5KH7A

Crystal structure of fragment (3-[6-oxo-3-(3-pyridinyl)-1(6h)-pyridazinyl]propanoic acid) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Histone deacetylase 6
total genus 30
structure length 100
sequence length 100
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh7A00
4R8PK 5B77A 4ZUXU 3LRQA 4AUQB 4CA1A 2YQMA 2QICA 1Z6UA 4A0CD 4BBQA 5TBNA 2YW8A 1MM3A 4QF2A 1E4UA 3C5KA 1CHCA 4CCGX 3ASLA 5B76A 5JG6A 4GNDA 5D1MB 3PURA 3O70A 3L1XA 2KR4A 2LGVA 2LRIC 1LDKC 2LN0A 3ZPVE 2XB1A 3U5PA 2DX8A 5TDRA 3L1ZB 4MVTA 1WIMA 2LGGA 4L7XA 2G6QA 2G43A 4Q6FA 2LXPC 5EYAF 2YURA 2K16A 4YADA 5TRBA 1MM2A 2LGLA 4GNFA 2LGKA 2MA6A 2L5UA 5B79A 1ZBDB 2Y1MA 4YC9A 4FK5A 4LLBA 4I7CA 5LKXA 2L43A 3O33A 4AP4A 2YUCA 3L11A 1WESA 4YABA 5LKZA 4R7EA 2M3HA 1T1HA 2M6MA 2KWJA 2VPGA 3ZVYA 3NG2A 3EB6A 2VP7A 4A49A 1WEUA 2ECGA 1Z2QA 4MSXA 1WENA 4IC3A 1WFKA 2K17A 3MHSA 4I7DA 1Z60A 2FUUA 2QIZA 2Y43A 2PUYA 5FB0A 3O34A 4YAXA 1X4UA 2RI7A 2C2VS 5G04B 1RMDA 3C6WA 1DVPA 3SOWA 2CKLB 2VPBA 4YBMA 3M62A 2FUIA 3M63A 3V43A 3O36A 1VD4A 1N87A 4XI1A 5KH7A 2KIZA 2D8SA 2VNFA 5DKAA 3FL2A 2VJFB 1WEQA 1K2FA 5TABA 3I2DA 2NAAA 2ECWA 2G45A 2YHOA 5B75A 2F6NA 4WZ0A 1WEMA 1WGMA 3LQIA 2JRJA 2K1JA 2H0DB 5FB1A 1WEWA 5KH9A 2UZGA 5LKTA 1G25A 1WILA 3ZTGA 2JMDA 2KWOA 4LK9A 1WEEA 2MA5A 2YSMA 4V3KC 4B86C 5H1TA 3U5NA 4WZ3B 4AYCA 4FJCA 5KH3A 3QZVA 3RPGC 5LCWB 2Y1NA 2KWNA 1FP0A 5C11A 3N9OA 2ECVA 2LQ6A 2I50A 4P5OB 1VYXA 2QJ0A 3HCSA 2M1RA 4TKPB 3DQVR 2LXHC 4FO9A 5D1LB 4UP0A 3U5OA 2YQLA 3N9MA 2BAYA 5DINA 3LQJA 2ECTA 5FEYA 3PUQA 2CSYA 2KGGA 4S3OC 5B8DA 5LKUA 3HCTA 3PHDA 2EGPA 2YREA 4N4FA 2L80A 3N9PA 4LKAA 2YYRA 3SOUA 2YSJA 4AVXA 5H1VA 4YBTA 3ZYQA 5AITA 2F6JA 1LDJB 2ECNA 2M85A 2MNZA 3EB5A 1WE9A 4C9ZA 4WZ2A 1IYMA 2MNYA 3SHBA 2YT5A 4WA6A 1VFYA 3ZPV1 2YHNA 2KYUA 2C2LA 4BHWA 2L0BA 2VPEA 3M99A 2KU3A 4L58A 2ZETC 2VJFA 2VJEA 3N9NA 2KFTA 1BORA 3KV5A 1WEVA 2FSAA 2HYED 2JMJA 4LADB 3DPLR 2K4DA 2LDRA 2EODA 3O35A 3GV4A 2CKLA 3U5MA 2CSZA 4A4CA 2MUMA 1HYJA 3LQHA 5FERA 4GNEA 2KWKA 4S3OB 5G05B 1FBVA 1JM7B 2PNXA 2OXQC 2MD7B 3RPGB 3O37A 4AYCB 4I7BA 3KNVA 1JM7A 1X4JA 1WEPA 3HTKC 4NN2A 4ZDTA 4ZQLA 1V87A 2AN6A 4V3LC 4B7YC 1XWHA 4GB0A 5H1UA 3RTRB 1U6GB 5D1KB 4QF3A 5B78A 3ZVZB 2E6SA 3O7AA 2CT2A 4R2YA 2VJEB 2IDAA 4UI9B 2E6RA 3T6RA 2MIQA 4LJNA 2LV9A 2ECJA 3SOXA 3ZNIA 3KQIA 2F42A 4YATA 4N3WA 2KE1A 1JOCA 1F62A 4A4BA 2L75A 2VPDA 3KV6A 4UP5A 5G0FA 4X3GA 2YU4A 3N9QA 3GL6A 4PTBA 5TDWA 5AIUA 3HCUA 2H0DA 4YBSA 3N9LA 2EA6A 2KREA 2KGIA 3MHHA 2JMIA 4F52B 2ECIA 3T7LA 4IC2A 2MD8C 2XEUA 5H9MA 3IHPA 1WEOA 4PPEA 5I3LA 4O64A 4FIPA 4GNGA 4W4UA 2HDPA 1X4IA 5J3XA 5C13A 1HYIA 2RSDA 2MT5A 3VK6A
