3EB6A

Structure of the ciap2 ring domain bound to ubch5b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis, ligase
molecule keywords Baculoviral IAP repeat-containing protein 3
publication title Structures of the cIAP2 RING Domain Reveal Conformational Changes Associated with Ubiquitin-conjugating Enzyme (E2) Recruitment.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3eb6A00
2I50A 2G43A 4Q6FA 3U5PA 3N9NA 4UI9B 2CSYA 1E4UA 2L80A 3HCSA 4YBMA 1F62A 4I7BA 5TBNA 4L7XA 2MNYA 4BHWA 2LXHC 2HYED 3PUQA 4WZ0A 1X4IA 5FERA 3GL6A 2PUYA 2VJFB 3EB6A 3N9PA 3M99A 3LQIA 2YHNA 2KU3A 5AIUA 1WEQA 2KIZA 2KR4A 3SOWA 2K1JA 3HTKC 2EA6A 3RPGB 5FB1A 2AN6A 4LLBA 4X3GA 1JM7B 2ECTA 5TDRA 1WILA 5H1UA 4WZ3B 1T1HA 1LDJB 2VPGA 3O7AA 4LADB 3C6WA 4ZQLA 2KREA 1WEMA 4ZDTA 4R2YA 2KWJA 5H1VA 4YABA 2QJ0A 3KV6A 5B78A 5C13A 2IDAA 4BBQA 1WEOA 3ZVZB 1WEPA 2Y1MA 3PHDA 3N9OA 2L43A 2M6MA 2YURA 4FO9A 5KH9A 1XWHA 2KWKA 5B77A 2QIZA 4AVXA 2YSJA 4AYCA 2ZETC 3NG2A 2CT2A 4WA6A 5D1MB 2VNFA 2KGIA 4YADA 4R7EA 3VK6A 4GNEA 5J3XA 1Z2QA 4GNGA 2XB1A 3U5OA 3L11A 3LQHA 1WFKA 2VP7A 2Y43A 5LKZA 4F52B 3SOXA 2NAAA 1K2FA 2VJEA 1WIMA 3L1XA 2YYRA 3HCTA 4WZ2A 2LGKA 1DVPA 2YQLA 2ECVA 1ZBDB 2C2LA 4LJNA 1WEUA 4QF2A 3PURA 2JMIA 5FB0A 2KWOA 2Y1NA 2M85A 3N9QA 2YQMA 4N3WA 4IC2A 2FUUA 2LDRA 5I3LA 2EODA 5G04B 1V87A 5JG6A 2K17A 3KNVA 4FJCA 2L5UA 2M1RA 3L1ZB 3RTRB 2KYUA 1HYIA 3T7LA 4AYCB 2LN0A 1U6GB 4L58A 3SHBA 3SOUA 4A0CD 1IYMA 5KH7A 2KWNA 5LKUA 2UZGA 5DKAA 5TDWA 3O35A 1VD4A 5B76A 2LV9A 1Z6UA 2LGGA 2FSAA 2OXQC 1WESA 1BORA 1JOCA 5FEYA 2G45A 5D1KB 3DQVR 2VJEB 2K4DA 4O64A 1G25A 2KE1A 2CKLA 3O36A 3V43A 2RSDA 5EYAF 1VYXA 3U5MA 2K16A 5G0FA 2E6SA 4CA1A 4B86C 3RPGC 4LK9A 4GNDA 3O34A 2D8SA 3O70A 5H1TA 4W4UA 2H0DA 2F6NA 2BAYA 2MD7B 2RI7A 4MVTA 5TABA 2MD8C 4NN2A 3O37A 5LKTA 2E6RA 3KV5A 2YW8A 3GV4A 2F42A 1CHCA 1MM3A 2LQ6A 2C2VS 4S3OC 4A4CA 1RMDA 5LKXA 2ECNA 4I7DA 4V3KC 5LCWB 4YBTA 5B79A 2LGVA 2G6QA 3KQIA 4IC3A 3M62A 3ZPVE 2EGPA 1WE9A 1X4JA 4UP5A 1Z60A 5AITA 5TRBA 4CCGX 4R8PK 2YREA 2LGLA 2JMDA 3QZVA 3ZNIA 2FUIA 4ZUXU 2CKLB 2HDPA 5H9MA 5G05B 3EB5A 2L75A 1FP0A 2ECWA 4C9ZA 3I2DA 2VPDA 4FIPA 2MA5A 2JRJA 2YT5A 2MIQA 4GNFA 2MT5A 4A4BA 2MA6A 3FL2A 4GB0A 3ZTGA 3T6RA 2XEUA 2H0DB 3LRQA 3HCUA 2QICA 3C5KA 4UP0A 4MSXA 1FBVA 4A49A 2PNXA 1HYJA 2L0BA 2YUCA 4YATA 3U5NA 5B75A 2VJFA 3O33A 4XI1A 5C11A 3N9MA 2MNZA 3LQJA 5D1LB 3IHPA 2CSZA 4FK5A 3MHHA 1WEVA 4S3OB 2ECGA 3ZVYA 4AUQB 4V3LC 2LXPC 4P5OB 2YSMA 4I7CA 4YBSA 2YU4A 2YHOA 2VPEA 1JM7A 1WEWA 1WENA 4YAXA 3ZYQA 2F6JA 2DX8A 5KH3A 2LRIC 4AP4A 1WEEA 4B7YC 4PPEA 2VPBA 1LDKC 2ECIA 1X4UA 2JMJA 4LKAA 2ECJA 3ZPV1 2MUMA 3MHSA 4PTBA 2KFTA 1WGMA 1VFYA 3ASLA 4TKPB 1MM2A 4QF3A 4N4FA 3N9LA 1N87A 3M63A 5B8DA 2M3HA 5DINA 4YC9A 2KGGA 3DPLR
