3O33A

Crystal structure of trim24 phd-bromo in the free state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 47
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o33A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o33A01
5CUEA 5D3LA 3IU5A 5FH7A 4O7EA 2K17A 4QR3A 4AKNA 4UYFB 5TABA 1EQFA 1WUMA 1WEMA 2XEUA 4O7CA 4MR3A 4QSVA 2KTBB 2RNXA 5B76A 1WEWA 2LXPC 4MEQA 5L98A 2YQDA 5G05B 4QSUA 4XY8A 4O7BA 3QZSA 4ALHA 5DYAA 4NXJA 2LGGA 2YHNA 4BBQA 5FB1A 2ECVA 5EWDA 2L80A 4A9EA 1FP0A 1X0JA 3L11A 3M62A 2E3KA 5KHMA 2KU3A 4TU6A 5TBNA 4TU4A 2L0BA 4TT4A 4FLPA 3FL2A 1G25A 2YEMA 3IU6A 1WEVA 3T7LA 5I1QA 4WHUA 4IC2A 4YYHA 4TZ2A 5A7CA 1WEPA 3UV4A 4YYJA 4UYHA 4IR3A 4BW3A 1Z60A 5B79A 4QBMA 5LKTA 5FE9A 5FE5A 5ETBA 5HQ7A 4L7XA 2IDAA 3N9PA 5CUBA 5EGUA 2VJEA 5CFWA 4MVTA 4QSPA 4YYIA 2CSZA 2KGIA 4OUFA 4A9HA 2Y1NA 4QC3A 2KREA 4PCIA 4QSWA 5CQ4A 2VNFA 4UP0A 5CQ5A 4LRGA 5CUCA 5HRWA 4QUUA 5FE1A 3U5LA 2DWWA 5CU8A 2OUOA 1HYJA 2EGPA 4V3LC 3ZNIA 4UP5A 2M6MA 4HBXA 3P1DA 1F62A 2AN6A 5A81A 4L58A 4YC9A 5KH3A 4QY4A 2LQ6A 3C6WA 5ENCA 1IYMA 2D9EA 4R2YA 4CUQA 1WILA 4NR8A 3ONIA 5D1LB 5E9LA 4S3OB 4NRCA 5II1A 5LJ2A 4PTBA 1X4IA 5FFWA 1WENA 2M85A 4C9ZA 4A9KA 4LZRA 2E7OA 4XUAA 5DFBA 4CFKA 5C8GA 3SHBA 5ENJA 3UVWA 3PURA 4AP4A 3V43A 4QC1A 3S91A 3G0LA 4F52B 5A82A 1WESA 4C67A 5E3GA 5KO4A 5DW1A 3FKMX 2MIQA 5EWHA 5FE4A 3GV4A 5DINA 3VK6A 2Y43A 5CRZA 5CQ6A 4QEVA 5CTLA 2MA5A 5EWWA 4J3IA 4OGIA 3P1FA 1N87A 4LYIA 4WZ0A 4TT6A 5TDRA 2YW8A 5E9KA 2DVRA 2YQLA 3N9QA 4Q0OA 5EM3A 5CQ8A 5E9MA 5FE8A 2HYED 4LLBA 1BORA 3RPGC 2ZETC 4Y03A 5F3AA 3MB3A 3SVHA 1ZS5A 2PNXA 5E74A 5DKAA 2FUIA 2ECGA 2QIZA 4PCEA 5I7YA 2H0DB 3LQIA 4I7BA 4TS8A 5EISA 1WFKA 4J0RA 3MB4A 4KV4A 4TZ8A 5EP7A 2G6QA 5DYCA 4YYGA 3GL6A 5EPSA 5FE0A 4AVXA 3O36A 5B78A 5TB6A 4B86C 2YHOA 2RS9B 3KNVA 3N9LA 3HMEA 