chains in the Genus database with same CATH superfamily
4R8PK 5B77A 4ZUXU 3LRQA 4AUQB 4CA1A 2YQMA 2QICA 1Z6UA 4A0CD 4BBQA 5TBNA 2YW8A 1MM3A 4QF2A 1E4UA 3C5KA 4Z0OA 1CHCA 4CCGX 3ASLA 5B76A 5JG6A 4GNDA 2JM3A 5D1MB 3PURA 3O70A 3L1XA 3LVRE 2KR4A 2LGVA 2MKEA 2LRIC 1LDKC 2LN0A 3ZPVE 4OGEA 2XB1A 3U5PA 2DX8A 5TDRA 3L1ZB 4MVTA 1WIMA 2LGGA 4L7XA 2DJAA 3FANA 2G6QA 2G43A 4Q6FA 2LXPC 5EYAF 2YURA 2K16A 4YADA 5TRBA 1MM2A 2LGLA 4GNFA 2LGKA 2MA6A 2L5UA 5B79A 2CRWA 1ZBDB 2M13A 2Y1MA 4YC9A 4FK5A 4LLBA 4I7CA 5LKXA 3PLWA 2L43A 2IQJA 2EXUA 3O33A 4AP4A 4H9DA 3JUEA 2YUCA 3L11A 4Z0RA 1WESA 3LVQE 3FEHA 4YABA 5LKZA 4R7EA 2M3HA 1T1HA 2M6MA 2KWJA 2VPGA 3FAOA 3ZVYA 3NG2A 3EB6A 2VP7A 4A49A 1WEUA 2ECGA 1Z2QA 4MSXA 1WENA 2FD4A 4IC3A 1WFKA 2K17A 5SVYA 3MHSA 4I7DA 1Z60A 2FUUA 2QIZA 2Y43A 2PUYA 5FB0A 3O34A 4YAXA 1X4UA 2RI7A 2C2VS 5G04B 1RMDA 3C6WA 1DVPA 2CSVA 2B0OE 3SOWA 2CKLB 2VPBA 4YBMA 3M62A 2FUIA 3M63A 3DWDA 3V43A 3O36A 1VD4A 1N87A 4XI1A 5KH7A 2KIZA 2D8SA 2VNFA 5DKAA 3FL2A 2VJFB 1WEQA 1K2FA 5TABA 3I2DA 2NAAA 2ECWA 2G45A 2YHOA 5B75A 2F6NA 4WZ0A 1WEMA 1WGMA 3LQIA 2JRJA 2K1JA 2H0DB 5FB1A 1WEWA 5KH9A 2UZGA 5LKTA 1G25A 1WILA 3ZTGA 2JMDA 2KWOA 4LK9A 3H7HA 1WEEA 3KDEC 2MA5A 2YSMA 4V3KC 4B86C 5H1TA 2EGMA 3U5NA 2YVRA 2KKXA 4WZ3B 4AYCA 4FJCA 5KH3A 3QZVA 2XP0A 5LCWB 3RPGC 2Y1NA 2CRRA 2KWNA 1FP0A 5C11A 3Q1DA 3N9OA 1MBMA 2ECVA 2LQ6A 2DSMA 2I50A 4P5OB 1VYXA 2QJ0A 3HCSA 2M1RA 4TKPB 5SVXA 3DQVR 2LXHC 4OGCA 4FO9A 5D1LB 2JUNA 4UP0A 3U5OA 2YQLA 2FFWA 3N9MA 2BAYA 5DINA 3LQJA 2ECTA 5FEYA 3PUQA 2CSYA 2KGGA 5SVIB 4S3OC 5B8DA 5LKUA 3DDTA 3HCTA 3PHDA 4O62A 2EGPA 2YREA 3SUBA 4N4FA 3M7KA 2L80A 3N9PA 4LKAA 2YYRA 3SOUA 2YSJA 4AVXA 5H1VA 4YBTA 3ZYQA 5AITA 2F6JA 1LDJB 2ECNA 2M85A 2MNZA 3EB5A 1WE9A 4C9ZA 4WZ2A 1IYMA 2MNYA 3SHBA 2YT5A 3LJUX 4WA6A 3LDYA 1VFYA 3ZPV1 2YHNA 2KYUA 2C2LA 4BHWA 2L0BA 2VPEA 3M99A 2KU3A 4L58A 2ZETC 2VJFA 2VJEA 3N9NA 2KFTA 1BORA 3KV5A 1WEVA 2FSAA 2HYED 2JMJA 4LADB 3DPLR 4QQ4A 2K4DA 2LDRA 2EODA 3O35A 3GV4A 2CKLA 3U5MA 2CSZA 4A4CA 2MUMA 2OWAA 3LQHA 5FERA 4GNEA 2L7PA 1HYJA 2KWKA 4S3OB 5G05B 1FBVA 3FJUB 1JM7B 3O47A 2PNXA 2OXQC 2MD7B 3RPGB 3O37A 4AYCB 4I7BA 3KNVA 1JM7A 1X4JA 