2E61A

Solution structure of the zf-cw domain in zinc finger cw-type pwwp domain protein 1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
GSSGSSGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the zinc finger CW domain as a histone modification reader
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Zinc finger CW-type PWWP domain protein 1
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2e61A00
2E61A 4QQ4A 5SVIB 2RR4A 5SVIA 5SVYA 4O62A 5SVXA 4Z0RA 2L7PA 4Z0OA
chains in the Genus database with same CATH superfamily
2CSVA 3N9NA 5AIUA 1HYIA 4MVTA 5SVYA 3ZPV1 2OXQC 2LGLA 2EODA 4V3KC 5TABA 1Z6UA 5SVIA 2K16A 2CSYA 3O36A 2EXUA 4S3OB 4PPEA 2ECJA 2VPEA 3LDYA 3O7AA 2EGMA 1XWHA 2Y1NA 3M63A 3FM8C 5B78A 2VJEA 2FUIA 2L7PA 3O37A 4YAXA 4ZDTA 3FJUB 4FJCA 4ZUXU 3ZVZB 4L7XA 2MT5A 4XI1A 2P57A 4NN2A 2PNXA 4H9DA 2YQLA 2UZGA 2YU4A 5KH3A 4LLBA 2M1RA 2MA6A 5G0FA 4B86C 4LK9A 2PUYA 4N4FA 2MD7B 2MD8C 1VYXA 4I7CA 4WZ2A 4Z0OA 4YBSA 2FD4A 4LJNA 3N9LA 2YHOA 3U5OA 1X4UA 5DINA 3RPGC 1WEQA 4X3GA 2YT5A 4YATA 4BBQA 5LCWB 5G04B 2YUCA 5FB0A 2VPDA 5I3LA 3DQVR 4AYCB 4F52B 4YBTA 1WEOA 2ECGA 2LGVA 2XEUA 2YREA 5FB1A 4W4UA 1WEEA 2HDPA 2KGIA 2EA6A 2F42A 2IDAA 2CONA 4O62A 2JMIA 4AVXA 1WIMA 4Q6FA 3MDBC 2KKYA 4WZ3B 3KV5A 4R8PK 3KNVA 2OWAA 3LQIA 3RPGB 5TDRA 3VK6A 1MM2A 4GNFA 2JMDA 2MA5A 3LJUX 1JM7A 2LRIC 1DVPA 2KKXA 3FL2A 3DPLR 1T1HA 2JM3A 2I50A 2VJFA 4FK5A 2RI7A 1WILA 2LGKA 2XOZA 3I2DA 5G05B 2M6MA 4A0CD 2KWOA 2RSDA 5D1LB 2XP0A 5KH9A 3C5KA 3HCUA 2CKLA 2K4DA 2F6NA 4R2YA 2XOCA 1F62A 2LGGA 2KU3A 4WA6A 1WEPA 2CSZA 4UP0A 1V87A 2LAUA 2YSMA 3O35A 2L43A 4YC9A 1G25A 3KV6A 3EB5A 2M13A 4UP5A 3LQJA 2H0DB 4QF2A 1MBMA 2ECIA 3HTKC 2VNFA 2MUMA 2E61A 1WESA 2JRJA 5EYAF 5B8DA 2K1JA 1LDJB 4IC2A 4P5OB 3LRQA 5C13A 4ZQLA 1DCQA 4YBMA 2AN6A 3RTRB 3GV4A 2KGGA 2VP7A 4GNDA 5H9MA 3ZTGA 3L1ZB 2D8UA 2ECTA 2YYRA 2DX8A 1N87A 4CCGX 3L11A 2Y43A 3LVQE 1WEVA 5SVXA 3C6WA 1WEWA 5H1VA 2QJ0A 1WEUA 3FAOA 2MNZA 3EB6A 4A4CA 5TDWA 5AITA 4YABA 3T9KA 3O34A 2LN0A 3MHHA 4UI9B 4GNGA 5H1UA 2VPGA 2KIZA 2KFTA 3NG2A 1WE9A 2XB1A 5B77A 3PLWA 2KWJA 2ECNA 2KWKA 3ZVYA 3E2DA 4YADA 4B7YC 3N9PA 5K3QA 2BAYA 3O47A 2DSMA 1FBVA 2CT2A 2ECWA 4BHWA 3HCSA 3N9QA 4AUQB 