2RNWA 2EODA 4QUTA 5FB0A 3UVYA 4ZDTA 3HCSA 4QSQA 2KE1A 2YSMA 4CCGX 2R0VA 5AD3A 4MR6A 2VJFB 5CPEA 4A9JA 5D1MB 5C4QA 4MR5A 5KU3A 4LYWA 2MNYA 2YSJA 3Q2EA 2L5UA 5L8TA 3LRQA 3G0JA 2YT5A 4LR6A 5LJ1A 5AITA 5I86A 3QZVA 5DFCA 1WEEA 4C66A 4FO9A 4NQMA 4GNDA 4CLBA 1DVPA 5CQ3A 4GNGA 1ZBDB 4R7EA 5FG4A 4O64A 4FJCA 4Q6FA 4UYEA 2I7KA 2YDWA 5J0DA 4IR6A 5EICA 2GRCA 5I40A 1FBVA 2MD7B 4LADB 4IORA 3UV2A 3MHSA 4A9OA 3MULA 4IOQA 3LJWA 5TCMA 3O35A 4A4CA 2I50A 1MM3A 4MR4A 2LSPB 5CUDA 5FH8A 1CHCA 3KQIA 4LZSA 4Z6IA 2MT5A 2CT2A 5E9YA 3N9OA 2YELA 3P5OA 4YYMA 2EA6A 4YATA 3HMFA 3MHHA 2L85A 5A5RA 2YU4A 4BW4A 2E7NA 2G43A 4O74A 5E3DA 3L1XA 4KCXA 5FG5A 4BW2A 1E4UA 2WP1A 5HENA 5AD2A 4XUBA 4ALGA 2CKLB 5DFDA 2QJ0A 5FERA 5D3PA 4IOOA 4AYCA 5CP5A 5DY7A 5EI4A 4J1PA 2F6JA 4N4IA 4IR5A 5C7NA 2K1JA 4Z6HA 2LV9A 4W4UA 5II2A 5COIA 5FFYA 2L84A 4YAXA 2LXHC 4MSXA 5DYXA 5C11A 4A9MA 5H1TA 1MM2A 5DKCA 5HRVA 3N9MA 3UW9A 2M3HA 3UV5A 4UIUA 5DYUA 4S3OC 1Z6UA 1T1HA 5F1LA 5IGKA 5A5SA 4QSSA 5A83A 4QR4A 1F68A 4NUDA 5JG6A 1HYIA 5TDWA 3SOWA 2L43A 3HTKC 5D3NA 2QICA 2VPDA 5D3JA 5HQ6A 4PPEA 1JM7B 5H1VA 5FEYA 5CS8A 2WP2A 5ENBA 4O71A 4TKPB 1N72A 4YYKA 4ZQLA 3MQMA 1K2FA 3PUQA 3UVDA 5LCWB 4YH3A 5A85A 3N9NA 3MXFA 5B75A 5ENGA 3TLPA 2RFJA 4NQNA 5CQ7A 5BT5A 1LDKC 2ECIA 3Q2FA 5HJCA 4KV1A 3DQVR 4YBTA 5F1HA 5G04B 3KV5A 1WEUA 4Z1QA 4NR9A 4UIXA 2VJEB 1WE9A 5EA1A 4CUPA 4UIVA 4UI9B 2VPBA 5IGNA 2H0DA 4GNFA 2MA6A 2C2VS 1JOCA 4NUEA 4O78A 5DW2A 4QF3A 4ZW1A 5F25A 4HBVA 5D3RA 4UITA 3GG3A 2PUYA 5ACYA 4MENA 3D7CA 3LQHA 1JSPB 5I88A 5E73A 2FSAA 3NXBA 4XYAA 5LJ0A 3AQAA 5F60A 4NR5A 5CQTA 3HCUA 4O7FA 4YADA 4TT2A 3EB5A 4I7DA 5IG6A 4QSXA 4LYSA 5LKXA 5LUUA 4O75A 3U5JA 1X4JA 2ECTA 3I3JA 4GB0A 1WEQA 5JI8A 3JVMA 4HXMA 5E9IA 1WGMA 4NRAA 5C13A 5CZGA 5LVRA 4CL9A 5CRMA 4CURA 4FK5A 2G45A 4WZ2A 5EK9A 4Z93A 2R0SA 