1WEPA 3HTKC 2KKYA 4NN2A 4ZDTA 5SVIA 4ZQLA 1V87A 2AN6A 2RR4A 4V3LC 4B7YC 3E2DA 1XWHA 4GB0A 5H1UA 3RTRB 1U6GB 5D1KB 4QF3A 5B78A 3ZVZB 2E6SA 3O7AA 2LAUA 2CT2A 4R2YA 2VJEB 2IDAA 4UI9B 2E6RA 3T6RA 1DCQA 5K3QA 2MIQA 3FM8C 4LJNA 2LV9A 2XOZA 2ECJA 3SOXA 3ZNIA 3KQIA 2F42A 4YATA 2CONA 4N3WA 2KE1A 1JOCA 1F62A 4A4BA 2L75A 2VPDA 3KV6A 4UP5A 5G0FA 4X3GA 2YU4A 2D8UA 3N9QA 3GL6A 4PTBA 5TDWA 5AIUA 3HCUA 2H0DA 4YBSA 3N9LA 2EA6A 2XOCA 2KREA 2KGIA 3MHHA 2JMIA 4F1PA 4F52B 2P57A 2ECIA 3T7LA 2XOYA 4IC2A 2MD8C 2XEUA 5H9MA 3IHPA 1WEOA 4PPEA 3T9KA 5I3LA 4O64A 4FIPA 4GNGA 4W4UA 2HDPA 1X4IA 5J3XA 5C13A 2E61A 1HYIA 3MDBC 2RSDA 2MT5A 3VK6A
chains in the Genus database with same CATH topology
4R8PK 5B77A 4ZUXU 3LRQA 4AUQB 4CA1A 2YQMA 2QICA 1Z6UA 4A0CD 4BBQA 5TBNA 2YW8A 1MM3A 4QF2A 1E4UA 3C5KA 1CHCA 4CCGX 3ASLA 5B76A 5JG6A 4GNDA 5D1MB 3PURA 3O70A 3L1XA 2KR4A 2LGVA 2LRIC 1LDKC 2LN0A 3ZPVE 2XB1A 3U5PA 2DX8A 5TDRA 3L1ZB 4MVTA 1WIMA 2LGGA 4L7XA 2G6QA 2G43A 4Q6FA 2LXPC 5EYAF 2YURA 2K16A 4YADA 5TRBA 1MM2A 2LGLA 4GNFA 2LGKA 2MA6A 2L5UA 5B79A 1ZBDB 2Y1MA 4YC9A 4FK5A 4LLBA 4I7CA 5LKXA 2L43A 3O33A 4AP4A 2YUCA 3L11A 1WESA 4YABA 5LKZA 4R7EA 2M3HA 1T1HA 2M6MA 2KWJA 2VPGA 3ZVYA 3NG2A 3EB6A 2VP7A 4A49A 1WEUA 2ECGA 1Z2QA 4MSXA 1WENA 4IC3A 1WFKA 2K17A 3MHSA 4I7DA 1Z60A 2FUUA 2QIZA 2Y43A 2PUYA 5FB0A 3O34A 4YAXA 1X4UA 2RI7A 2C2VS 5G04B 1RMDA 3C6WA 1DVPA 3SOWA 2CKLB 2VPBA 4YBMA 3M62A 2FUIA 3M63A 3V43A 3O36A 1VD4A 1N87A 4XI1A 5KH7A 2KIZA 2D8SA 2VNFA 5DKAA 3FL2A 2VJFB 1WEQA 1K2FA 5TABA 3I2DA 2NAAA 2ECWA 2G45A 2YHOA 5B75A 2F6NA 4WZ0A 1WEMA 1WGMA 3LQIA 2JRJA 2K1JA 2H0DB 5FB1A 1WEWA 5KH9A 2UZGA 5LKTA 1G25A 1WILA 3ZTGA 2JMDA 2KWOA 4LK9A 1WEEA 2MA5A 2YSMA 4V3KC 4B86C 5H1TA 3U5NA 4WZ3B 4AYCA 4FJCA 5KH3A 3QZVA 3RPGC 5LCWB 2Y1NA 2KWNA 1FP0A 5C11A 3N9OA 2ECVA 2LQ6A 2I50A 4P5OB 1VYXA 2QJ0A 3HCSA 2M1RA 4TKPB 3DQVR 2LXHC 4FO9A 5D1LB 4UP0A 3U5OA 2YQLA 3N9MA 2BAYA 5DINA 3LQJA 2ECTA 5FEYA 3PUQA 2CSYA 2KGGA 4S3OC 5B8DA 5LKUA 3HCTA 3PHDA 2EGPA 2YREA 4N4FA 2L80A 3N9PA 4LKAA 2YYRA 3SOUA 2YSJA 4AVXA 5H1VA 4YBTA 3ZYQA 5AITA 2F6JA 1LDJB 2ECNA 2M85A 2MNZA 3EB5A 1WE9A 4C9ZA 4WZ2A 1IYMA 2MNYA 3SHBA 2YT5A 4WA6A 1VFYA 3ZPV1 2YHNA 2KYUA 2C2LA 4BHWA 2L0BA 2VPEA 3M99A 2KU3A 4L58A 2ZETC 2VJFA 2VJEA 3N9NA 2KFTA 1BORA 3KV5A 1WEVA 2FSAA 2HYED 2JMJA 4LADB 3DPLR 2K4DA 2LDRA 2EODA 3O35A 3GV4A 2CKLA 3U5MA 2CSZA 4A4CA 2MUMA 1HYJA 3LQHA 