chains in the Genus database with same CATH superfamily
2I50A 2G43A 4Q6FA 2EXUA 3U5PA 1MBMA 3N9NA 4UI9B 2CSYA 1E4UA 2L80A 3HCSA 4YBMA 1F62A 3T9KA 3DWDA 4I7BA 5SVIB 5TBNA 4L7XA 2DSMA 2MNYA 4BHWA 2LXHC 2HYED 3PUQA 4WZ0A 1X4IA 5FERA 3GL6A 2PUYA 2VJFB 3JUEA 3EB6A 3N9PA 3M99A 3LQIA 2YHNA 2KU3A 5AIUA 1WEQA 2KIZA 2KR4A 3SOWA 2K1JA 3HTKC 2EA6A 3LVQE 3RPGB 5FB1A 1DCQA 2AN6A 4LLBA 5SVXA 4X3GA 1JM7B 2ECTA 5TDRA 1WILA 5H1UA 4WZ3B 1T1HA 1LDJB 2VPGA 3O7AA 4LADB 2M13A 3C6WA 4ZQLA 2KREA 1WEMA 2YVRA 4ZDTA 4R2YA 2KWJA 3H7HA 5H1VA 4YABA 2QJ0A 3KV6A 5B78A 5C13A 2IDAA 4BBQA 1WEOA 3ZVZB 1WEPA 3O47A 2Y1MA 3FEHA 3PHDA 3N9OA 2L43A 2M6MA 2YURA 4FO9A 5KH9A 1XWHA 2XOZA 2KWKA 5B77A 2QIZA 4AVXA 2CRRA 2YSJA 4AYCA 2ZETC 3NG2A 2CT2A 4WA6A 5D1MB 2VNFA 2KGIA 4YADA 4R7EA 3VK6A 4GNEA 5J3XA 1Z2QA 2CONA 4GNGA 2XB1A 3U5OA 3L11A 3LQHA 1WFKA 2VP7A 2Y43A 5LKZA 2E61A 4F52B 3SOXA 2NAAA 1K2FA 2VJEA 1WIMA 3L1XA 2YYRA 3HCTA 4WZ2A 5K3QA 2LGKA 2OWAA 1DVPA 2YQLA 2ECVA 4Z0RA 2LAUA 1ZBDB 2C2LA 4LJNA 2XOYA 3KDEC 2EGMA 2FD4A 1WEUA 4QF2A 3LJUX 3PURA 2KKYA 2JMIA 2KWOA 5FB0A 2Y1NA 2M85A 3M7KA 3N9QA 2YQMA 4N3WA 4IC2A 2FUUA 2LDRA 5I3LA 2EODA 5G04B 1V87A 5JG6A 2K17A 3FJUB 3KNVA 4FJCA 2L5UA 2M1RA 3L1ZB 3RTRB 2KYUA 1HYIA 2XOCA 3T7LA 4AYCB 2LN0A 1U6GB 4L58A 3SHBA 3SOUA 4A0CD 1IYMA 5KH7A 2KWNA 5LKUA 2UZGA 5DKAA 5TDWA 3O35A 1VD4A 5B76A 2LV9A 1Z6UA 4H9DA 2LGGA 2FSAA 2OXQC 1WESA 1BORA 1JOCA 5FEYA 2G45A 2DJAA 5D1KB 5SVYA 3DQVR 2VJEB 2K4DA 4O64A 1G25A 2KE1A 2CKLA 3O36A 3V43A 2RSDA 5EYAF 4QQ4A 1VYXA 3U5MA 2K16A 5G0FA 2E6SA 4CA1A 4B86C 3RPGC 4O62A 4LK9A 4GNDA 3O34A 2D8SA 3O70A 5H1TA 4W4UA 2H0DA 2F6NA 2BAYA 2MD7B 2RI7A 4MVTA 5TABA 2MD8C 4NN2A 3O37A 5LKTA 2E6RA 3KV5A 2YW8A 4OGCA 2IQJA 3GV4A 2F42A 1CHCA 1MM3A 2LQ6A 2C2VS 4S3OC 4A4CA 1RMDA 5LKXA 2ECNA 4I7DA 4V3KC 5LCWB 4YBTA 5B79A 2LGVA 2G6QA 3KQIA 4IC3A 3M62A 2CRWA 3ZPVE 2EGPA 1WE9A 1X4JA 4UP5A 1Z60A 5AITA 5TRBA 4CCGX 2L7PA 4R8PK 2YREA 2LGLA 2JMDA 3QZVA 3ZNIA 2FUIA 4ZUXU 2CKLB 2HDPA 2FFWA 5H9MA 5G05B 3EB5A 2D8UA 2L75A 4Z0OA 1FP0A 2ECWA 4C9ZA 3I2DA 2VPDA 3DDTA 2MA5A 4FIPA 2JRJA 