3EB6A

Structure of the ciap2 ring domain bound to ubch5b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the cIAP2 RING Domain Reveal Conformational Changes Associated with Ubiquitin-conjugating Enzyme (E2) Recruitment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, ligase
molecule keywords Baculoviral IAP repeat-containing protein 3
total genus 9
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3eb6A00
3RTRB 3N9NA 5D1KB 4AP4A 1IYMA 4QF3A 5H1UA 3RPGC 3KQIA 1Z2QA 5JG6A 1VD4A 2CKLB 1X4JA 2K4DA 4WZ3B 2Y43A 2MT5A 2PUYA 5B77A 2MD8C 5B8DA 2CKLA 5C13A 3VK6A 2CT2A 2ECIA 3O34A 2E6RA 5H1TA 3SOXA 1FP0A 1VFYA 1WEPA 2K1JA 1F62A 5TDRA 4C9ZA 1X4IA 4I7BA 1JM7A 3O36A 2D8SA 3PUQA 3NG2A 5KH7A 1CHCA 2M85A 5DINA 1WFKA 1WEOA 5FB0A 5AITA 2RI7A 3MHHA 1VYXA 2YQLA 4S3OB 2YT5A 1JM7B 2QIZA 2AN6A 2VJEB 3ASLA 1JOCA 3L1XA 3N9LA 4UP0A 2Y1MA 4O64A 1WEUA 2FSAA 2IDAA 2LGLA 2EODA 4I7CA 3L1ZB 2XB1A 4YABA 1WE9A 2XEUA 5LCWB 2JMDA 2MUMA 5FEYA 5B79A 2KWNA 5TDWA 2NAAA 2YHNA 3SHBA 1V87A 2LXPC 2K17A 2KFTA 2YSJA 5TRBA 3ZPV1 3MHSA 3N9MA 2VPEA 3U5OA 2M6MA 5I3LA 5LKZA 2E6SA 3ZNIA 4CCGX 4A49A 3LQJA 2C2VS 5KH9A 2KGGA 4YBSA 1WEMA 2EGPA 2L43A 2M3HA 2KIZA 2YREA 3U5PA 3O7AA 5B78A 4NN2A 3KNVA 4A4CA 2CSYA 2HYED 2YHOA 3N9PA 3I2DA 5H9MA 2F6JA 4YBTA 2VNFA 2LV9A 4WA6A 1Z6UA 2MIQA 2EA6A 2H0DB 5KH3A 4LKAA 3DPLR 3ZTGA 1U6GB 3GV4A 1MM3A 2RSDA 5D1LB 2KREA 2LN0A 1HYJA 2YUCA 2LGGA 2MNZA 4ZDTA 1G25A 4YBMA 2ECJA 2ZETC 2F42A 2ECVA 2ECTA 2LQ6A 1T1HA 1DVPA 4LADB 3DQVR 2MA6A 4AYCA 4CA1A 2ECNA 2VJEA 3RPGB 2LRIC 1WEVA 5G0FA 4YADA 2M1RA 4GNGA 2LGKA 2FUIA 5EYAF 5FERA 2C2LA 3T7LA 5TBNA 4TKPB 4L58A 3O35A 3ZPVE 4L7XA 2KE1A 3EB6A 4I7DA 5D1MB 2VPBA 2K16A 4WZ2A 2OXQC 3M63A 1N87A 2YU4A 3HCSA 4GNFA 4MSXA 4FK5A 2JMJA 4V3KC 2DX8A 2BAYA 1K2FA 2Y1NA 4FJCA 4AYCB 3HCTA 1HYIA 1WGMA 1Z60A 3LQHA 2G45A 2YURA 2QJ0A 3N9QA 2YSMA 3V43A 1ZBDB 4ZUXU 4GNDA 4B7YC 3O33A 4WZ0A 3C5KA 2QICA 5B75A 4X3GA 1WENA 1XWHA 5LKTA 4GB0A 3ZVYA 2CSZA 2H0DA 5G04B 2VJFB 4V3LC 3SOWA 3HCUA 4UI9B 2KWJA 2LDRA 5LKXA 2L75A 2YQMA 3L11A 3IHPA 2KGIA 5C11A 2JRJA 4S3OC 1X4UA 4QF2A 1WIMA 4B86C 2VPGA 3U5MA 5TABA 3ZYQA 2KYUA 3O70A 2MA5A 3LRQA 2MNYA 4YC9A 3T6RA 2KWKA 2VPDA 2L0BA 2KU3A 5FB1A 1FBVA 4GNEA 2PNXA 4A0CD 2HDPA 3KV5A 4XI1A 5J3XA 3ZVZB 2LXHC 2ECGA 2UZGA 1BORA 2L80A 4AVXA 4BHWA 5G05B 1WEEA 3EB5A 2YW8A 4MVTA 2MD7B 3PHDA 4BBQA 4AUQB 3N9OA 3PURA 3KV6A 4ZQLA 4R7EA 4PTBA 2G43A 4UP5A 3LQIA 4N3WA 3M62A 1WEQA 5AIUA 2FUUA 4LJNA 4F52B 5H1VA 2VP7A 2G6QA 4P5OB 3SOUA 5B76A 1MM2A 5LKUA 4FIPA 4IC2A 4A4BA 2YYRA 4YATA 2KWOA 4FO9A 4IC3A 4YAXA 1RMDA 5DKAA 4R2YA 3QZVA 3HTKC 4R8PK 4LK9A 2LGVA 4N4FA 1WESA 4LLBA 3GL6A 1LDKC 2I50A 3C6WA 1WEWA 1WILA 2VJFA 2JMIA 3FL2A 1E4UA 4Q6FA 4W4UA 2L5UA 1LDJB 3U5NA 4PPEA 3O37A 2KR4A 3M99A 2ECWA 2F6NA
