2E61A

Solution structure of the zf-cw domain in zinc finger cw-type pwwp domain protein 1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
GSSGSSGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger CW-type PWWP domain protein 1
publication title Structural insight into the zinc finger CW domain as a histone modification reader
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2e61A00
2L7PA 5SVIB 5SVIA 5SVXA 4QQ4A 4Z0OA 2E61A 4O62A 5SVYA 4Z0RA 2RR4A
chains in the Genus database with same CATH superfamily
2EA6A 2IDAA 4WA6A 5LCWB 4L7XA 5FERA 4FIPA 4AYCA 5SVXA 4Z0OA 2M13A 4AP4A 4AYCB 2PNXA 2M85A 3HCUA 1WESA 3FJUB 3RTRB 3LJUX 5H1UA 1V87A 5FB0A 4YAXA 3FANA 1U6GB 3O47A 4BHWA 2ECTA 1FBVA 2VJEA 2KGGA 2LGVA 2CONA 2VJEB 5AIUA 5B78A 3MHHA 2MA5A 2FUUA 3L1ZB 3E2DA 3L1XA 2PUYA 4LADB 4LLBA 3N9QA 2CSVA 4YADA 5G04B 1LDKC 2ECNA 2VPEA 2H0DA 2CSYA 2RR4A 2H0DB 2G6QA 5D1MB 5K3QA 2L0BA 2LGLA 5B76A 2VNFA 3KV6A 5LKUA 3FM8C 4YABA 2YREA 2MD7B 5LKZA 4GNEA 5H1TA 3FAOA 3SOWA 2JM3A 4QF2A 1MM2A 2KE1A 3U5OA 4A4CA 2YW8A 2E6SA 4O64A 2DJAA 2EXUA 4A4BA 2CRWA 4MVTA 2XEUA 1G25A 1K2FA 3DQVR 4B7YC 3C6WA 4UI9B 3VK6A 4LKAA 4MSXA 4WZ0A 5TRBA 2CRRA 5G0FA 2YHOA 2K1JA 3LRQA 2LV9A 4H9DA 3KNVA 3M63A 3MDBC 3DPLR 5TBNA 3T9KA 4UP5A 3HCTA 5C11A 5AITA 1WGMA 2L43A 3L11A 5LKXA 2RI7A 3U5MA 4OGEA 3FEHA 2ECWA 2LGKA 2XOYA 4XI1A 3N9MA 2D8UA 4AVXA 2E61A 4AUQB 4Z0RA 2LXPC 1WEMA 3HCSA 3ZVZB 3V43A 3PUQA 2LN0A 4GNGA 2VP7A 1WE9A 3ZPV1 2LQ6A 2JMIA 2VPBA 4LK9A 2LRIC 1BORA 4I7BA 5H1VA 2KKXA 3LQIA 2KWOA 2K16A 1DVPA 4C9ZA 2YUCA 4V3LC 4FK5A 1WILA 3U5NA 2MKEA 4B86C 1IYMA 1VFYA 5H9MA 2EGMA 3NG2A 2K4DA 4YC9A 2VJFA 4X3GA 3PURA 2VJFB 2YSMA 4LJNA 2NAAA 2DX8A 4N4FA 2Y43A 2YQLA 1WEQA 2K17A 2B0OE 3ZYQA 3N9OA 2F42A 4R8PK 4YBTA 1X4IA 2YYRA 1CHCA 2MNYA 2G45A 2OXQC 4GNFA 1WENA 2IQJA 2MD8C 2VPDA 5LKTA 1WEEA 2HDPA 2YSJA 2FUIA 4L58A 4I7CA 3IHPA 3I2DA 2F6JA 2KWNA 3KDEC 4NN2A 4WZ2A 3ASLA 1DCQA 3JUEA 3U5PA 1HYJA 2L80A 5TABA 3O70A 4ZDTA 2ECJA 2G43A 3EB6A 2KIZA 2LXHC 3H7HA 4YATA 2L7PA 2MT5A 1VD4A 2KYUA 2YVRA 3ZVYA 3MHSA 4YBSA 2Y1MA 1JOCA 2C2LA 2KR4A 4FJCA 5C13A 2LAUA 1N87A 3Q1DA 2MA6A 3LQHA 3LVRE 1WEUA 1Z2QA 3GV4A 5B79A 5SVIA 1LDJB 3O36A 1MM3A 5SVIB 