2YT5A 2MIQA 4GNFA 2MT5A 4A4BA 2MA6A 3FL2A 2CSVA 4GB0A 3ZTGA 2XP0A 3T6RA 2XEUA 3PLWA 2H0DB 3LRQA 3LVRE 3Q1DA 3HCUA 2QICA 3C5KA 2JUNA 4UP0A 2KKXA 5SVIA 4MSXA 1FBVA 4A49A 2PNXA 1HYJA 2L0BA 2YUCA 4YATA 3U5NA 5B75A 2VJFA 3O33A 4XI1A 5C11A 4F1PA 3N9MA 3LDYA 2MNZA 3LQJA 5D1LB 3E2DA 3IHPA 2CSZA 4FK5A 3MHHA 1WEVA 4S3OB 2ECGA 3ZVYA 4AUQB 4V3LC 2LXPC 4P5OB 2YSMA 4I7CA 4YBSA 2YU4A 3FM8C 2YHOA 3SUBA 2VPEA 1JM7A 1WEWA 1WENA 4YAXA 3ZYQA 2F6JA 2DX8A 5KH3A 2LRIC 2JM3A 4AP4A 1WEEA 4B7YC 2B0OE 3FAOA 2P57A 4PPEA 2VPBA 1LDKC 2ECIA 1X4UA 2JMJA 4LKAA 4OGEA 2ECJA 3ZPV1 2MUMA 3MHSA 4PTBA 2KFTA 1WGMA 1VFYA 3ASLA 3MDBC 4TKPB 1MM2A 3FANA 4QF3A 4N4FA 2MKEA 3N9LA 1N87A 3M63A 5B8DA 2M3HA 2RR4A 5DINA 4YC9A 2KGGA 3DPLR
chains in the Genus database with same CATH topology
2I50A 2G43A 4Q6FA 3U5PA 3N9NA 4UI9B 2CSYA 1E4UA 2L80A 3HCSA 4YBMA 1F62A 4I7BA 5TBNA 4L7XA 2MNYA 4BHWA 2LXHC 2HYED 3PUQA 4WZ0A 1X4IA 5FERA 3GL6A 2PUYA 2VJFB 3EB6A 3N9PA 3M99A 3LQIA 2YHNA 2KU3A 5AIUA 1WEQA 2KIZA 2KR4A 3SOWA 2K1JA 3HTKC 2EA6A 3RPGB 5FB1A 2AN6A 4LLBA 4X3GA 1JM7B 2ECTA 5TDRA 1WILA 5H1UA 4WZ3B 1T1HA 1LDJB 2VPGA 3O7AA 4LADB 3C6WA 4ZQLA 2KREA 1WEMA 4ZDTA 4R2YA 2KWJA 5H1VA 4YABA 2QJ0A 3KV6A 5B78A 5C13A 2IDAA 4BBQA 1WEOA 3ZVZB 1WEPA 2Y1MA 3PHDA 3N9OA 2L43A 2M6MA 2YURA 4FO9A 5KH9A 1XWHA 2KWKA 5B77A 2QIZA 4AVXA 2YSJA 4AYCA 2ZETC 3NG2A 2CT2A 4WA6A 5D1MB 2VNFA 2KGIA 4YADA 4R7EA 3VK6A 4GNEA 5J3XA 1Z2QA 4GNGA 2XB1A 3U5OA 3L11A 3LQHA 1WFKA 2VP7A 2Y43A 5LKZA 4F52B 3SOXA 2NAAA 1K2FA 2VJEA 1WIMA 3L1XA 2YYRA 3HCTA 4WZ2A 2LGKA 1DVPA 2YQLA 2ECVA 1ZBDB 2C2LA 4LJNA 1WEUA 4QF2A 3PURA 2JMIA 5FB0A 2KWOA 2Y1NA 2M85A 3N9QA 2YQMA 4N3WA 4IC2A 2FUUA 2LDRA 5I3LA 2EODA 5G04B 1V87A 5JG6A 2K17A 3KNVA 4FJCA 2L5UA 2M1RA 3L1ZB 3RTRB 2KYUA 1HYIA 3T7LA 4AYCB 2LN0A 1U6GB 4L58A 3SHBA 3SOUA 4A0CD 1IYMA 5KH7A 2KWNA 5LKUA 2UZGA 5DKAA 5TDWA 3O35A 1VD4A 5B76A 2LV9A 1Z6UA 2LGGA 2FSAA 2OXQC 1WESA 1BORA 1JOCA 5FEYA 2G45A 5D1KB 3DQVR 2VJEB 2K4DA 4O64A 1G25A 2KE1A 2CKLA 3O36A 3V43A 2RSDA 5EYAF 1VYXA 3U5MA 2K16A 5G0FA 2E6SA 4CA1A 4B86C 3RPGC 4LK9A 4GNDA 3O34A 2D8SA 3O70A 5H1TA 4W4UA 2H0DA 2F6NA 2BAYA 2MD7B 2RI7A 4MVTA 5TABA 2MD8C 4NN2A 3O37A 5LKTA 2E6RA 3KV5A 2YW8A 3GV4A 2F42A 1CHCA 1MM3A 2LQ6A 2C2VS 4S3OC 4A4CA 1RMDA 5LKXA 2ECNA 4I7DA 4V3KC 5LCWB 4YBTA 5B79A 2LGVA 2G6QA 3KQIA 4IC3A 3M62A 3ZPVE 2EGPA 1WE9A 1X4JA 4UP5A 1Z60A 5AITA 5TRBA 4CCGX 4R8PK 2YREA 2LGLA 2JMDA 