chains in the Genus database with same CATH superfamily
3RTRB 3N9NA 5D1KB 4AP4A 1IYMA 3LVQE 4QF3A 5H1UA 3RPGC 3KQIA 1Z2QA 5JG6A 1VD4A 2CKLB 2IQJA 1X4JA 2K4DA 4WZ3B 2Y43A 2MT5A 2PUYA 5B77A 2MD8C 5B8DA 3LDYA 2CKLA 5C13A 3VK6A 2CT2A 2ECIA 3O34A 5SVIB 2E6RA 5H1TA 3SOXA 1FP0A 1VFYA 1WEPA 2K1JA 1F62A 5TDRA 3FM8C 4C9ZA 1X4IA 4I7BA 1JM7A 3O36A 2D8SA 3PUQA 3NG2A 5KH7A 3DDTA 1CHCA 2M85A 5DINA 3LJUX 1WFKA 1WEOA 3FEHA 5FB0A 5AITA 2RI7A 2XOZA 3MHHA 1VYXA 2YQLA 4S3OB 2YT5A 1JM7B 2QIZA 2AN6A 2VJEB 3ASLA 1JOCA 3L1XA 3N9LA 4UP0A 2Y1MA 4O64A 5SVIA 1WEUA 2FSAA 2IDAA 2LGLA 2EODA 4I7CA 3L1ZB 2XB1A 2JUNA 4YABA 3E2DA 1WE9A 2XEUA 5LCWB 2JMDA 4O62A 2MUMA 5FEYA 2CRRA 5B79A 2KWNA 5TDWA 2NAAA 2YHNA 3SHBA 2KKYA 1V87A 2LXPC 2K17A 2KFTA 2YSJA 1DCQA 5TRBA 3ZPV1 3MHSA 3KDEC 2RR4A 3N9MA 4OGEA 2VPEA 3U5OA 2M6MA 5I3LA 5LKZA 2E6SA 2L7PA 3ZNIA 4CCGX 4A49A 3FAOA 3LQJA 2C2VS 5KH9A 2KGGA 4YBSA 1WEMA 2EGPA 4QQ4A 3FJUB 2L43A 2M3HA 2KIZA 4H9DA 2YREA 3U5PA 3O7AA 5B78A 4NN2A 3KNVA 4A4CA 2CSYA 2HYED 2FD4A 2YHOA 3N9PA 3I2DA 5H9MA 2F6JA 4YBTA 2XP0A 2JM3A 2VNFA 2LV9A 4WA6A 1Z6UA 2MIQA 2EA6A 2H0DB 5KH3A 4LKAA 3DPLR 3ZTGA 1U6GB 3GV4A 1MM3A 2RSDA 5D1LB 2KREA 2LN0A 1HYJA 2YUCA 2LGGA 2XOCA 2MNZA 4ZDTA 1G25A 2M13A 4YBMA 2ECJA 2ZETC 2F42A 5SVXA 2CRWA 2ECVA 2ECTA 2LQ6A 1T1HA 1DVPA 4F1PA 4LADB 3DQVR 2MA6A 4AYCA 4CA1A 2ECNA 2VJEA 3RPGB 2LRIC 1WEVA 5G0FA 4YADA 2M1RA 4GNGA 2LGKA 2FUIA 5EYAF 5FERA 2C2LA 3T7LA 5TBNA 4TKPB 4L58A 3O35A 3ZPVE 4L7XA 2KE1A 3EB6A 4I7DA 5D1MB 2VPBA 2K16A 4WZ2A 2OXQC 3M63A 1N87A 3LVRE 2YU4A 5K3QA 3HCSA 4GNFA 4MSXA 4FK5A 2JMJA 4V3KC 2DX8A 2BAYA 2MKEA 1K2FA 2Y1NA 4FJCA 4AYCB 3HCTA 1HYIA 1WGMA 3O47A 4Z0RA 1Z60A 3LQHA 2G45A 2YURA 2QJ0A 3N9QA 2YSMA 3V43A 1ZBDB 4Z0OA 4ZUXU 4GNDA 4B7YC 3O33A 4WZ0A 3C5KA 2QICA 5B75A 4X3GA 1WENA 1XWHA 5LKTA 4GB0A 3ZVYA 2CSZA 2H0DA 2OWAA 5G04B 3Q1DA 2VJFB 4V3LC 3SOWA 3HCUA 4UI9B 2KWJA 2LDRA 3FANA 5LKXA 2L75A 3M7KA 2YQMA 3L11A 2EXUA 3IHPA 2KGIA 5C11A 2JRJA 4S3OC 1X4UA 4QF2A 2EGMA 1WIMA 4B86C 2VPGA 3U5MA 5TABA 3ZYQA 2KYUA 3O70A 3MDBC 2MA5A 2B0OE 