;  5TDW A;  5B79 A;  2KRE A;  2LXH C;  2QJ0 A;  2D8S A;  5D1K B;  4F52 B;  4B86 C;  1WES A;  2KU3 A;  2LV9 A;  2QIZ A;  3C5K A;  4B7Y C;  2LGV A;  2JRJ A;  2H0D A;  2M85 A;  1HYJ A;  4V3L C;  2K4D A;  2LXP C;  2YSJ A;  4A4B A;  3EB6 A;  2G43 A;  2F6N A;  4GNF A;  2LN0 A;  2G45 A;  4LKA A;  3ZVY A;  4WZ0 A;  1WIM A;  1VD4 A;  1WEW A;  3M63 A;  4LLB A;  4O64 A;  1Z60 A;  3ZPV E;  1WEQ A;  2VPE A;  2HDP A;  2KWN A;  2MD7 B;  2C2L A;  2L5U A;  2M6M A;  3O37 A;  4AP4 A;  4YAX A;  3N9L A;  1VFY A;  1ZBD B;  5G04 B;  5JG6 A;  3DQV R;  2EGP A;  2VPD A;  3HCU A;  2CKL A;  5C11 A;  3KNV A;  2HYE D;  2ECT A;  2ECV A;  4P5O B;  2ECW A;  4V3K C;  4IC3 A;  1HYI A;  4GND A;  2KFT A;  2KWJ A;  4FK5 A;  3LRQ A;  2FUI A;  1X4I A;  2F42 A;  3ZPV 1;  2ECI A;  2M1R A;  2UZG A;  4QF2 A;  2MA6 A;  3LQI A;  3EB5 A;  4LAD B;  3HTK C;  2YHN A;  3N9N A;  3O33 A;  4TKP B;  2YUR A;  3MHS A;  2KE1 A;  2RI7 A;  3GL6 A;  2MUM A;  2YQL A;  3VK6 A;  2KR4 A;  1MM3 A;  2LGG A;  5B77 A;  2EA6 A;  4Q6F A;  1X4U A;  1G25 A;  5LKU A;  5DKA A;  5FER A;  4I7D A;  4CA1 A;  4WZ2 A;  3HCS A;  3N9Q A;  5KH7 A;  2LGK A;  4CCG X;  2AN6 A;  5B75 A;  5AIU A;  2FUU A;  1Z2Q A;  4L58 A;  3T7L A;  1MM2 A;  2KWK A;  2L80 A;  4MSX A;  4UP5 A;  3HCT A;  1IYM A;  2CT2 A;  4YBT A;  2YQM A;  5AIT A;  1JOC A;  5H1U A;  2XB1 A;  3N9M A;  4L7X A;  4BHW A;  2YRE A;  4YAT A;  3IHP A;  1WIL A;  4N3W A;  1FP0 A;  2MA5 A;  1WE9 A;  4YAD A;  4YC9 A;  1Z6U A;  5LCW B;  2L75 A;  3V43 A;  5B76 A;  2YT5 A;  3L1Z B;  2L0B A;  2KGI A;  4R7E A;  3O35 A;  5FEY A;  3SOX A;  2ECG A;  3SOU A;  4A49 A;  4ZDT A;  2L43 A;  1LDJ B;  4FJC A;  2QIC A;  2K16 A;  2E6R A;  2VP7 A;  4AVX A;  5FB0 A;  5D1M B;  5FB1 A;  3NG2 A;  1FBV A;  2ECN A;  3GV4 A;  5EYA F;  1VYX A;  4R8P K;  5H9M A;  3KV5 A;  4LJN A;  1K2F A;  4PTB A;  5B8D A;  3M62 A;  4GNE A;  4S3O B;  2LQ6 A;  2VJE A;  3U5N A;  2CSY A;  4BBQ A;  3U5P A;  3KV6 A;  2CSZ A;  2XEU A;  2G6Q A;  4FIP A;  2MT5 A;  2I50 A;  5D1L B;  3FL2 A;  3ZVZ B;  5TBN A;  2YHO A;  2Y1M A;  3ZTG A;  3O34 A;  1RMD A;  2OXQ C;  3PHD A;  3O36 A;  2JMJ A;  2BAY A;  5H1V A;  3U5O A;  5C13 A;  1JM7 B;  2MNZ A;  2LGL A;  1WGM A;  3T6R A;  3KQI A;  2C2V S;  3ZYQ A;  2LDR A;  3N9O A;  2IDA A;  2JMI A;  5KH3 A;  1WFK A;  5LKZ A;  3C6W A;  4YBM A;  4MVT A;  4I7C A;  3DPL R;  5H1T A;  5I3L A;  3M99 A;  2YU4 A;  1WEE A;  2VJE B;  2K1J A;  3SHB A;  5J3X A;  4GNG A;  4IC2 A;  3LQH A;  3QZV A;  2PUY A;  3I2D A;  2KGG A;  4X3G A;  4WZ3 B;  5G0F A;  2YSM A;  2ZET C;  4ZUX U;  2JMD A;  3MHH A;  3RPG B;  2YW8 A;  2VPB A;  4GB0 A;  1WEN A;  2F6J A;  2DX8 A;  1BOR A;  2YYR A;  2LRI C;  2KYU A;  3U5M A;  2Y43 A;  4AYC A;  5G05 B;  5TRB A;  1T1H A;  1N87 A;  3RTR B;  2RSD A;  3N9P A;  1XWH A;  2PNX A;  2VPG A;  3RPG C;  4W4U A;  2M3H A;  4XI1 A;  4LK9 A;  1JM7 A;  2Y1N A;  2MD8 C;  1DVP A;  4C9Z A;  2EOD A;  1WEP A;  3O70 A;  2MNY A;  1WEU A;  3O7A A;  2VJF A;  4ZQL A;  4R2Y A;  3LQJ A;  1WEM A;  2MIQ A;  5DIN A;  1V87 A;  4FO9 A;  4PPE A;  4A4C A;  1WEO A;  2H0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...