3QZVA 3ZNIA 2FUIA 4ZUXU 2CKLB 2HDPA 5H9MA 5G05B 3EB5A 2L75A 1FP0A 2ECWA 4C9ZA 3I2DA 2VPDA 4FIPA 2MA5A 2JRJA 2YT5A 2MIQA 4GNFA 2MT5A 4A4BA 2MA6A 3FL2A 4GB0A 3ZTGA 3T6RA 2XEUA 2H0DB 3LRQA 3HCUA 2QICA 3C5KA 4UP0A 4MSXA 1FBVA 4A49A 2PNXA 1HYJA 2L0BA 2YUCA 4YATA 3U5NA 5B75A 2VJFA 3O33A 4XI1A 5C11A 3N9MA 2MNZA 3LQJA 5D1LB 3IHPA 2CSZA 4FK5A 3MHHA 1WEVA 4S3OB 2ECGA 3ZVYA 4AUQB 4V3LC 2LXPC 4P5OB 2YSMA 4I7CA 4YBSA 2YU4A 2YHOA 2VPEA 1JM7A 1WEWA 1WENA 4YAXA 3ZYQA 2F6JA 2DX8A 5KH3A 2LRIC 4AP4A 1WEEA 4B7YC 4PPEA 2VPBA 1LDKC 2ECIA 1X4UA 2JMJA 4LKAA 2ECJA 3ZPV1 2MUMA 3MHSA 4PTBA 2KFTA 1WGMA 1VFYA 3ASLA 4TKPB 1MM2A 4QF3A 4N4FA 3N9LA 1N87A 3M63A 5B8DA 2M3HA 5DINA 4YC9A 2KGGA 3DPLR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I50 A;  2G43 A;  4Q6F A;  3U5P A;  3N9N A;  4UI9 B;  2CSY A;  1E4U A;  2L80 A;  3HCS A;  4YBM A;  1F62 A;  4I7B A;  5TBN A;  4L7X A;  2MNY A;  4BHW A;  2LXH C;  2HYE D;  3PUQ A;  4WZ0 A;  1X4I A;  5FER A;  3GL6 A;  2PUY A;  2VJF B;  3EB6 A;  3N9P A;  3M99 A;  3LQI A;  2YHN A;  2KU3 A;  5AIU A;  1WEQ A;  2KIZ A;  2KR4 A;  3SOW A;  2K1J A;  3HTK C;  2EA6 A;  3RPG B;  5FB1 A;  2AN6 A;  4LLB A;  4X3G A;  1JM7 B;  2ECT A;  5TDR A;  1WIL A;  5H1U A;  4WZ3 B;  1T1H A;  1LDJ B;  2VPG A;  3O7A A;  4LAD B;  3C6W A;  4ZQL A;  2KRE A;  1WEM A;  4ZDT A;  4R2Y A;  2KWJ A;  5H1V A;  4YAB A;  2QJ0 A;  3KV6 A;  5B78 A;  5C13 A;  2IDA A;  4BBQ A;  1WEO A;  3ZVZ B;  1WEP A;  2Y1M A;  3PHD A;  3N9O A;  2L43 A;  2M6M A;  2YUR A;  4FO9 A;  5KH9 A;  1XWH A;  2KWK A;  5B77 A;  2QIZ A;  4AVX A;  2YSJ A;  4AYC A;  2ZET C;  3NG2 A;  2CT2 A;  4WA6 A;  5D1M B;  2VNF A;  2KGI A;  4YAD A;  4R7E A;  3VK6 A;  4GNE A;  5J3X A;  1Z2Q A;  4GNG A;  2XB1 A;  3U5O A;  3L11 A;  3LQH A;  1WFK A;  2VP7 A;  2Y43 A;  5LKZ A;  4F52 B;  3SOX A;  2NAA A;  1K2F A;  2VJE A;  1WIM A;  3L1X A;  2YYR A;  3HCT A;  4WZ2 A;  2LGK A;  1DVP A;  2YQL A;  2ECV A;  1ZBD B;  2C2L A;  4LJN A;  1WEU A;  4QF2 A;  3PUR A;  2JMI A;  5FB0 A;  2KWO A;  2Y1N A;  2M85 A;  3N9Q A;  2YQM A;  4N3W A;  4IC2 A;  2FUU A;  2LDR A;  5I3L A;  2EOD A;  5G04 B;  1V87 A;  5JG6 A;  2K17 A;  3KNV A;  4FJC A;  2L5U A;  2M1R A;  3L1Z B;  3RTR B;  2KYU A;  1HYI A;  3T7L A;  4AYC B;  2LN0 A;  1U6G B;  4L58 A;  3SHB A;  3SOU A;  4A0C D;  1IYM A;  5KH7 A;  2KWN A;  5LKU A;  2UZG A;  5DKA A;  5TDW A;  3O35 A;  1VD4 A;  5B76 A;  2LV9 A;  