5FERA 4GNEA 2KWKA 4S3OB 5G05B 1FBVA 1JM7B 2PNXA 2OXQC 2MD7B 3RPGB 3O37A 4AYCB 4I7BA 3KNVA 1JM7A 1X4JA 1WEPA 3HTKC 4NN2A 4ZDTA 4ZQLA 1V87A 2AN6A 4V3LC 4B7YC 1XWHA 4GB0A 5H1UA 3RTRB 1U6GB 5D1KB 4QF3A 5B78A 3ZVZB 2E6SA 3O7AA 2CT2A 4R2YA 2VJEB 2IDAA 4UI9B 2E6RA 3T6RA 2MIQA 4LJNA 2LV9A 2ECJA 3SOXA 3ZNIA 3KQIA 2F42A 4YATA 4N3WA 2KE1A 1JOCA 1F62A 4A4BA 2L75A 2VPDA 3KV6A 4UP5A 5G0FA 4X3GA 2YU4A 3N9QA 3GL6A 4PTBA 5TDWA 5AIUA 3HCUA 2H0DA 4YBSA 3N9LA 2EA6A 2KREA 2KGIA 3MHHA 2JMIA 4F52B 2ECIA 3T7LA 4IC2A 2MD8C 2XEUA 5H9MA 3IHPA 1WEOA 4PPEA 5I3LA 4O64A 4FIPA 4GNGA 4W4UA 2HDPA 1X4IA 5J3XA 5C13A 1HYIA 2RSDA 2MT5A 3VK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P K;  5B77 A;  4ZUX U;  3LRQ A;  4AUQ B;  4CA1 A;  2YQM A;  2QIC A;  1Z6U A;  4A0C D;  4BBQ A;  5TBN A;  2YW8 A;  1MM3 A;  4QF2 A;  1E4U A;  3C5K A;  1CHC A;  4CCG X;  3ASL A;  5B76 A;  5JG6 A;  4GND A;  5D1M B;  3PUR A;  3O70 A;  3L1X A;  2KR4 A;  2LGV A;  2LRI C;  1LDK C;  2LN0 A;  3ZPV E;  2XB1 A;  3U5P A;  2DX8 A;  5TDR A;  3L1Z B;  4MVT A;  1WIM A;  2LGG A;  4L7X A;  2G6Q A;  2G43 A;  4Q6F A;  2LXP C;  5EYA F;  2YUR A;  2K16 A;  4YAD A;  5TRB A;  1MM2 A;  2LGL A;  4GNF A;  2LGK A;  2MA6 A;  2L5U A;  5B79 A;  1ZBD B;  2Y1M A;  4YC9 A;  4FK5 A;  4LLB A;  4I7C A;  5LKX A;  2L43 A;  3O33 A;  4AP4 A;  2YUC A;  3L11 A;  1WES A;  4YAB A;  5LKZ A;  4R7E A;  2M3H A;  1T1H A;  2M6M A;  2KWJ A;  2VPG A;  3ZVY A;  3NG2 A;  3EB6 A;  2VP7 A;  4A49 A;  1WEU A;  2ECG A;  1Z2Q A;  4MSX A;  1WEN A;  4IC3 A;  1WFK A;  2K17 A;  3MHS A;  4I7D A;  1Z60 A;  2FUU A;  2QIZ A;  2Y43 A;  2PUY A;  5FB0 A;  3O34 A;  4YAX A;  1X4U A;  2RI7 A;  2C2V S;  5G04 B;  1RMD A;  3C6W A;  1DVP A;  3SOW A;  2CKL B;  2VPB A;  4YBM A;  3M62 A;  2FUI A;  3M63 A;  3V43 A;  3O36 A;  1VD4 A;  1N87 A;  4XI1 A;  5KH7 A;  2KIZ A;  2D8S A;  2VNF A;  5DKA A;  3FL2 A;  2VJF B;  1WEQ A;  1K2F A;  5TAB A;  3I2D A;  2NAA A;  2ECW A;  2G45 A;  2YHO A;  5B75 A;  2F6N A;  4WZ0 A;  1WEM A;  1WGM A;  3LQI A;  2JRJ A;  2K1J A;  2H0D B;  5FB1 A;  1WEW A;  5KH9 A;  2UZG A;  5LKT A;  1G25 A;  1WIL A;  3ZTG A;  2JMD A;  2KWO A;  4LK9 A;  1WEE A;  2MA5 A;  2YSM A;  4V3K C;  4B86 C;  5H1T A;  3U5N A;  4WZ3 B;  4AYC A;  4FJC A;  5KH3 A;  3QZV A;  3RPG C;  5LCW B;  2Y1N A;  2KWN A;  1FP0 A;  5C11 A;  3N9O A;  2ECV A;  2LQ6 A;  2I50 A;  4P5O B;  1VYX A;  2QJ0 A;  