2KKYA 2M6MA 3SUBA 2XOZA 3HTKC 3O35A 1WIMA 4I7DA 3C5KA 4GB0A 3SOXA 4P5OB 4S3OB 5J3XA 3RPGC 3N9PA 5KH3A 1WFKA 2JMDA 4V3KC 3GL6A 3ZTGA 2LGGA 1E4UA 2YU4A 2KWKA 1XWHA 4QF3A 2Y1NA 2F6NA 2YHNA 1HYIA 4ZUXU 5D1LB 2AN6A 2ECVA 3LVQE 3RPGB 2QJ0A 5KH9A 3O7AA 4YBMA 4F1PA 5B8DA 2KWJA 2ECGA 4OGCA 2CSZA 1FP0A 3QZVA 2FD4A 3KV5A 2XOCA 2I50A 2YURA 3LDYA 3M7KA 4R7EA 3T6RA 1MBMA 3EB5A 5JG6A 1WEPA 2D8SA 2KREA 2L75A 4IC2A 5G05B 2HYED 2KGIA 2EODA 4W4UA 4A0CD 5DKAA 1Z60A 2YQMA 4UP0A 2FSAA 3N9LA 1T1HA 2JMJA 3FL2A 4BBQA 4F52B 2XP0A 2C2VS 5FB1A 4GNDA 2JRJA 4QQ4A 2FFWA 4S3OC 3O33A 5EYAF 5FEYA 1WEOA 1X4UA 4IC3A 2MIQA 5D1KB 1WEWA 2M3HA 3PLWA 4TKPB 1JM7A 1JM7B 1ZBDB 2OWAA 5DINA 1F62A 4CA1A 3KQIA 4WZ3B 2VPGA 2UZGA 1RMDA 4FO9A 3PHDA 4ZQLA 2CT2A 2CKLA 2XB1A 2CKLB 1VYXA 5B75A 4PTBA 3O37A 3SOUA 2DSMA 3T7LA 3M62A 2YT5A 5TDRA 5KH7A 2QICA 3SHBA 4Q6FA 5I3LA 2EGPA 2MUMA 1X4JA 2QIZA 3LQJA 4O62A 2ZETC 2P57A 3ZPVE 4N3WA 2E6RA 1Z6UA 4CCGX 2MNZA 5B77A 2JUNA 2L5UA 2LDRA 3N9NA 4R2YA 3DWDA 5SVYA 4A49A 2RSDA 2M1RA 2ECIA 3ZNIA 1WEVA 2KFTA 5TDWA 4PPEA 2BAYA 3DDTA 3M99A 3O34A 2KU3A
chains in the Genus database with same CATH topology
2P57A 2EGMA 2IQJA 4QQ4A 3LVRE 3FM8C 4OGEA 2YREA 3FEHA 4F1PA 5SVIA 2FFWA 2CRRA 2KKXA 3E2DA 2XOYA 2JUNA 5SVIB 2KKYA 3SUBA 2XOZA 4OGCA 2D8UA 5SVXA 4Z0OA 3H7HA 2E61A 2M13A 3DWDA 5SVYA 4H9DA 4Z0RA 2B0OE 2L7PA 2JM3A 2FD4A 3PLWA 2CSVA 2YVRA 2XOCA 3FJUB 3KDEC 3LDYA 3M7KA 3MDBC 2OWAA 2RR4A 3LJUX 2XP0A 2DJAA 2EXUA 3O47A 1DCQA 2LAUA 2MKEA 3JUEA 3T9KA 3Q1DA 4O62A 3LVQE 5K3QA 3DDTA 2CRWA 2CONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7P A;  5SVI B;  5SVI A;  5SVX A;  4QQ4 A;  4Z0O A;  2E61 A;  4O62 A;  5SVY A;  4Z0R A;  2RR4 A; 
#chains in the Genus database with same CATH topology
 2EA6 A;  2IDA A;  4WA6 A;  5LCW B;  4L7X A;  5FER A;  4FIP A;  4AYC A;  5SVX A;  4Z0O A;  2M13 A;  4AP4 A;  4AYC B;  2PNX A;  2M85 A;  3HCU A;  1WES A;  3FJU B;  3RTR B;  3LJU X;  5H1U A;  1V87 A;  5FB0 A;  4YAX A;  3FAN A;  1U6G B;  3O47 A;  4BHW A;  2ECT A;  1FBV A;  2VJE A;  2KGG A;  2LGV A;  2CON A;  2VJE B;  5AIU A;  5B78 A;  3MHH A;  2MA5 A;  2FUU A;  3L1Z B;  3E2D A;  3L1X A;  2PUY A;  4LAD B;  4LLB A;  3N9Q