1Z6U A;  2LGG A;  2FSA A;  2OXQ C;  1WES A;  1BOR A;  1JOC A;  5FEY A;  2G45 A;  5D1K B;  3DQV R;  2VJE B;  2K4D A;  4O64 A;  1G25 A;  2KE1 A;  2CKL A;  3O36 A;  3V43 A;  2RSD A;  5EYA F;  1VYX A;  3U5M A;  2K16 A;  5G0F A;  2E6S A;  4CA1 A;  4B86 C;  3RPG C;  4LK9 A;  4GND A;  3O34 A;  2D8S A;  3O70 A;  5H1T A;  4W4U A;  2H0D A;  2F6N A;  2BAY A;  2MD7 B;  2RI7 A;  4MVT A;  5TAB A;  2MD8 C;  4NN2 A;  3O37 A;  5LKT A;  2E6R A;  3KV5 A;  2YW8 A;  3GV4 A;  2F42 A;  1CHC A;  1MM3 A;  2LQ6 A;  2C2V S;  4S3O C;  4A4C A;  1RMD A;  5LKX A;  2ECN A;  4I7D A;  4V3K C;  5LCW B;  4YBT A;  5B79 A;  2LGV A;  2G6Q A;  3KQI A;  4IC3 A;  3M62 A;  3ZPV E;  2EGP A;  1WE9 A;  1X4J A;  4UP5 A;  1Z60 A;  5AIT A;  5TRB A;  4CCG X;  4R8P K;  2YRE A;  2LGL A;  2JMD A;  3QZV A;  3ZNI A;  2FUI A;  4ZUX U;  2CKL B;  2HDP A;  5H9M A;  5G05 B;  3EB5 A;  2L75 A;  1FP0 A;  2ECW A;  4C9Z A;  3I2D A;  2VPD A;  4FIP A;  2MA5 A;  2JRJ A;  2YT5 A;  2MIQ A;  4GNF A;  2MT5 A;  4A4B A;  2MA6 A;  3FL2 A;  4GB0 A;  3ZTG A;  3T6R A;  2XEU A;  2H0D B;  3LRQ A;  3HCU A;  2QIC A;  3C5K A;  4UP0 A;  4MSX A;  1FBV A;  4A49 A;  2PNX A;  1HYJ A;  2L0B A;  2YUC A;  4YAT A;  3U5N A;  5B75 A;  2VJF A;  3O33 A;  4XI1 A;  5C11 A;  3N9M A;  2MNZ A;  3LQJ A;  5D1L B;  3IHP A;  2CSZ A;  4FK5 A;  3MHH A;  1WEV A;  4S3O B;  2ECG A;  3ZVY A;  4AUQ B;  4V3L C;  2LXP C;  4P5O B;  2YSM A;  4I7C A;  4YBS A;  2YU4 A;  2YHO A;  2VPE A;  1JM7 A;  1WEW A;  1WEN A;  4YAX A;  3ZYQ A;  2F6J A;  2DX8 A;  5KH3 A;  2LRI C;  4AP4 A;  1WEE A;  4B7Y C;  4PPE A;  2VPB A;  1LDK C;  2ECI A;  1X4U A;  2JMJ A;  4LKA A;  2ECJ A;  3ZPV 1;  2MUM A;  3MHS A;  4PTB A;  2KFT A;  1WGM A;  1VFY A;  3ASL A;  4TKP B;  1MM2 A;  4QF3 A;  4N4F A;  3N9L A;  1N87 A;  3M63 A;  5B8D A;  2M3H A;  5DIN A;  4YC9 A;  2KGG A;  3DPL R; 
#chains in the Genus database with same CATH topology
 2I50 A;  2G43 A;  4Q6F A;  2EXU A;  3U5P A;  1MBM A;  3N9N A;  4UI9 B;  2CSY A;  1E4U A;  2L80 A;  3HCS A;  4YBM A;  1F62 A;  3T9K A;  3DWD A;  4I7B A;  5SVI B;  5TBN A;  4L7X A;  2DSM A;  2MNY A;  4BHW A;  2LXH C;  2HYE D;  3PUQ A;  4WZ0 A;  1X4I A;  5FER A;  3GL6 A;  2PUY A;  2VJF B;  3JUE A;  3EB6 A;  3N9P A;  3M99 A;  3LQI A;  2YHN A;  2KU3 A;  5AIU A;  1WEQ A;  2KIZ A;  2KR4 A;  3SOW A;  2K1J A;  3HTK C;  2EA6 A;  3LVQ E;  3RPG B;  5FB1 A;  1DCQ A;  2AN6 A;  4LLB A;  5SVX A;  