4UYFA 4BJXA 2HDPA 3ZTGA 2DKWA 3ZYQA 4TQNA 2JMDA 2VPEA 4DONA 4NUCA 5I80A 5D24A 2K4DA 3QZTA 2YW5A 1VYXA 2KGGA 3ZPVE 4NRBA 4PKLA 4QYLA 5EPRA 3U5KA 2L75A 3O70A 4TTEA 4YY6A 4YBSA 5DX4A 2F42A 5TRBA 2MD8C 2FUUA 3RTRB 4B7YC 5FE3A 4QEUA 2VP7A 4BHWA 5EV9A 2H60A 5KTWA 2L5EA 3ASLA 4WHWA 2YYNA 1U6GB 2I8NA 4GNEA 4CUTA 2RSDA 3T6RA 4NYWA 4CUUA 2M1RA 3IHPA 4QSRA 4QEWA 4A9NA 4YBMA 5LVQA 4YABA 4WIVA 2KYUA 5ENHA 5DKHA 1V87A 4MEOA 3S92A 2NXBA 2YUCA 5L99A 5CQAA 3DAIA 2LRIC 5HELA 5FFVA 4FIPA 5L8UA 5IGMA 4XI1A 5HLSA 2DVVA 4NYVA 2DX8A 4CFLA 5BT4A 5AMEA 3UVXA 4UIZA 4MEPA 3LQJA 5C85A 5D3HA 4NN2A 2N9GA 2KIZA 2LGVA 4LK9A 5BT3A 5CUGA 2NAAA 5HEMA 2C2LA 3L1ZB 4HXSA 2MJVB 3PHDA 4LDFA 3P1EA 3SOUA 5FE7A 3JVJA 4X3GA 3O34A 5I3LA 3ZVZB 4ZC9A 5I89A 3JVLA 5B77A 4Z1SA 4N4GA 5C87A 2Y1MA 4QB3A 4UIYA 5FE6A 5HRXA 4P5OB 4QYDA 5D3SA 1JM4B 4QF2A 3O7AA 1JM7A 5IIDA 4PS5A 5C89A 5D0CA 4LJNA 5FH6A 3P1CA 4A9FA 4OGJA 4XY9A 2LGLA 3HCTA 2VPGA 4QR5A 2YYRA 4A9LA 2MUMA 5EWVA 5E0RA 5HM0A 3U5OA 5H1UA 5KH9A 3AADA 4QZSA 2YREA 5FDZA 4HXKA 5D7XA 5F61A 4NR6A 5L96A 5HQ5A 2ECWA 5DKDA 4N4FA 5L97A 2OO1A 5K29A 2ECNA 2RNYA 5KTUA 4R8PK 5F63A 4PY6A 3RCWA 1E6IA 1WEOA 5ENIA 4LZ2A 4HBYA 2LGKA 5EU1A 4HXPA 5A5OA 1X4UA 1LDJB 4X2IA 3O33A 2K16A 4TYLA 5IBNA 2OXQC 3KV6A 5CGPA 4N4HA 2JMJA 2JMIA 4RVRA 2RO1A 5I7XA 4IR4A 2E6RA 5LKUA 3SVGA 3M63A 2CSYA 2DVSA 5CY9A 2D82A 5H9MA 5KH7A 4NYXA 4O76A 2LN0A 3ZVYA 4AYCB 2RI7A 4O72A 4Q0NA 5FG6A 2KWOA 4YYNA 4CUSA 4NR4A 5AIUA 4QSTA 4E96A 4LKAA 4NS5A 5G4RA 2UZGA 5FE2A 4HBWA 5F5ZA 1RMDA 3C5KA 4HXLA 3HMHA 5FBXA 2VJFA 3DPLR 2G4AA 4AUQB 4BW1A 5B8DA 5EPBA 5HCLA 2OSSA 4LC2A 2KWKA 3SOXA 3SVFA 4YYDA 3ZPV1 4YY4A 2MNZA 4F3IA 2YEKA 2DATA 4WA6A 4A4BA 5EWCA 5F62A 3NG2A 2YQMA 2KFTA 5E7DA 5J3XA 2R10A 5A5QA 5HFRA 5JWMA 5HFQA 4V3KC 3LXJA 5D25A 4CA1A 5EQ1A 1WIMA 5LKZA 