3O33A 3SOWA 3ZYQA 5SVIB 4MSXA 2LQ6A 2KYUA 3N9MA 2CRRA 5FEYA 3U5NA 3QZVA 2K17A 2L5UA 2E6RA 4C9ZA 2KR4A 2HYED 2ECVA 2CKLB 2YQMA 2XOYA 3M99A 2JUNA 2MIQA 3LVRE 4V3LC 3M62A 2C2VS 3PHDA 4LKAA 1Z60A 1Z2QA 2CRWA 3U5MA 5LKXA 1WFKA 2C2LA 5LKZA 3LQHA 1LDKC 3HCTA 1VFYA 4Z0RA 4QF3A 4F1PA 2QIZA 2KE1A 2M3HA 5DKAA 3T6RA 2IQJA 2YHNA 4I7BA 1E4UA 3H7HA 1WEMA 4WZ0A 1MM3A 2FFWA 5D1MB 4I7DA 2M85A 2G6QA 4L58A 5KH7A 1FP0A 2YVRA 2B0OE 4GNEA 2G45A 3ZPVE 3JUEA 2D8SA 2G43A 3SUBA 2DJAA 3PURA 5J3XA 1HYJA 4PTBA 4OGEA 2RR4A 1JOCA 1U6GB 5B76A 2E6SA 3N9OA 3FANA 5TRBA 1WENA 3KDEC 3ASLA 4A49A 5JG6A 4R7EA 3KQIA 2FUUA 4O64A 1ZBDB 2L0BA 3Q1DA 3DWDA 5B79A 1X4JA 3SOUA 2QICA 3SOXA 2F6JA 2KWNA 3ZNIA 3IHPA 4QQ4A 3PUQA 5LKUA 1WGMA 4FO9A 4GB0A 3MHSA 2H0DA 4LADB 1RMDA 2LXPC 5TBNA 5H1TA 4AP4A 4AYCA 3DDTA 2YW8A 4IC3A 4OGCA 2Y1MA 1BORA 5B75A 3U5PA 3T7LA 4S3OC 1CHCA 1X4IA 3SHBA 2YURA 3O70A 2VPBA 5D1KB 2MNYA 2LV9A 5FERA 2MKEA 2LXHC 2EGPA 1VD4A 2NAAA 3FEHA 4TKPB 3V43A 3GL6A 3L1XA 2ZETC 2YSJA 2VJEB 2LDRA 3M7KA 2FSAA 2L80A 1IYMA 5LKTA 4N3WA 2VJFB 4CA1A 1K2FA 5C11A 2KREA 4A4BA 2L75A 1JM7B 4FIPA 2JMJA
chains in the Genus database with same CATH topology
3O47A 2CSVA 3LJUX 3JUEA 3KDEC 2YREA 2FD4A 2KKXA 4F1PA 3FEHA 5SVYA 3T9KA 3SUBA 2DJAA 2P57A 2JM3A 2D8UA 2XOYA 2JUNA 3LVRE 2E61A 4H9DA 2IQJA 4OGEA 2RR4A 5SVIA 3H7HA 2CONA 3Q1DA 4O62A 3DWDA 2LAUA 2XOZA 3PLWA 3M7KA 2EXUA 3LVQE 2FFWA 3DDTA 5SVIB 3MDBC 4OGCA 2KKYA 3LDYA 5SVXA 5K3QA 2OWAA 3E2DA 2EGMA 2CRWA 2CRRA 4QQ4A 2M13A 2XP0A 2YVRA 2B0OE 3FM8C 1DCQA 4Z0RA 2L7PA 2XOCA 2MKEA 4Z0OA 3FJUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E61 A;  4QQ4 A;  5SVI B;  2RR4 A;  5SVI A;  5SVY A;  4O62 A;  5SVX A;  4Z0R A;  2L7P A;  4Z0O A; 
#chains in the Genus database with same CATH topology
 2CSV A;  3N9N A;  5AIU A;  1HYI A;  4MVT A;  5SVY A;  3ZPV 1;  2OXQ C;  2LGL A;  2EOD A;  4V3K C;  5TAB A;  1Z6U A;  5SVI A;  2K16 A;  2CSY A;  3O36 A;  2EXU A;  4S3O B;  4PPE A;  2ECJ A;  2VPE A;  3LDY A;  3O7A A;  2EGM A;  1XWH A;  2Y1N A;  3M63 A;  3FM8 C;  5B78 A;  2VJE A;  2FUI A;  2L7P A;  3O37 A;  4YAX A;  4ZDT A;  3FJU B;  4FJC A;  4ZUX U;  3ZVZ B;  4L7X A;  2MT5 A;  4XI1 A;  2P57 A;  4NN2 A;  