A;  2CSV A;  4YAD A;  5G04 B;  1LDK C;  2ECN A;  2VPE A;  2H0D A;  2CSY A;  2RR4 A;  2H0D B;  2G6Q A;  5D1M B;  5K3Q A;  2L0B A;  2LGL A;  5B76 A;  2VNF A;  3KV6 A;  5LKU A;  3FM8 C;  4YAB A;  2YRE A;  2MD7 B;  5LKZ A;  4GNE A;  5H1T A;  3FAO A;  3SOW A;  2JM3 A;  4QF2 A;  1MM2 A;  2KE1 A;  3U5O A;  4A4C A;  2YW8 A;  2E6S A;  4O64 A;  2DJA A;  2EXU A;  4A4B A;  2CRW A;  4MVT A;  2XEU A;  1G25 A;  1K2F A;  3DQV R;  4B7Y C;  3C6W A;  4UI9 B;  3VK6 A;  4LKA A;  4MSX A;  4WZ0 A;  5TRB A;  2CRR A;  5G0F A;  2YHO A;  2K1J A;  3LRQ A;  2LV9 A;  4H9D A;  3KNV A;  3M63 A;  3MDB C;  3DPL R;  5TBN A;  3T9K A;  4UP5 A;  3HCT A;  5C11 A;  5AIT A;  1WGM A;  2L43 A;  3L11 A;  5LKX A;  2RI7 A;  3U5M A;  4OGE A;  3FEH A;  2ECW A;  2LGK A;  2XOY A;  4XI1 A;  3N9M A;  2D8U A;  4AVX A;  2E61 A;  4AUQ B;  4Z0R A;  2LXP C;  1WEM A;  3HCS A;  3ZVZ B;  3V43 A;  3PUQ A;  2LN0 A;  4GNG A;  2VP7 A;  1WE9 A;  3ZPV 1;  2LQ6 A;  2JMI A;  2VPB A;  4LK9 A;  2LRI C;  1BOR A;  4I7B A;  5H1V A;  2KKX A;  3LQI A;  2KWO A;  2K16 A;  1DVP A;  4C9Z A;  2YUC A;  4V3L C;  4FK5 A;  1WIL A;  3U5N A;  2MKE A;  4B86 C;  1IYM A;  1VFY A;  5H9M A;  2EGM A;  3NG2 A;  2K4D A;  4YC9 A;  2VJF A;  4X3G A;  3PUR A;  2VJF B;  2YSM A;  4LJN A;  2NAA A;  2DX8 A;  4N4F A;  2Y43 A;  2YQL A;  1WEQ A;  2K17 A;  2B0O E;  3ZYQ A;  3N9O A;  2F42 A;  4R8P K;  4YBT A;  1X4I A;  2YYR A;  1CHC A;  2MNY A;  2G45 A;  2OXQ C;  4GNF A;  1WEN A;  2IQJ A;  2MD8 C;  2VPD A;  5LKT A;  1WEE A;  2HDP A;  2YSJ A;  2FUI A;  4L58 A;  4I7C A;  3IHP A;  3I2D A;  2F6J A;  2KWN A;  3KDE C;  4NN2 A;  4WZ2 A;  3ASL A;  1DCQ A;  3JUE A;  3U5P A;  1HYJ A;  2L80 A;  5TAB A;  3O70 A;  4ZDT A;  2ECJ A;  2G43 A;  3EB6 A;  2KIZ A;  2LXH C;  3H7H A;  4YAT A;  2L7P A;  2MT5 A;  1VD4 A;  2KYU A;  2YVR A;  3ZVY A;  3MHS A;  4YBS A;  2Y1M A;  1JOC A;  2C2L A;  2KR4 A;  4FJC A;  5C13 A;  2LAU A;  1N87 A;  3Q1D A;  2MA6 A;  3LQH A;  3LVR E;  1WEU A;  1Z2Q A;  3GV4 A;  5B79 A;  5SVI A;  1LDJ B;  3O36 A;  1MM3 A;  5SVI B;  2KKY A;  2M6M A;  3SUB A;  2XOZ A;  3HTK C;  3O35 A;  1WIM A;  4I7D A;  3C5K A;  4GB0 A;  3SOX A;  4P5O B;  4S3O B;  5J3X A;  3RPG C;  3N9P A;  