2KR4A 1XWHA 2KWNA 3M99A 5D1KB 3U5PA 4YH4A 5DBMA 2ECJA 5F36A 4HXOA 1VFYA 3MUKA 4J0SA 5ETDA 3RPGB 3U5NA 3DWYA 4N3WA 2JRJA 4A9IA 5IGLA 4HXNA 5H85A 3O37A 1WUGA 3JVKA 4A0CD 5AMFA 3I2DA 3U5MA 4UYGA 1VD4A 1Z2QA 2KWJA 4I7CA 2D8SA 5EYAF 2BAYA 4HXRA 5A5NA 5I83A 5D3TA 5ENFA 4O7AA 2YURA 3EB6A 4O77A 4WZ3B 5CUAA 5G0FA 4UIWA 2F6NA 4ZUXU 2E6SA 4QNSA 5A5PA 5E9VA 5G4SA 5KTXA 4YK0A 4NR7A 2LDRA 4A49A 3K2JA 5I29A 2R0YA 4GPJA 4IC3A 5EVAA 5DLXA 2CKLA 2XB1A 5ENEA 3ZYUA 5F2PA 4O70A 4UYDA 5D26A 5DLZA 2DVQA
chains in the Genus database with same CATH superfamily
5CUEA 5D3LA 3IU5A 5FH7A 4O62A 4O7EA 2K17A 4QR3A 4AKNA 4UYFB 5TABA 1EQFA 1WUMA 1WEMA 2XEUA 4O7CA 4MR3A 4QSVA 2KTBB 2RNXA 5B76A 1WEWA 2LXPC 4MEQA 5L98A 2JUNA 2YQDA 5G05B 4QSUA 4XY8A 4O7BA 3QZSA 4ALHA 5DYAA 4NXJA 2LGGA 2YHNA 4BBQA 5FB1A 2ECVA 5EWDA 2L80A 4A9EA 1FP0A 1X0JA 3L11A 3M62A 2E3KA 5KHMA 2KU3A 4TU6A 5TBNA 4TU4A 2L0BA 4TT4A 4FLPA 3FL2A 1G25A 2YEMA 3IU6A 1WEVA 3T7LA 5I1QA 4WHUA 4IC2A 4YYHA 4TZ2A 5A7CA 1WEPA 3UV4A 4YYJA 4UYHA 4IR3A 4BW3A 1Z60A 5B79A 4QBMA 5LKTA 2D8UA 5FE9A 5FE5A 5ETBA 5HQ7A 4L7XA 2IDAA 3N9PA 5CUBA 5EGUA 2VJEA 5CFWA 4MVTA 4QSPA 4YYIA 2CSZA 2KGIA 4OUFA 4A9HA 2Y1NA 4QC3A 2KREA 4PCIA 4QSWA 5CQ4A 2VNFA 4UP0A 5CQ5A 4LRGA 5CUCA 5HRWA 4QUUA 1PUOA 5FE1A 3U5LA 2DWWA 5CU8A 2OUOA 1HYJA 2EGPA 4V3LC 3ZNIA 2LAUA 4UP5A 2M6MA 4HBXA 3P1DA 1F62A 2AN6A 5A81A 3T9KA 4L58A 4YC9A 5KH3A 4QY4A 2LQ6A 3C6WA 5ENCA 1IYMA 2D9EA 4R2YA 4CUQA 1WILA 4NR8A 3ONIA 5D1LB 1MBMA 5E9LA 4S3OB 4NRCA 5II1A 5LJ2A 4PTBA 1X4IA 5FFWA 1WENA 2M85A 4C9ZA 4A9KA 3LVQE 4LZRA 2E7OA 4XUAA 5DFBA 4CFKA 5C8GA 3SHBA 5ENJA 3UVWA 3PURA 4AP4A 3V43A 4QC1A 3S91A 3G0LA 4F52B 5A82A 1WESA 4C67A 2KKXA 5E3GA 5KO4A 5DW1A 3FKMX 2MIQA 5EWHA 5FE4A 3GV4A 5DINA 3VK6A 2Y43A 5CRZA 5CQ6A 4QEVA 5CTLA 2MA5A 5EWWA 4J3IA 3DWDA 4OGIA 