2PNX A;  4H9D A;  2YQL A;  2UZG A;  2YU4 A;  5KH3 A;  4LLB A;  2M1R A;  2MA6 A;  5G0F A;  4B86 C;  4LK9 A;  2PUY A;  4N4F A;  2MD7 B;  2MD8 C;  1VYX A;  4I7C A;  4WZ2 A;  4Z0O A;  4YBS A;  2FD4 A;  4LJN A;  3N9L A;  2YHO A;  3U5O A;  1X4U A;  5DIN A;  3RPG C;  1WEQ A;  4X3G A;  2YT5 A;  4YAT A;  4BBQ A;  5LCW B;  5G04 B;  2YUC A;  5FB0 A;  2VPD A;  5I3L A;  3DQV R;  4AYC B;  4F52 B;  4YBT A;  1WEO A;  2ECG A;  2LGV A;  2XEU A;  2YRE A;  5FB1 A;  4W4U A;  1WEE A;  2HDP A;  2KGI A;  2EA6 A;  2F42 A;  2IDA A;  2CON A;  4O62 A;  2JMI A;  4AVX A;  1WIM A;  4Q6F A;  3MDB C;  2KKY A;  4WZ3 B;  3KV5 A;  4R8P K;  3KNV A;  2OWA A;  3LQI A;  3RPG B;  5TDR A;  3VK6 A;  1MM2 A;  4GNF A;  2JMD A;  2MA5 A;  3LJU X;  1JM7 A;  2LRI C;  1DVP A;  2KKX A;  3FL2 A;  3DPL R;  1T1H A;  2JM3 A;  2I50 A;  2VJF A;  4FK5 A;  2RI7 A;  1WIL A;  2LGK A;  2XOZ A;  3I2D A;  5G05 B;  2M6M A;  4A0C D;  2KWO A;  2RSD A;  5D1L B;  2XP0 A;  5KH9 A;  3C5K A;  3HCU A;  2CKL A;  2K4D A;  2F6N A;  4R2Y A;  2XOC A;  1F62 A;  2LGG A;  2KU3 A;  4WA6 A;  1WEP A;  2CSZ A;  4UP0 A;  1V87 A;  2LAU A;  2YSM A;  3O35 A;  2L43 A;  4YC9 A;  1G25 A;  3KV6 A;  3EB5 A;  2M13 A;  4UP5 A;  3LQJ A;  2H0D B;  4QF2 A;  1MBM A;  2ECI A;  3HTK C;  2VNF A;  2MUM A;  2E61 A;  1WES A;  2JRJ A;  5EYA F;  5B8D A;  2K1J A;  1LDJ B;  4IC2 A;  4P5O B;  3LRQ A;  5C13 A;  4ZQL A;  1DCQ A;  4YBM A;  2AN6 A;  3RTR B;  3GV4 A;  2KGG A;  2VP7 A;  4GND A;  5H9M A;  3ZTG A;  3L1Z B;  2D8U A;  2ECT A;  2YYR A;  2DX8 A;  1N87 A;  4CCG X;  3L11 A;  2Y43 A;  3LVQ E;  1WEV A;  5SVX A;  3C6W A;  1WEW A;  5H1V A;  2QJ0 A;  1WEU A;  3FAO A;  2MNZ A;  3EB6 A;  4A4C A;  5TDW A;  5AIT A;  4YAB A;  3T9K A;  3O34 A;  2LN0 A;  3MHH A;  4UI9 B;  4GNG A;  5H1U A;  2VPG A;  2KIZ A;  2KFT A;  3NG2 A;  1WE9 A;  2XB1 A;  5B77 A;  3PLW A;  2KWJ A;  2ECN A;  2KWK A;  3ZVY A;  3E2D A;  4YAD A;  4B7Y C;  3N9P A;  5K3Q A;  2BAY A;  3O47 A;  2DSM A;  1FBV A;  2CT2 A;  2ECW A;  4BHW A;  3HCS A;  3N9Q A;  4AUQ B;  3O33 A;  3SOW A;  3ZYQ A;  5SVI B;  4MSX A;  2LQ6 A;  2KYU A;  3N9M A;  2CRR A;  5FEY A;  3U5N A;  3QZV A;  2K17 A;  2L5U A;  2E6R A;  4C9Z A;  2KR4 A;  2HYE D;  2ECV