3HCS A;  2M1R A;  4TKP B;  3DQV R;  2LXH C;  4FO9 A;  5D1L B;  4UP0 A;  3U5O A;  2YQL A;  3N9M A;  2BAY A;  5DIN A;  3LQJ A;  2ECT A;  5FEY A;  3PUQ A;  2CSY A;  2KGG A;  4S3O C;  5B8D A;  5LKU A;  3HCT A;  3PHD A;  2EGP A;  2YRE A;  4N4F A;  2L80 A;  3N9P A;  4LKA A;  2YYR A;  3SOU A;  2YSJ A;  4AVX A;  5H1V A;  4YBT A;  3ZYQ A;  5AIT A;  2F6J A;  1LDJ B;  2ECN A;  2M85 A;  2MNZ A;  3EB5 A;  1WE9 A;  4C9Z A;  4WZ2 A;  1IYM A;  2MNY A;  3SHB A;  2YT5 A;  4WA6 A;  1VFY A;  3ZPV 1;  2YHN A;  2KYU A;  2C2L A;  4BHW A;  2L0B A;  2VPE A;  3M99 A;  2KU3 A;  4L58 A;  2ZET C;  2VJF A;  2VJE A;  3N9N A;  2KFT A;  1BOR A;  3KV5 A;  1WEV A;  2FSA A;  2HYE D;  2JMJ A;  4LAD B;  3DPL R;  2K4D A;  2LDR A;  2EOD A;  3O35 A;  3GV4 A;  2CKL A;  3U5M A;  2CSZ A;  4A4C A;  2MUM A;  1HYJ A;  3LQH A;  5FER A;  4GNE A;  2KWK A;  4S3O B;  5G05 B;  1FBV A;  1JM7 B;  2PNX A;  2OXQ C;  2MD7 B;  3RPG B;  3O37 A;  4AYC B;  4I7B A;  3KNV A;  1JM7 A;  1X4J A;  1WEP A;  3HTK C;  4NN2 A;  4ZDT A;  4ZQL A;  1V87 A;  2AN6 A;  4V3L C;  4B7Y C;  1XWH A;  4GB0 A;  5H1U A;  3RTR B;  1U6G B;  5D1K B;  4QF3 A;  5B78 A;  3ZVZ B;  2E6S A;  3O7A A;  2CT2 A;  4R2Y A;  2VJE B;  2IDA A;  4UI9 B;  2E6R A;  3T6R A;  2MIQ A;  4LJN A;  2LV9 A;  2ECJ A;  3SOX A;  3ZNI A;  3KQI A;  2F42 A;  4YAT A;  4N3W A;  2KE1 A;  1JOC A;  1F62 A;  4A4B A;  2L75 A;  2VPD A;  3KV6 A;  4UP5 A;  5G0F A;  4X3G A;  2YU4 A;  3N9Q A;  3GL6 A;  4PTB A;  5TDW A;  5AIU A;  3HCU A;  2H0D A;  4YBS A;  3N9L A;  2EA6 A;  2KRE A;  2KGI A;  3MHH A;  2JMI A;  4F52 B;  2ECI A;  3T7L A;  4IC2 A;  2MD8 C;  2XEU A;  5H9M A;  3IHP A;  1WEO A;  4PPE A;  5I3L A;  4O64 A;  4FIP A;  4GNG A;  4W4U A;  2HDP A;  1X4I A;  5J3X A;  5C13 A;  1HYI A;  2RSD A;  2MT5 A;  3VK6 A; 
#chains in the Genus database with same CATH topology
 4R8P K;  5B77 A;  4ZUX U;  3LRQ A;  4AUQ B;  4CA1 A;  2YQM A;  2QIC A;  1Z6U A;  4A0C D;  4BBQ A;  5TBN A;  2YW8 A;  1MM3 A;  4QF2 A;  1E4U A;  3C5K A;  4Z0O A;  1CHC A;  4CCG X;  3ASL A;  5B76 A;  5JG6 A;  4GND A;  2JM3 A;  5D1M B;  3PUR A;  3O70 A;  3L1X A;  3LVR E;  2KR4 A;  2LGV A;  2MKE A;  2LRI C;  1LDK C;  2LN0 A;  3ZPV E;  4OGE A;  2XB1 A;  3U5P A;  2DX8 A;  5TDR A;  3L1Z B;  4MVT A;  1WIM A;  2LGG A;  4L7X A;  2DJA A;  3FAN A;  2G6Q A;  2G43 A;  4Q6F A;  2LXP C;  5EYA F;  2YUR A;  2K16 A;  4YAD A;  5TRB A;  