3LRQA 2MNYA 4YC9A 3T6RA 2KWKA 2VPDA 2L0BA 2KU3A 5FB1A 1FBVA 4GNEA 2PNXA 2E61A 4A0CD 2HDPA 2D8UA 3KV5A 4XI1A 5J3XA 3ZVZB 2LAUA 2LXHC 2ECGA 2UZGA 1BORA 2L80A 4AVXA 4BHWA 5G05B 1WEEA 3EB5A 1MBMA 2YW8A 4MVTA 2DSMA 2MD7B 3PHDA 4BBQA 4AUQB 3N9OA 3PURA 3KV6A 4ZQLA 4R7EA 4PTBA 2G43A 3LQIA 4UP5A 4N3WA 3M62A 1WEQA 5AIUA 2FUUA 3SUBA 4LJNA 4F52B 2P57A 2VP7A 2G6QA 5H1VA 3PLWA 4P5OB 5SVYA 3SOUA 5B76A 4OGCA 3T9KA 1MM2A 5LKUA 4FIPA 4IC2A 4A4BA 2YYRA 3DWDA 4YATA 2KWOA 4FO9A 4IC3A 4YAXA 1RMDA 5DKAA 4R2YA 3QZVA 3HTKC 4R8PK 4LK9A 2KKXA 2DJAA 2LGVA 4N4FA 1WESA 4LLBA 3GL6A 1LDKC 2I50A 3JUEA 3H7HA 3C6WA 1WEWA 1WILA 2VJFA 2JMIA 3FL2A 1E4UA 4Q6FA 2CONA 4W4UA 2L5UA 1LDJB 3U5NA 2FFWA 2CSVA 4PPEA 3O37A 2KR4A 3M99A 2ECWA 2YVRA 2F6NA 2XOYA
chains in the Genus database with same CATH topology
3RTRB 3N9NA 5D1KB 4AP4A 1IYMA 4QF3A 5H1UA 3RPGC 3KQIA 1Z2QA 5JG6A 1VD4A 2CKLB 1X4JA 2K4DA 4WZ3B 2Y43A 2MT5A 2PUYA 5B77A 2MD8C 5B8DA 2CKLA 5C13A 3VK6A 2CT2A 2ECIA 3O34A 2E6RA 5H1TA 3SOXA 1FP0A 1VFYA 1WEPA 2K1JA 1F62A 5TDRA 4C9ZA 1X4IA 4I7BA 1JM7A 3O36A 2D8SA 3PUQA 3NG2A 5KH7A 1CHCA 2M85A 5DINA 1WFKA 1WEOA 5FB0A 5AITA 2RI7A 3MHHA 1VYXA 2YQLA 4S3OB 2YT5A 1JM7B 2QIZA 2AN6A 2VJEB 3ASLA 1JOCA 3L1XA 3N9LA 4UP0A 2Y1MA 4O64A 1WEUA 2FSAA 2IDAA 2LGLA 2EODA 4I7CA 3L1ZB 2XB1A 4YABA 1WE9A 2XEUA 5LCWB 2JMDA 2MUMA 5FEYA 5B79A 2KWNA 5TDWA 2NAAA 2YHNA 3SHBA 1V87A 2LXPC 2K17A 2KFTA 2YSJA 5TRBA 3ZPV1 3MHSA 3N9MA 2VPEA 3U5OA 2M6MA 5I3LA 5LKZA 2E6SA 3ZNIA 4CCGX 4A49A 3LQJA 2C2VS 5KH9A 2KGGA 4YBSA 1WEMA 2EGPA 2L43A 2M3HA 2KIZA 2YREA 3U5PA 3O7AA 5B78A 4NN2A 3KNVA 4A4CA 2CSYA 2HYED 2YHOA 3N9PA 3I2DA 5H9MA 2F6JA 4YBTA 2VNFA 2LV9A 4WA6A 1Z6UA 2MIQA 2EA6A 2H0DB 5KH3A 4LKAA 3DPLR 3ZTGA 1U6GB 3GV4A 1MM3A 2RSDA 5D1LB 2KREA 2LN0A 1HYJA 2YUCA 2LGGA 2MNZA 4ZDTA 1G25A 4YBMA 2ECJA 2ZETC 2F42A 2ECVA 2ECTA 2LQ6A 1T1HA 1DVPA 4LADB 3DQVR 2MA6A 4AYCA 4CA1A 2ECNA 2VJEA 3RPGB 2LRIC 1WEVA 5G0FA 4YADA 2M1RA 4GNGA 2LGKA 2FUIA 5EYAF 5FERA 2C2LA 3T7LA 5TBNA 4TKPB 4L58A 3O35A 3ZPVE 4L7XA 2KE1A 3EB6A 4I7DA 5D1MB 2VPBA 2K16A 4WZ2A 2OXQC 3M63A 1N87A 2YU4A 3HCSA 4GNFA 4MSXA 4FK5A 2JMJA 4V3KC 2DX8A 2BAYA 1K2FA 2Y1NA 4FJCA 4AYCB 3HCTA 1HYIA 1WGMA 1Z60A 3LQHA 2G45A 2YURA 2QJ0A 3N9QA 2YSMA 3V43A 1ZBDB 4ZUXU 4GNDA 4B7YC 3O33A 4WZ0A 3C5KA 2QICA 5B75A 4X3GA 1WENA 1XWHA 5LKTA 4GB0A 3ZVYA 2CSZA 2H0DA 5G04B 2VJFB 4V3LC 3SOWA 3HCUA 4UI9B 2KWJA 2LDRA 5LKXA 2L75A 2YQMA 