A;  2CKL B;  2YQM A;  2XOY A;  3M99 A;  2JUN A;  2MIQ A;  3LVR E;  4V3L C;  3M62 A;  2C2V S;  3PHD A;  4LKA A;  1Z60 A;  1Z2Q A;  2CRW A;  3U5M A;  5LKX A;  1WFK A;  2C2L A;  5LKZ A;  3LQH A;  1LDK C;  3HCT A;  1VFY A;  4Z0R A;  4QF3 A;  4F1P A;  2QIZ A;  2KE1 A;  2M3H A;  5DKA A;  3T6R A;  2IQJ A;  2YHN A;  4I7B A;  1E4U A;  3H7H A;  1WEM A;  4WZ0 A;  1MM3 A;  2FFW A;  5D1M B;  4I7D A;  2M85 A;  2G6Q A;  4L58 A;  5KH7 A;  1FP0 A;  2YVR A;  2B0O E;  4GNE A;  2G45 A;  3ZPV E;  3JUE A;  2D8S A;  2G43 A;  3SUB A;  2DJA A;  3PUR A;  5J3X A;  1HYJ A;  4PTB A;  4OGE A;  2RR4 A;  1JOC A;  1U6G B;  5B76 A;  2E6S A;  3N9O A;  3FAN A;  5TRB A;  1WEN A;  3KDE C;  3ASL A;  4A49 A;  5JG6 A;  4R7E A;  3KQI A;  2FUU A;  4O64 A;  1ZBD B;  2L0B A;  3Q1D A;  3DWD A;  5B79 A;  1X4J A;  3SOU A;  2QIC A;  3SOX A;  2F6J A;  2KWN A;  3ZNI A;  3IHP A;  4QQ4 A;  3PUQ A;  5LKU A;  1WGM A;  4FO9 A;  4GB0 A;  3MHS A;  2H0D A;  4LAD B;  1RMD A;  2LXP C;  5TBN A;  5H1T A;  4AP4 A;  4AYC A;  3DDT A;  2YW8 A;  4IC3 A;  4OGC A;  2Y1M A;  1BOR A;  5B75 A;  3U5P A;  3T7L A;  4S3O C;  1CHC A;  1X4I A;  3SHB A;  2YUR A;  3O70 A;  2VPB A;  5D1K B;  2MNY A;  2LV9 A;  5FER A;  2MKE A;  2LXH C;  2EGP A;  1VD4 A;  2NAA A;  3FEH A;  4TKP B;  3V43 A;  3GL6 A;  3L1X A;  2ZET C;  2YSJ A;  2VJE B;  2LDR A;  3M7K A;  2FSA A;  2L80 A;  1IYM A;  5LKT A;  4N3W A;  2VJF B;  4CA1 A;  1K2F A;  5C11 A;  2KRE A;  4A4B A;  2L75 A;  1JM7 B;  4FIP A;  2JMJ A; 
#chains in the Genus database with same CATH homology
 3O47 A;  2CSV A;  3LJU X;  3JUE A;  3KDE C;  2YRE A;  2FD4 A;  2KKX A;  4F1P A;  3FEH A;  5SVY A;  3T9K A;  3SUB A;  2DJA A;  2P57 A;  2JM3 A;  2D8U A;  2XOY A;  2JUN A;  3LVR E;  2E61 A;  4H9D A;  2IQJ A;  4OGE A;  2RR4 A;  5SVI A;  3H7H A;  2CON A;  3Q1D A;  4O62 A;  3DWD A;  2LAU A;  2XOZ A;  3PLW A;  3M7K A;  2EXU A;  3LVQ E;  2FFW A;  3DDT A;  5SVI B;  3MDB C;  4OGC A;  2KKY A;  3LDY A;  5SVX A;  5K3Q A;  2OWA A;  3E2D A;  2EGM A;  2CRW A;  2CRR A;  4QQ4 A;  2M13 A;  2XP0 A;  2YVR A;  2B0O E;  3FM8 C;  1DCQ A;  4Z0R A;  2L7P A;  2XOC A;  2MKE A;  4Z0O A;  3FJU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...