1MM2 A;  2LGL A;  4GNF A;  2LGK A;  2MA6 A;  2L5U A;  5B79 A;  2CRW A;  1ZBD B;  2M13 A;  2Y1M A;  4YC9 A;  4FK5 A;  4LLB A;  4I7C A;  5LKX A;  3PLW A;  2L43 A;  2IQJ A;  2EXU A;  3O33 A;  4AP4 A;  4H9D A;  3JUE A;  2YUC A;  3L11 A;  4Z0R A;  1WES A;  3LVQ E;  3FEH A;  4YAB A;  5LKZ A;  4R7E A;  2M3H A;  1T1H A;  2M6M A;  2KWJ A;  2VPG A;  3FAO A;  3ZVY A;  3NG2 A;  3EB6 A;  2VP7 A;  4A49 A;  1WEU A;  2ECG A;  1Z2Q A;  4MSX A;  1WEN A;  2FD4 A;  4IC3 A;  1WFK A;  2K17 A;  5SVY A;  3MHS A;  4I7D A;  1Z60 A;  2FUU A;  2QIZ A;  2Y43 A;  2PUY A;  5FB0 A;  3O34 A;  4YAX A;  1X4U A;  2RI7 A;  2C2V S;  5G04 B;  1RMD A;  3C6W A;  1DVP A;  2CSV A;  2B0O E;  3SOW A;  2CKL B;  2VPB A;  4YBM A;  3M62 A;  2FUI A;  3M63 A;  3DWD A;  3V43 A;  3O36 A;  1VD4 A;  1N87 A;  4XI1 A;  5KH7 A;  2KIZ A;  2D8S A;  2VNF A;  5DKA A;  3FL2 A;  2VJF B;  1WEQ A;  1K2F A;  5TAB A;  3I2D A;  2NAA A;  2ECW A;  2G45 A;  2YHO A;  5B75 A;  2F6N A;  4WZ0 A;  1WEM A;  1WGM A;  3LQI A;  2JRJ A;  2K1J A;  2H0D B;  5FB1 A;  1WEW A;  5KH9 A;  2UZG A;  5LKT A;  1G25 A;  1WIL A;  3ZTG A;  2JMD A;  2KWO A;  4LK9 A;  3H7H A;  1WEE A;  3KDE C;  2MA5 A;  2YSM A;  4V3K C;  4B86 C;  5H1T A;  2EGM A;  3U5N A;  2YVR A;  2KKX A;  4WZ3 B;  4AYC A;  4FJC A;  5KH3 A;  3QZV A;  2XP0 A;  5LCW B;  3RPG C;  2Y1N A;  2CRR A;  2KWN A;  1FP0 A;  5C11 A;  3Q1D A;  3N9O A;  1MBM A;  2ECV A;  2LQ6 A;  2DSM A;  2I50 A;  4P5O B;  1VYX A;  2QJ0 A;  3HCS A;  2M1R A;  4TKP B;  5SVX A;  3DQV R;  2LXH C;  4OGC A;  4FO9 A;  5D1L B;  2JUN A;  4UP0 A;  3U5O A;  2YQL A;  2FFW A;  3N9M A;  2BAY A;  5DIN A;  3LQJ A;  2ECT A;  5FEY A;  3PUQ A;  2CSY A;  2KGG A;  5SVI B;  4S3O C;  5B8D A;  5LKU A;  3DDT A;  3HCT A;  3PHD A;  4O62 A;  2EGP A;  2YRE A;  3SUB A;  4N4F A;  3M7K A;  2L80 A;  3N9P A;  4LKA A;  2YYR A;  3SOU A;  2YSJ A;  4AVX A;  5H1V A;  4YBT A;  3ZYQ A;  5AIT A;  2F6J A;  1LDJ B;  2ECN A;  2M85 A;  2MNZ A;  3EB5 A;  1WE9 A;  4C9Z A;  4WZ2 A;  1IYM A;  2MNY A;  3SHB A;  2YT5 A;  3LJU X;  4WA6 A;  3LDY A;  1VFY A;  3ZPV 1;  2YHN A;  2KYU A;  2C2L A;  4BHW A;  2L0B A;  2VPE A;  3M99 A;  2KU3 A;  4L58 A;  2ZET C;  2VJF A;  2VJE A;  3N9N A;  2KFT A;  1BOR A;  3KV5 A;  1WEV A;  2FSA A;  2HYE D;  2JMJ A;  4LAD B;  3DPL R;  4QQ4 A;  2K4D A;  2LDR A;  2EOD A;  3O35 A;  3GV4 A;  2CKL A;  3U5M A;  2CSZ A;  4A4C A;  2MUM A;  