3L11A 3IHPA 2KGIA 5C11A 2JRJA 4S3OC 1X4UA 4QF2A 1WIMA 4B86C 2VPGA 3U5MA 5TABA 3ZYQA 2KYUA 3O70A 2MA5A 3LRQA 2MNYA 4YC9A 3T6RA 2KWKA 2VPDA 2L0BA 2KU3A 5FB1A 1FBVA 4GNEA 2PNXA 4A0CD 2HDPA 3KV5A 4XI1A 5J3XA 3ZVZB 2LXHC 2ECGA 2UZGA 1BORA 2L80A 4AVXA 4BHWA 5G05B 1WEEA 3EB5A 2YW8A 4MVTA 2MD7B 3PHDA 4BBQA 4AUQB 3N9OA 3PURA 3KV6A 4ZQLA 4R7EA 4PTBA 2G43A 4UP5A 3LQIA 4N3WA 3M62A 1WEQA 5AIUA 2FUUA 4LJNA 4F52B 5H1VA 2VP7A 2G6QA 4P5OB 3SOUA 5B76A 1MM2A 5LKUA 4FIPA 4IC2A 4A4BA 2YYRA 4YATA 2KWOA 4FO9A 4IC3A 4YAXA 1RMDA 5DKAA 4R2YA 3QZVA 3HTKC 4R8PK 4LK9A 2LGVA 4N4FA 1WESA 4LLBA 3GL6A 1LDKC 2I50A 3C6WA 1WEWA 1WILA 2VJFA 2JMIA 3FL2A 1E4UA 4Q6FA 4W4UA 2L5UA 1LDJB 3U5NA 4PPEA 3O37A 2KR4A 3M99A 2ECWA 2F6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTR B;  3N9N A;  5D1K B;  4AP4 A;  1IYM A;  4QF3 A;  5H1U A;  3RPG C;  3KQI A;  1Z2Q A;  5JG6 A;  1VD4 A;  2CKL B;  1X4J A;  2K4D A;  4WZ3 B;  2Y43 A;  2MT5 A;  2PUY A;  5B77 A;  2MD8 C;  5B8D A;  2CKL A;  5C13 A;  3VK6 A;  2CT2 A;  2ECI A;  3O34 A;  2E6R A;  5H1T A;  3SOX A;  1FP0 A;  1VFY A;  1WEP A;  2K1J A;  1F62 A;  5TDR A;  4C9Z A;  1X4I A;  4I7B A;  1JM7 A;  3O36 A;  2D8S A;  3PUQ A;  3NG2 A;  5KH7 A;  1CHC A;  2M85 A;  5DIN A;  1WFK A;  1WEO A;  5FB0 A;  5AIT A;  2RI7 A;  3MHH A;  1VYX A;  2YQL A;  4S3O B;  2YT5 A;  1JM7 B;  2QIZ A;  2AN6 A;  2VJE B;  3ASL A;  1JOC A;  3L1X A;  3N9L A;  4UP0 A;  2Y1M A;  4O64 A;  1WEU A;  2FSA A;  2IDA A;  2LGL A;  2EOD A;  4I7C A;  3L1Z B;  2XB1 A;  4YAB A;  1WE9 A;  2XEU A;  5LCW B;  2JMD A;  2MUM A;  5FEY A;  5B79 A;  2KWN A;  5TDW A;  2NAA A;  2YHN A;  3SHB A;  1V87 A;  2LXP C;  2K17 A;  2KFT A;  2YSJ A;  5TRB A;  3ZPV 1;  3MHS A;  3N9M A;  2VPE A;  3U5O A;  2M6M A;  5I3L A;  5LKZ A;  2E6S A;  3ZNI A;  4CCG X;  4A49 A;  3LQJ A;  2C2V S;  5KH9 A;  2KGG A;  4YBS A;  1WEM A;  2EGP A;  2L43 A;  2M3H A;  2KIZ A;  2YRE A;  3U5P A;  3O7A A;  5B78 A;  4NN2 A;  3KNV A;  4A4C A;  2CSY A;  2HYE D;  2YHO A;  3N9P A;  3I2D A;  5H9M A;  2F6J A;  4YBT A;  2VNF A;  2LV9 A;  4WA6 A;  1Z6U A;  2MIQ A;  2EA6 A;  2H0D B;  5KH3 A;  4LKA A;  3DPL R;  3ZTG A;  1U6G B;  3GV4 A;  1MM3 A;  2RSD A;  5D1L B;  2KRE A;  2LN0 A;  1HYJ A;  2YUC A;  2LGG A;  2MNZ A;  4ZDT A;  1G25 A;  4YBM A;  2ECJ A;  2ZET C;  2F42 A;  2ECV A;  2ECT A;  2LQ6 A;  1T1H A;  1DVP A;  4LAD B;  3DQV R;  2MA6 A;  4AYC A;  4CA1 A;  2ECN A;  2VJE