5KH3 A;  1WFK A;  2JMD A;  4V3K C;  3GL6 A;  3ZTG A;  2LGG A;  1E4U A;  2YU4 A;  2KWK A;  1XWH A;  4QF3 A;  2Y1N A;  2F6N A;  2YHN A;  1HYI A;  4ZUX U;  5D1L B;  2AN6 A;  2ECV A;  3LVQ E;  3RPG B;  2QJ0 A;  5KH9 A;  3O7A A;  4YBM A;  4F1P A;  5B8D A;  2KWJ A;  2ECG A;  4OGC A;  2CSZ A;  1FP0 A;  3QZV A;  2FD4 A;  3KV5 A;  2XOC A;  2I50 A;  2YUR A;  3LDY A;  3M7K A;  4R7E A;  3T6R A;  1MBM A;  3EB5 A;  5JG6 A;  1WEP A;  2D8S A;  2KRE A;  2L75 A;  4IC2 A;  5G05 B;  2HYE D;  2KGI A;  2EOD A;  4W4U A;  4A0C D;  5DKA A;  1Z60 A;  2YQM A;  4UP0 A;  2FSA A;  3N9L A;  1T1H A;  2JMJ A;  3FL2 A;  4BBQ A;  4F52 B;  2XP0 A;  2C2V S;  5FB1 A;  4GND A;  2JRJ A;  4QQ4 A;  2FFW A;  4S3O C;  3O33 A;  5EYA F;  5FEY A;  1WEO A;  1X4U A;  4IC3 A;  2MIQ A;  5D1K B;  1WEW A;  2M3H A;  3PLW A;  4TKP B;  1JM7 A;  1JM7 B;  1ZBD B;  2OWA A;  5DIN A;  1F62 A;  4CA1 A;  3KQI A;  4WZ3 B;  2VPG A;  2UZG A;  1RMD A;  4FO9 A;  3PHD A;  4ZQL A;  2CT2 A;  2CKL A;  2XB1 A;  2CKL B;  1VYX A;  5B75 A;  4PTB A;  3O37 A;  3SOU A;  2DSM A;  3T7L A;  3M62 A;  2YT5 A;  5TDR A;  5KH7 A;  2QIC A;  3SHB A;  4Q6F A;  5I3L A;  2EGP A;  2MUM A;  1X4J A;  2QIZ A;  3LQJ A;  4O62 A;  2ZET C;  2P57 A;  3ZPV E;  4N3W A;  2E6R A;  1Z6U A;  4CCG X;  2MNZ A;  5B77 A;  2JUN A;  2L5U A;  2LDR A;  3N9N A;  4R2Y A;  3DWD A;  5SVY A;  4A49 A;  2RSD A;  2M1R A;  2ECI A;  3ZNI A;  1WEV A;  2KFT A;  5TDW A;  4PPE A;  2BAY A;  3DDT A;  3M99 A;  3O34 A;  2KU3 A; 
#chains in the Genus database with same CATH homology
 2P57 A;  2EGM A;  2IQJ A;  4QQ4 A;  3LVR E;  3FM8 C;  4OGE A;  2YRE A;  3FEH A;  4F1P A;  5SVI A;  2FFW A;  2CRR A;  2KKX A;  3E2D A;  2XOY A;  2JUN A;  5SVI B;  2KKY A;  3SUB A;  2XOZ A;  4OGC A;  2D8U A;  5SVX A;  4Z0O A;  3H7H A;  2E61 A;  2M13 A;  3DWD A;  5SVY A;  4H9D A;  4Z0R A;  2B0O E;  2L7P A;  2JM3 A;  2FD4 A;  3PLW A;  2CSV A;  2YVR A;  2XOC A;  3FJU B;  3KDE C;  3LDY A;  3M7K A;  3MDB C;  2OWA A;  2RR4 A;  3LJU X;  2XP0 A;  2DJA A;  2EXU A;  3O47 A;  1DCQ A;  2LAU A;  2MKE A;  3JUE A;  3T9K A;  3Q1D A;  4O62 A;  3LVQ E;  5K3Q A;  3DDT A;  2CRW A;  2CON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...