2OWA A;  3LQH A;  5FER A;  4GNE A;  2L7P A;  1HYJ A;  2KWK A;  4S3O B;  5G05 B;  1FBV A;  3FJU B;  1JM7 B;  3O47 A;  2PNX A;  2OXQ C;  2MD7 B;  3RPG B;  3O37 A;  4AYC B;  4I7B A;  3KNV A;  1JM7 A;  1X4J A;  1WEP A;  3HTK C;  2KKY A;  4NN2 A;  4ZDT A;  5SVI A;  4ZQL A;  1V87 A;  2AN6 A;  2RR4 A;  4V3L C;  4B7Y C;  3E2D A;  1XWH A;  4GB0 A;  5H1U A;  3RTR B;  1U6G B;  5D1K B;  4QF3 A;  5B78 A;  3ZVZ B;  2E6S A;  3O7A A;  2LAU A;  2CT2 A;  4R2Y A;  2VJE B;  2IDA A;  4UI9 B;  2E6R A;  3T6R A;  1DCQ A;  5K3Q A;  2MIQ A;  3FM8 C;  4LJN A;  2LV9 A;  2XOZ A;  2ECJ A;  3SOX A;  3ZNI A;  3KQI A;  2F42 A;  4YAT A;  2CON A;  4N3W A;  2KE1 A;  1JOC A;  1F62 A;  4A4B A;  2L75 A;  2VPD A;  3KV6 A;  4UP5 A;  5G0F A;  4X3G A;  2YU4 A;  2D8U A;  3N9Q A;  3GL6 A;  4PTB A;  5TDW A;  5AIU A;  3HCU A;  2H0D A;  4YBS A;  3N9L A;  2EA6 A;  2XOC A;  2KRE A;  2KGI A;  3MHH A;  2JMI A;  4F1P A;  4F52 B;  2P57 A;  2ECI A;  3T7L A;  2XOY A;  4IC2 A;  2MD8 C;  2XEU A;  5H9M A;  3IHP A;  1WEO A;  4PPE A;  3T9K A;  5I3L A;  4O64 A;  4FIP A;  4GNG A;  4W4U A;  2HDP A;  1X4I A;  5J3X A;  5C13 A;  2E61 A;  1HYI A;  3MDB C;  2RSD A;  2MT5 A;  3VK6 A; 
#chains in the Genus database with same CATH homology
 4R8P K;  5B77 A;  4ZUX U;  3LRQ A;  4AUQ B;  4CA1 A;  2YQM A;  2QIC A;  1Z6U A;  4A0C D;  4BBQ A;  5TBN A;  2YW8 A;  1MM3 A;  4QF2 A;  1E4U A;  3C5K A;  1CHC A;  4CCG X;  3ASL A;  5B76 A;  5JG6 A;  4GND A;  5D1M B;  3PUR A;  3O70 A;  3L1X A;  2KR4 A;  2LGV A;  2LRI C;  1LDK C;  2LN0 A;  3ZPV E;  2XB1 A;  3U5P A;  2DX8 A;  5TDR A;  3L1Z B;  4MVT A;  1WIM A;  2LGG A;  4L7X A;  2G6Q A;  2G43 A;  4Q6F A;  2LXP C;  5EYA F;  2YUR A;  2K16 A;  4YAD A;  5TRB A;  1MM2 A;  2LGL A;  4GNF A;  2LGK A;  2MA6 A;  2L5U A;  5B79 A;  1ZBD B;  2Y1M A;  4YC9 A;  4FK5 A;  4LLB A;  4I7C A;  5LKX A;  2L43 A;  3O33 A;  4AP4 A;  2YUC A;  3L11 A;  1WES A;  4YAB A;  5LKZ A;  4R7E A;  2M3H A;  1T1H A;  2M6M A;  2KWJ A;  2VPG A;  3ZVY A;  3NG2 A;  3EB6 A;  2VP7 A;  4A49 A;  1WEU A;  2ECG A;  1Z2Q A;  4MSX A;  1WEN A;  4IC3 A;  1WFK A;  2K17 A;  3MHS A;  4I7D A;  1Z60 A;  2FUU A;  2QIZ A;  2Y43 A;  2PUY A;  5FB0 A;  3O34 A;  4YAX A;  1X4U A;  2RI7 A;  2C2V S;  5G04 B;  1RMD A;  3C6W A;  1DVP A;  3SOW A;  2CKL B;  2VPB A;  4YBM A;  3M62 A;  2FUI A;  3M63 A;  3V43 A;  3O36 A;  1VD4 A;  1N87 A;  4XI1 A;  5KH7 A;  2KIZ A;  2D8S A;  2VNF A;  5DKA A;  3FL2 A;  2VJF B;  1WEQ A;  1K2F A;  5TAB A;  3I2D A;  2NAA A;  2ECW A;  2G45 A;  2YHO A;  5B75 A;  2F6N A;  4WZ0 A;  1WEM A;  1WGM A;  3LQI A;  2JRJ A;  2K1J A;  2H0D B;  5FB1 A;  1WEW A;  5KH9 A;  2UZG A;  5LKT A;  1G25 A;  1WIL A;  3ZTG A;  2JMD A;  2KWO A;  4LK9 A;  1WEE A;  2MA5 A;  2YSM A;  4V3K C;  4B86 C;  5H1T A;  3U5N A;  4WZ3 B;  4AYC A;  4FJC A;  5KH3 A;  3QZV A;  3RPG C;  5LCW B;  2Y1N A;  2KWN A;  1FP0 A;  5C11 A;  3N9O A;  2ECV A;  2LQ6 A;  2I50 A;  4P5O B;  1VYX A;  2QJ0 A;  3HCS A;  2M1R A;  4TKP B;  3DQV R;  2LXH C;  4FO9 A;  5D1L B;  4UP0 A;  3U5O A;  2YQL A;  3N9M A;  2BAY A;  5DIN A;  3LQJ A;  2ECT A;  5FEY A;  3PUQ A;  2CSY A;  2KGG A;  4S3O C;  5B8D A;  5LKU A;  3HCT A;  3PHD A;  2EGP A;  2YRE A;  4N4F A;  2L80 A;  3N9P A;  4LKA A;  2YYR A;  3SOU A;  2YSJ A;  4AVX A;  5H1V A;  4YBT A;  3ZYQ A;  5AIT A;  2F6J A;  1LDJ B;  2ECN A;  2M85 A;  2MNZ A;  3EB5 A;  1WE9 A;  4C9Z A;  4WZ2 A;  1IYM A;  2MNY A;  3SHB A;  2YT5 A;  4WA6 A;  1VFY A;  3ZPV 1;  2YHN A;  2KYU A;  2C2L A;  4BHW A;  2L0B A;  2VPE A;  3M99 A;  2KU3 A;  4L58 A;  2ZET C;  2VJF A;  2VJE A;  3N9N A;  2KFT A;  1BOR A;  3KV5 A;  1WEV A;  2FSA A;  2HYE D;  2JMJ A;  4LAD B;  3DPL R;  2K4D A;  2LDR A;  2EOD A;  3O35 A;  3GV4 A;  2CKL A;  3U5M A;  2CSZ A;  4A4C A;  2MUM A;  1HYJ A;  3LQH A;  5FER A;  4GNE A;  2KWK A;  4S3O B;  5G05 B;  1FBV A;  1JM7 B;  2PNX A;  2OXQ C;  2MD7 B;  3RPG B;  3O37 A;  4AYC B;  4I7B A;  3KNV A;  1JM7 A;  1X4J A;  1WEP A;  3HTK C;  4NN2 A;  4ZDT A;  4ZQL A;  1V87 A;  2AN6 A;  4V3L C;  4B7Y C;  1XWH A;  4GB0 A;  5H1U A;  3RTR B;  1U6G B;  5D1K B;  4QF3 A;  5B78 A;  3ZVZ B;  2E6S A;  3O7A A;  2CT2 A;  4R2Y A;  2VJE B;  2IDA A;  4UI9 B;  2E6R A;  3T6R A;  2MIQ A;  4LJN A;  2LV9 A;  2ECJ A;  3SOX A;  3ZNI A;  3KQI A;  2F42 A;  4YAT A;  4N3W A;  2KE1 A;  1JOC A;  1F62 A;  4A4B A;  2L75 A;  2VPD A;  3KV6 A;  4UP5 A;  5G0F A;  4X3G A;  2YU4 A;  3N9Q A;  3GL6 A;  4PTB A;  5TDW A;  5AIU A;  3HCU A;  2H0D A;  4YBS A;  3N9L A;  2EA6 A;  2KRE A;  2KGI A;  3MHH A;  2JMI A;  4F52 B;  2ECI A;  3T7L A;  4IC2 A;  2MD8 C;  2XEU A;  5H9M A;  3IHP A;  1WEO A;  4PPE A;  5I3L A;  4O64 A;  4FIP A;  4GNG A;  4W4U A;  2HDP A;  1X4I A;  5J3X A;  5C13 A;  1HYI A;  2RSD A;  2MT5 A;  3VK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...