A;  3RPG B;  2LRI C;  1WEV A;  5G0F A;  4YAD A;  2M1R A;  4GNG A;  2LGK A;  2FUI A;  5EYA F;  5FER A;  2C2L A;  3T7L A;  5TBN A;  4TKP B;  4L58 A;  3O35 A;  3ZPV E;  4L7X A;  2KE1 A;  3EB6 A;  4I7D A;  5D1M B;  2VPB A;  2K16 A;  4WZ2 A;  2OXQ C;  3M63 A;  1N87 A;  2YU4 A;  3HCS A;  4GNF A;  4MSX A;  4FK5 A;  2JMJ A;  4V3K C;  2DX8 A;  2BAY A;  1K2F A;  2Y1N A;  4FJC A;  4AYC B;  3HCT A;  1HYI A;  1WGM A;  1Z60 A;  3LQH A;  2G45 A;  2YUR A;  2QJ0 A;  3N9Q A;  2YSM A;  3V43 A;  1ZBD B;  4ZUX U;  4GND A;  4B7Y C;  3O33 A;  4WZ0 A;  3C5K A;  2QIC A;  5B75 A;  4X3G A;  1WEN A;  1XWH A;  5LKT A;  4GB0 A;  3ZVY A;  2CSZ A;  2H0D A;  5G04 B;  2VJF B;  4V3L C;  3SOW A;  3HCU A;  4UI9 B;  2KWJ A;  2LDR A;  5LKX A;  2L75 A;  2YQM A;  3L11 A;  3IHP A;  2KGI A;  5C11 A;  2JRJ A;  4S3O C;  1X4U A;  4QF2 A;  1WIM A;  4B86 C;  2VPG A;  3U5M A;  5TAB A;  3ZYQ A;  2KYU A;  3O70 A;  2MA5 A;  3LRQ A;  2MNY A;  4YC9 A;  3T6R A;  2KWK A;  2VPD A;  2L0B A;  2KU3 A;  5FB1 A;  1FBV A;  4GNE A;  2PNX A;  4A0C D;  2HDP A;  3KV5 A;  4XI1 A;  5J3X A;  3ZVZ B;  2LXH C;  2ECG A;  2UZG A;  1BOR A;  2L80 A;  4AVX A;  4BHW A;  5G05 B;  1WEE A;  3EB5 A;  2YW8 A;  4MVT A;  2MD7 B;  3PHD A;  4BBQ A;  4AUQ B;  3N9O A;  3PUR A;  3KV6 A;  4ZQL A;  4R7E A;  4PTB A;  2G43 A;  4UP5 A;  3LQI A;  4N3W A;  3M62 A;  1WEQ A;  5AIU A;  2FUU A;  4LJN A;  4F52 B;  5H1V A;  2VP7 A;  2G6Q A;  4P5O B;  3SOU A;  5B76 A;  1MM2 A;  5LKU A;  4FIP A;  4IC2 A;  4A4B A;  2YYR A;  4YAT A;  2KWO A;  4FO9 A;  4IC3 A;  4YAX A;  1RMD A;  5DKA A;  4R2Y A;  3QZV A;  3HTK C;  4R8P K;  4LK9 A;  2LGV A;  4N4F A;  1WES A;  4LLB A;  3GL6 A;  1LDK C;  2I50 A;  3C6W A;  1WEW A;  1WIL A;  2VJF A;  2JMI A;  3FL2 A;  1E4U A;  4Q6F A;  4W4U A;  2L5U A;  1LDJ B;  3U5N A;  4PPE A;  3O37 A;  2KR4 A;  3M99 A;  2ECW A;  2F6N A; 
#chains in the Genus database with same CATH topology
 3RTR B;  3N9N A;  5D1K B;  4AP4 A;  1IYM A;  3LVQ E;  4QF3 A;  5H1U A;  3RPG C;  3KQI A;  1Z2Q A;  5JG6 A;  1VD4 A;  2CKL B;  2IQJ A;  1X4J A;  2K4D A;  4WZ3 B;  2Y43 A;  2MT5 A;  2PUY A;  5B77 A;  2MD8 C;  5B8D A;  3LDY A;  2CKL A;  5C13 A;  3VK6 A;  2CT2 A;  2ECI A;  3O34 A;  5SVI B;  2E6R A;  5H1T A;  3SOX A;  1FP0 A;  1VFY A;  1WEP A;  2K1J A;  1F62 A;  5TDR A;  3FM8 C;  4C9Z A;  1X4I A;  4I7B A;  1JM7 A;  3O36 A;  2D8S A;  3PUQ A;  3NG2 A;  5KH7 A;  3DDT A;  1CHC