4X3G A;  1JM7 B;  2ECT A;  5TDR A;  1WIL A;  5H1U A;  4WZ3 B;  1T1H A;  1LDJ B;  2VPG A;  3O7A A;  4LAD B;  2M13 A;  3C6W A;  4ZQL A;  2KRE A;  1WEM A;  2YVR A;  4ZDT A;  4R2Y A;  2KWJ A;  3H7H A;  5H1V A;  4YAB A;  2QJ0 A;  3KV6 A;  5B78 A;  5C13 A;  2IDA A;  4BBQ A;  1WEO A;  3ZVZ B;  1WEP A;  3O47 A;  2Y1M A;  3FEH A;  3PHD A;  3N9O A;  2L43 A;  2M6M A;  2YUR A;  4FO9 A;  5KH9 A;  1XWH A;  2XOZ A;  2KWK A;  5B77 A;  2QIZ A;  4AVX A;  2CRR A;  2YSJ A;  4AYC A;  2ZET C;  3NG2 A;  2CT2 A;  4WA6 A;  5D1M B;  2VNF A;  2KGI A;  4YAD A;  4R7E A;  3VK6 A;  4GNE A;  5J3X A;  1Z2Q A;  2CON A;  4GNG A;  2XB1 A;  3U5O A;  3L11 A;  3LQH A;  1WFK A;  2VP7 A;  2Y43 A;  5LKZ A;  2E61 A;  4F52 B;  3SOX A;  2NAA A;  1K2F A;  2VJE A;  1WIM A;  3L1X A;  2YYR A;  3HCT A;  4WZ2 A;  5K3Q A;  2LGK A;  2OWA A;  1DVP A;  2YQL A;  2ECV A;  4Z0R A;  2LAU A;  1ZBD B;  2C2L A;  4LJN A;  2XOY A;  3KDE C;  2EGM A;  2FD4 A;  1WEU A;  4QF2 A;  3LJU X;  3PUR A;  2KKY A;  2JMI A;  2KWO A;  5FB0 A;  2Y1N A;  2M85 A;  3M7K A;  3N9Q A;  2YQM A;  4N3W A;  4IC2 A;  2FUU A;  2LDR A;  5I3L A;  2EOD A;  5G04 B;  1V87 A;  5JG6 A;  2K17 A;  3FJU B;  3KNV A;  4FJC A;  2L5U A;  2M1R A;  3L1Z B;  3RTR B;  2KYU A;  1HYI A;  2XOC A;  3T7L A;  4AYC B;  2LN0 A;  1U6G B;  4L58 A;  3SHB A;  3SOU A;  4A0C D;  1IYM A;  5KH7 A;  2KWN A;  5LKU A;  2UZG A;  5DKA A;  5TDW A;  3O35 A;  1VD4 A;  5B76 A;  2LV9 A;  1Z6U A;  4H9D A;  2LGG A;  2FSA A;  2OXQ C;  1WES A;  1BOR A;  1JOC A;  5FEY A;  2G45 A;  2DJA A;  5D1K B;  5SVY A;  3DQV R;  2VJE B;  2K4D A;  4O64 A;  1G25 A;  2KE1 A;  2CKL A;  3O36 A;  3V43 A;  2RSD A;  5EYA F;  4QQ4 A;  1VYX A;  3U5M A;  2K16 A;  5G0F A;  2E6S A;  4CA1 A;  4B86 C;  3RPG C;  4O62 A;  4LK9 A;  4GND A;  3O34 A;  2D8S A;  3O70 A;  5H1T A;  4W4U A;  2H0D A;  2F6N A;  2BAY A;  2MD7 B;  2RI7 A;  4MVT A;  5TAB A;  2MD8 C;  4NN2 A;  3O37 A;  5LKT A;  2E6R A;  3KV5 A;  2YW8 A;  4OGC A;  2IQJ A;  3GV4 A;  2F42 A;  1CHC A;  1MM3 A;  2LQ6 A;  2C2V S;  4S3O C;  4A4C A;  1RMD A;  5LKX A;  2ECN A;  4I7D A;  4V3K C;  5LCW B;  4YBT A;  5B79 A;  2LGV A;  2G6Q A;  3KQI A;  4IC3 A;  3M62 A;  2CRW A;  3ZPV E;  2EGP A;  1WE9 A;  1X4J A;  4UP5 A;  1Z60 A;  5AIT A;  5TRB A;  4CCG X;  2L7P A;  4R8P K;  2YRE A;  2LGL A;  2JMD A;  3QZV A;  3ZNI A;  2FUI A;  4ZUX U;  2CKL B;  2HDP A;  2FFW A;  5H9M A;  5G05 B;  3EB5 