A;  2M85 A;  5DIN A;  3LJU X;  1WFK A;  1WEO A;  3FEH A;  5FB0 A;  5AIT A;  2RI7 A;  2XOZ A;  3MHH A;  1VYX A;  2YQL A;  4S3O B;  2YT5 A;  1JM7 B;  2QIZ A;  2AN6 A;  2VJE B;  3ASL A;  1JOC A;  3L1X A;  3N9L A;  4UP0 A;  2Y1M A;  4O64 A;  5SVI A;  1WEU A;  2FSA A;  2IDA A;  2LGL A;  2EOD A;  4I7C A;  3L1Z B;  2XB1 A;  2JUN A;  4YAB A;  3E2D A;  1WE9 A;  2XEU A;  5LCW B;  2JMD A;  4O62 A;  2MUM A;  5FEY A;  2CRR A;  5B79 A;  2KWN A;  5TDW A;  2NAA A;  2YHN A;  3SHB A;  2KKY A;  1V87 A;  2LXP C;  2K17 A;  2KFT A;  2YSJ A;  1DCQ A;  5TRB A;  3ZPV 1;  3MHS A;  3KDE C;  2RR4 A;  3N9M A;  4OGE A;  2VPE A;  3U5O A;  2M6M A;  5I3L A;  5LKZ A;  2E6S A;  2L7P A;  3ZNI A;  4CCG X;  4A49 A;  3FAO A;  3LQJ A;  2C2V S;  5KH9 A;  2KGG A;  4YBS A;  1WEM A;  2EGP A;  4QQ4 A;  3FJU B;  2L43 A;  2M3H A;  2KIZ A;  4H9D A;  2YRE A;  3U5P A;  3O7A A;  5B78 A;  4NN2 A;  3KNV A;  4A4C A;  2CSY A;  2HYE D;  2FD4 A;  2YHO A;  3N9P A;  3I2D A;  5H9M A;  2F6J A;  4YBT A;  2XP0 A;  2JM3 A;  2VNF A;  2LV9 A;  4WA6 A;  1Z6U A;  2MIQ A;  2EA6 A;  2H0D B;  5KH3 A;  4LKA A;  3DPL R;  3ZTG A;  1U6G B;  3GV4 A;  1MM3 A;  2RSD A;  5D1L B;  2KRE A;  2LN0 A;  1HYJ A;  2YUC A;  2LGG A;  2XOC A;  2MNZ A;  4ZDT A;  1G25 A;  2M13 A;  4YBM A;  2ECJ A;  2ZET C;  2F42 A;  5SVX A;  2CRW A;  2ECV A;  2ECT A;  2LQ6 A;  1T1H A;  1DVP A;  4F1P A;  4LAD B;  3DQV R;  2MA6 A;  4AYC A;  4CA1 A;  2ECN A;  2VJE A;  3RPG B;  2LRI C;  1WEV A;  5G0F A;  4YAD A;  2M1R A;  4GNG A;  2LGK A;  2FUI A;  5EYA F;  5FER A;  2C2L A;  3T7L A;  5TBN A;  4TKP B;  4L58 A;  3O35 A;  3ZPV E;  4L7X A;  2KE1 A;  3EB6 A;  4I7D A;  5D1M B;  2VPB A;  2K16 A;  4WZ2 A;  2OXQ C;  3M63 A;  1N87 A;  3LVR E;  2YU4 A;  5K3Q A;  3HCS A;  4GNF A;  4MSX A;  4FK5 A;  2JMJ A;  4V3K C;  2DX8 A;  2BAY A;  2MKE A;  1K2F A;  2Y1N A;  4FJC A;  4AYC B;  3HCT A;  1HYI A;  1WGM A;  3O47 A;  4Z0R A;  1Z60 A;  3LQH A;  2G45 A;  2YUR A;  2QJ0 A;  3N9Q A;  2YSM A;  3V43 A;  1ZBD B;  4Z0O A;  4ZUX U;  4GND A;  4B7Y C;  3O33 A;  4WZ0 A;  3C5K A;  2QIC A;  5B75 A;  4X3G A;  1WEN A;  1XWH A;  5LKT A;  4GB0 A;  3ZVY A;  2CSZ A;  2H0D A;  2OWA A;  5G04 B;  3Q1D A;  2VJF B;  4V3L C;  3SOW A;  3HCU A;  4UI9 B;  2KWJ A;  2LDR A;  3FAN A;  5LKX A;  2L75 A;  3M7K A;  2YQM A;  3L11 A;  2EXU A;  3IHP A;  2KGI A;  5C11 A;  2JRJ A;  4S3O C;  1X4U A;  4QF2 A;  2EGM A;  1WIM A;  4B86 C;  2VPG A;  3U5M A;  5TAB A;  3ZYQ A;  2KYU A;  3O70 A;  3MDB C;  2MA5 A;  2B0O E;  3LRQ A;  2MNY A;  4YC9 A;  3T6R A;  2KWK A;  2VPD A;  2L0B A;  2KU3 A;  5FB1 A;  1FBV A;  4GNE A;  2PNX A;  2E61 A;  4A0C D;  2HDP A;  2D8U A;  3KV5 A;  4XI1 A;  5J3X A;  3ZVZ B;  2LAU A;  2LXH C;  2ECG A;  2UZG A;  1BOR A;  2L80 A;  4AVX A;  4BHW A;  5G05 B;  1WEE A;  3EB5 A;  1MBM A;  2YW8 A;  4MVT A;  2DSM A;  2MD7 B;  3PHD A;  4BBQ A;  4AUQ B;  3N9O A;  3PUR A;  3KV6 A;  4ZQL A;  4R7E A;  4PTB A;  2G43 A;  3LQI A;  4UP5 A;  4N3W A;  3M62 A;  1WEQ A;  5AIU A;  2FUU A;  3SUB A;  4LJN A;  4F52 B;  2P57 A;  2VP7 A;  2G6Q A;  5H1V A;  3PLW A;  4P5O B;  5SVY A;  3SOU A;  5B76 A;  4OGC A;  3T9K A;  1MM2 A;  5LKU A;  4FIP A;  4IC2 A;  4A4B A;  2YYR A;  3DWD A;  4YAT A;  2KWO A;  4FO9 A;  4IC3 A;  4YAX A;  1RMD A;  5DKA A;  4R2Y A;  3QZV A;  3HTK C;  4R8P K;  4LK9 A;  2KKX A;  2DJA A;  2LGV A;  4N4F A;  1WES A;  4LLB A;  3GL6 A;  1LDK C;  2I50 A;  3JUE A;  3H7H A;  3C6W A;  1WEW A;  1WIL A;  2VJF A;  2JMI A;  3FL2 A;  1E4U A;  4Q6F A;  2CON A;  4W4U A;  2L5U A;  1LDJ B;  3U5N A;  2FFW A;  2CSV A;  4PPE A;  3O37 A;  2KR4 A;  3M99 A;  2ECW A;  2YVR A;  2F6N A;  2XOY A; 
#chains in the Genus database with same CATH homology
 3RTR B;  3N9N A;  5D1K B;  4AP4 A;  1IYM A;  4QF3 A;  5H1U A;  3RPG C;  3KQI A;  1Z2Q A;  5JG6 A;  1VD4 A;  2CKL B;  1X4J A;  2K4D A;  4WZ3 B;  2Y43 A;  2MT5 A;  2PUY A;  5B77 A;  2MD8 C;  5B8D A;  2CKL A;  5C13 A;  3VK6 A;  2CT2 A;  2ECI A;  3O34 A;  2E6R A;  5H1T A;  3SOX A;  1FP0 A;  1VFY A;  1WEP A;  2K1J A;  1F62 A;  5TDR A;  4C9Z A;  1X4I A;  4I7B A;  1JM7 A;  3O36 A;  2D8S A;  3PUQ A;  3NG2 A;  5KH7 A;  1CHC A;  2M85 A;  5DIN A;  1WFK A;  1WEO A;  5FB0 A;  5AIT A;  2RI7 A;  3MHH A;  1VYX A;  2YQL A;  4S3O B;  2YT5 A;  1JM7 B;  2QIZ A;  2AN6 A;  2VJE B;  3ASL A;  1JOC A;  3L1X A;  3N9L A;  4UP0 A;  2Y1M A;  4O64 A;  1WEU A;  2FSA A;  2IDA A;  2LGL A;  2EOD A;  4I7C A;  3L1Z B;  2XB1 A;  4YAB A;  1WE9 A;  2XEU A;  5LCW B;  2JMD A;  2MUM A;  5FEY A;  5B79 A;  2KWN A;  5TDW A;  2NAA A;  2YHN A;  3SHB A;  1V87 A;  2LXP C;  2K17 A;  2KFT A;  2YSJ A;  5TRB A;  3ZPV 1;  3MHS A;  3N9M A;  2VPE A;  3U5O A;  2M6M A;  5I3L A;  5LKZ A;  2E6S A;  3ZNI A;  4CCG X;  4A49 A;  3LQJ A;  2C2V S;  5KH9 A;  2KGG A;  4YBS A;  1WEM A;  2EGP A;  2L43 A;  2M3H A;  2KIZ A;  2YRE A;  3U5P A;  3O7A A;  5B78 A;  4NN2 A;  3KNV A;  4A4C A;  2CSY A;  2HYE D;  2YHO A;  3N9P A;  3I2D A;  5H9M A;  2F6J A;  4YBT A;  2VNF A;  2LV9 A;  4WA6 A;  1Z6U A;  2MIQ A;  2EA6 A;  2H0D B;  5KH3 A;  4LKA A;  3DPL R;  3ZTG A;  1U6G B;  3GV4 A;  1MM3 A;  2RSD A;  5D1L B;  2KRE A;  2LN0 A;  1HYJ A;  2YUC A;  2LGG A;  2MNZ A;  4ZDT A;  1G25 A;  4YBM A;  2ECJ A;  2ZET C;  2F42 A;  2ECV A;  2ECT A;  2LQ6 A;  1T1H A;  1DVP A;  4LAD B;  3DQV R;  2MA6 A;  4AYC A;  4CA1 A;  2ECN A;  2VJE A;  3RPG B;  2LRI C;  1WEV A;  5G0F A;  4YAD A;  2M1R A;  4GNG A;  2LGK A;  2FUI A;  5EYA F;  5FER A;  2C2L A;  3T7L A;  5TBN A;  4TKP B;  4L58 A;  3O35 A;  3ZPV E;  4L7X A;  2KE1 A;  3EB6 A;  4I7D A;  5D1M B;  2VPB A;  2K16 A;  4WZ2 A;  2OXQ C;  3M63 A;  1N87 A;  2YU4 A;  3HCS A;  4GNF A;  4MSX A;  4FK5 A;  2JMJ A;  4V3K C;  2DX8 A;  2BAY A;  1K2F A;  2Y1N A;  4FJC A;  4AYC B;  3HCT A;  1HYI A;  1WGM A;  1Z60 A;  3LQH A;  2G45 A;  2YUR A;  2QJ0 A;  3N9Q A;  2YSM A;  3V43 A;  1ZBD B;  4ZUX U;  4GND A;  4B7Y C;  3O33 A;  4WZ0 A;  3C5K A;  2QIC A;  5B75 A;  4X3G A;  1WEN A;  1XWH A;  5LKT A;  4GB0 A;  3ZVY A;  2CSZ A;  2H0D A;  5G04 B;  2VJF B;  4V3L C;  3SOW A;  3HCU A;  4UI9 B;  2KWJ A;  2LDR A;  5LKX A;  2L75 A;  2YQM A;  3L11 A;  3IHP A;  2KGI A;  5C11 A;  2JRJ A;  4S3O C;  1X4U A;  4QF2 A;  1WIM A;  4B86 C;  2VPG A;  3U5M A;  5TAB A;  3ZYQ A;  2KYU A;  3O70 A;  2MA5 A;  3LRQ A;  2MNY A;  4YC9 A;  3T6R A;  2KWK A;  2VPD A;  2L0B A;  2KU3 A;  5FB1 A;  1FBV A;  4GNE A;  2PNX A;  4A0C D;  2HDP A;  3KV5 A;  4XI1 A;  5J3X A;  3ZVZ B;  2LXH C;  2ECG A;  2UZG A;  1BOR A;  2L80 A;  4AVX A;  4BHW A;  5G05 B;  1WEE A;  3EB5 A;  2YW8 A;  4MVT A;  2MD7 B;  3PHD A;  4BBQ A;  4AUQ B;  3N9O A;  3PUR A;  3KV6 A;  4ZQL A;  4R7E A;  4PTB A;  2G43 A;  4UP5 A;  3LQI A;  4N3W A;  3M62 A;  1WEQ A;  5AIU A;  2FUU A;  4LJN A;  4F52 B;  5H1V A;  2VP7 A;  2G6Q A;  4P5O B;  3SOU A;  5B76 A;  1MM2 A;  5LKU A;  4FIP A;  4IC2 A;  4A4B A;  2YYR A;  4YAT A;  2KWO A;  4FO9 A;  4IC3 A;  4YAX A;  1RMD A;  5DKA A;  4R2Y A;  3QZV A;  3HTK C;  4R8P K;  4LK9 A;  2LGV A;  4N4F A;  1WES A;  4LLB A;  3GL6 A;  1LDK C;  2I50 A;  3C6W A;  1WEW A;  1WIL A;  2VJF A;  2JMI A;  3FL2 A;  1E4U A;  4Q6F A;  4W4U A;  2L5U A;  1LDJ B;  3U5N A;  4PPE A;  3O37 A;  2KR4 A;  3M99 A;  2ECW A;  2F6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...