A;  2D8U A;  2L75 A;  4Z0O A;  1FP0 A;  2ECW A;  4C9Z A;  3I2D A;  2VPD A;  3DDT A;  2MA5 A;  4FIP A;  2JRJ A;  2YT5 A;  2MIQ A;  4GNF A;  2MT5 A;  4A4B A;  2MA6 A;  3FL2 A;  2CSV A;  4GB0 A;  3ZTG A;  2XP0 A;  3T6R A;  2XEU A;  3PLW A;  2H0D B;  3LRQ A;  3LVR E;  3Q1D A;  3HCU A;  2QIC A;  3C5K A;  2JUN A;  4UP0 A;  2KKX A;  5SVI A;  4MSX A;  1FBV A;  4A49 A;  2PNX A;  1HYJ A;  2L0B A;  2YUC A;  4YAT A;  3U5N A;  5B75 A;  2VJF A;  3O33 A;  4XI1 A;  5C11 A;  4F1P A;  3N9M A;  3LDY A;  2MNZ A;  3LQJ A;  5D1L B;  3E2D A;  3IHP A;  2CSZ A;  4FK5 A;  3MHH A;  1WEV A;  4S3O B;  2ECG A;  3ZVY A;  4AUQ B;  4V3L C;  2LXP C;  4P5O B;  2YSM A;  4I7C A;  4YBS A;  2YU4 A;  3FM8 C;  2YHO A;  3SUB A;  2VPE A;  1JM7 A;  1WEW A;  1WEN A;  4YAX A;  3ZYQ A;  2F6J A;  2DX8 A;  5KH3 A;  2LRI C;  2JM3 A;  4AP4 A;  1WEE A;  4B7Y C;  2B0O E;  3FAO A;  2P57 A;  4PPE A;  2VPB A;  1LDK C;  2ECI A;  1X4U A;  2JMJ A;  4LKA A;  4OGE A;  2ECJ A;  3ZPV 1;  2MUM A;  3MHS A;  4PTB A;  2KFT A;  1WGM A;  1VFY A;  3ASL A;  3MDB C;  4TKP B;  1MM2 A;  3FAN A;  4QF3 A;  4N4F A;  2MKE A;  3N9L A;  1N87 A;  3M63 A;  5B8D A;  2M3H A;  2RR4 A;  5DIN A;  4YC9 A;  2KGG A;  3DPL R; 
#chains in the Genus database with same CATH homology
 2I50 A;  2G43 A;  4Q6F A;  3U5P A;  3N9N A;  4UI9 B;  2CSY A;  1E4U A;  2L80 A;  3HCS A;  4YBM A;  1F62 A;  4I7B A;  5TBN A;  4L7X A;  2MNY A;  4BHW A;  2LXH C;  2HYE D;  3PUQ A;  4WZ0 A;  1X4I A;  5FER A;  3GL6 A;  2PUY A;  2VJF B;  3EB6 A;  3N9P A;  3M99 A;  3LQI A;  2YHN A;  2KU3 A;  5AIU A;  1WEQ A;  2KIZ A;  2KR4 A;  3SOW A;  2K1J A;  3HTK C;  2EA6 A;  3RPG B;  5FB1 A;  2AN6 A;  4LLB A;  4X3G A;  1JM7 B;  2ECT A;  5TDR A;  1WIL A;  5H1U A;  4WZ3 B;  1T1H A;  1LDJ B;  2VPG A;  3O7A A;  4LAD B;  3C6W A;  4ZQL A;  2KRE A;  1WEM A;  4ZDT A;  4R2Y A;  2KWJ A;  5H1V A;  4YAB A;  2QJ0 A;  3KV6 A;  5B78 A;  5C13 A;  2IDA A;  4BBQ A;  1WEO A;  3ZVZ B;  1WEP A;  2Y1M A;  3PHD A;  3N9O A;  2L43 A;  2M6M A;  2YUR A;  4FO9 A;  5KH9 A;  1XWH A;  2KWK A;  5B77 A;  2QIZ A;  4AVX A;  2YSJ A;  4AYC A;  2ZET C;  3NG2 A;  2CT2 A;  4WA6 A;  5D1M B;  2VNF A;  2KGI A;  4YAD A;  4R7E A;  3VK6 A;  4GNE A;  5J3X A;  1Z2Q A;  4GNG A;  2XB1 A;  3U5O A;  3L11 A;  3LQH A;  1WFK A;  2VP7 A;  2Y43 A;  5LKZ A;  4F52 B;  3SOX A;  2NAA A;  1K2F A;  2VJE A;  1WIM A;  3L1X A;  2YYR A;  3HCT A;  4WZ2 A;  2LGK A;  1DVP A;  2YQL A;  2ECV A;  1ZBD B;  2C2L A;  4LJN A;  1WEU A;  4QF2 A;  3PUR A;  2JMI A;  5FB0 A;  2KWO A;  2Y1N A;  2M85 A;  3N9Q A;  2YQM A;  4N3W A;  4IC2 A;  2FUU A;  2LDR A;  5I3L A;  2EOD A;  5G04 B;  1V87 A;  5JG6 A;  2K17 A;  3KNV A;  4FJC A;  2L5U A;  2M1R A;  3L1Z B;  3RTR B;  2KYU A;  1HYI A;  3T7L A;  4AYC B;  2LN0 A;  1U6G B;  4L58 A;  3SHB A;  3SOU A;  4A0C D;  1IYM A;  5KH7 A;  2KWN A;  5LKU A;  2UZG A;  5DKA A;  5TDW A;  3O35 A;  1VD4 A;  5B76 A;  2LV9 A;  1Z6U A;  2LGG A;  2FSA A;  2OXQ C;  1WES A;  1BOR A;  1JOC A;  5FEY A;  2G45 A;  5D1K B;  3DQV R;  2VJE B;  2K4D A;  4O64 A;  1G25 A;  2KE1 A;  2CKL A;  3O36 A;  3V43 A;  2RSD A;  5EYA F;  1VYX A;  3U5M A;  2K16 A;  5G0F A;  2E6S A;  4CA1 A;  4B86 C;  3RPG C;  4LK9 A;  4GND A;  3O34 A;  2D8S A;  3O70 A;  5H1T A;  4W4U A;  2H0D A;  2F6N A;  2BAY A;  2MD7 B;  2RI7 A;  4MVT A;  5TAB A;  2MD8 C;  4NN2 A;  3O37 A;  5LKT A;  2E6R A;  3KV5 A;  2YW8 A;  3GV4 A;  2F42 A;  1CHC A;  1MM3 A;  2LQ6 A;  2C2V S;  4S3O C;  4A4C A;  1RMD A;  5LKX A;  2ECN A;  4I7D A;  4V3K C;  5LCW B;  4YBT A;  5B79 A;  2LGV A;  2G6Q A;  3KQI A;  4IC3 A;  3M62 A;  3ZPV E;  2EGP A;  1WE9 A;  1X4J A;  4UP5 A;  1Z60 A;  5AIT A;  5TRB A;  4CCG X;  4R8P K;  2YRE A;  2LGL A;  2JMD A;  3QZV A;  3ZNI A;  2FUI A;  4ZUX U;  2CKL B;  2HDP A;  5H9M A;  5G05 B;  3EB5 A;  2L75 A;  1FP0 A;  2ECW A;  4C9Z A;  3I2D A;  2VPD A;  4FIP A;  2MA5 A;  2JRJ A;  2YT5 A;  2MIQ A;  4GNF A;  2MT5 A;  4A4B A;  2MA6 A;  3FL2 A;  4GB0 A;  3ZTG A;  3T6R A;  2XEU A;  2H0D B;  3LRQ A;  3HCU A;  2QIC A;  3C5K A;  4UP0 A;  4MSX A;  1FBV A;  4A49 A;  2PNX A;  1HYJ A;  2L0B A;  2YUC A;  4YAT A;  3U5N A;  5B75 A;  2VJF A;  3O33 A;  4XI1 A;  5C11 A;  3N9M A;  2MNZ A;  3LQJ A;  5D1L B;  3IHP A;  2CSZ A;  4FK5 A;  3MHH A;  1WEV A;  4S3O B;  2ECG A;  3ZVY A;  4AUQ B;  4V3L C;  2LXP C;  4P5O B;  2YSM A;  4I7C A;  4YBS A;  2YU4 A;  2YHO A;  2VPE A;  1JM7 A;  1WEW A;  1WEN A;  4YAX A;  3ZYQ A;  2F6J A;  2DX8 A;  5KH3 A;  2LRI C;  4AP4 A;  1WEE A;  4B7Y C;  4PPE A;  2VPB A;  1LDK C;  2ECI A;  1X4U A;  2JMJ A;  4LKA A;  2ECJ A;  3ZPV 1;  2MUM A;  3MHS A;  4PTB A;  2KFT A;  1WGM A;  1VFY A;  3ASL A;  4TKP B;  1MM2 A;  4QF3 A;  4N4F A;  3N9L A;  1N87 A;  3M63 A;  5B8D A;  2M3H A;  5DIN A;  4YC9 A;  2KGG A;  3DPL R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...