3P1FA 1N87A 4LYIA 4WZ0A 4TT6A 5TDRA 2YW8A 5E9KA 2DVRA 2YQLA 3N9QA 4Z0RA 4Q0OA 5EM3A 5CQ8A 1DCQA 5E9MA 5FE8A 2HYED 3FJUB 4Z0OA 4LLBA 1BORA 3RPGC 2ZETC 4Y03A 5F3AA 3MB3A 5SVXA 3SVHA 1ZS5A 2PNXA 5E74A 5DKAA 2FUIA 2ECGA 2QIZA 4PCEA 5I7YA 2H0DB 3LDYA 3LQIA 4I7BA 2E61A 3LJUX 4TS8A 5EISA 1WFKA 4J0RA 3MB4A 4KV4A 4TZ8A 5EP7A 2G6QA 5DYCA 4YYGA 3GL6A 5EPSA 5FE0A 4AVXA 3O36A 5B78A 5TB6A 4B86C 2YHOA 2RS9B 3KNVA 3N9LA 3HMEA 2RNWA 2EODA 4QUTA 5FB0A 3UVYA 4H9DA 4ZDTA 3HCSA 4QSQA 2KE1A 2YSMA 4CCGX 2R0VA 5AD3A 4MR6A 2VJFB 5CPEA 4A9JA 5D1MB 5C4QA 4MR5A 5KU3A 4LYWA 3KDEC 2MNYA 2CSVA 3Q2EA 2L5UA 5L8TA 2YSJA 3G0JA 3LRQA 2YT5A 4LR6A 5LJ1A 5AITA 5I86A 3QZVA 5DFCA 1WEEA 4C66A 4FO9A 4F1PA 4NQMA 4GNDA 2RR4A 4CLBA 1DVPA 5CQ3A 4GNGA 3D1BA 1ZBDB 4R7EA 5FG4A 4O64A 4FJCA 5SVIA 4Q6FA 4UYEA 2I7KA 2YDWA 5J0DA 4IR6A 5EICA 2GRCA 5I40A 1FBVA 2MD7B 4LADB 4IORA 3UV2A 3MHSA 4OGCA 4A9OA 3MULA 4IOQA 3LJWA 5TCMA 3O35A 4A4CA 2I50A 1MM3A 4MR4A 2LSPB 5CUDA 5FH8A 1CHCA 3KQIA 4LZSA 4Z6IA 2MT5A 2CT2A 5E9YA 3N9OA 2YELA 3P5OA 2CRRA 4YYMA 2EA6A 4YATA 3FM8C 3HMFA 3MHHA 2L85A 5A5RA 2YU4A 3DDTA 4BW4A 2E7NA 2G43A 4O74A 5E3DA 3L1XA 2IQJA 4KCXA 5FG5A 4BW2A 1E4UA 4AKIA 2WP1A 5HENA 5AD2A 4XUBA 4ALGA 2CKLB 5DFDA 2QJ0A 5FERA 5D3PA 4IOOA 4AYCA 5CP5A 5SVYA 5DY7A 5EI4A 4J1PA 2F6JA 4N4IA 4IR5A 5C7NA 2K1JA 4Z6HA 2LV9A 4W4UA 5II2A 5COIA 5FFYA 2L84A 4YAXA 2LXHC 4MSXA 5DYXA 5C11A 4A9MA 5H1TA 1MM2A 5DKCA 5HRVA 2FFWA 3N9MA 3UW9A 2M3HA 3UV5A 4UIUA 5DYUA 2FD4A 4S3OC 1Z6UA 1T1HA 5F1LA 5IGKA 5A5SA 4QSSA 5A83A 4QR4A 1F68A 4NUDA 5JG6A 1HYIA 3H7HA 5TDWA 2CONA 3SOWA 2L43A 3HTKC 5D3NA 2QICA 2VPDA 5D3JA 5HQ6A 4PPEA 1JM7B 3FANA 5H1VA 5FEYA 5CS8A 2WP2A 5ENBA 4O71A 2YVRA 4TKPB 4AKHA 1N72A 4YYKA 4ZQLA 3MQMA 1K2FA 3PUQA 3UVDA 5LCWB 4YH3A 3VKGA 5A85A 3N9NA 3MXFA 5B75A 5ENGA 3TLPA 2RFJA 4NQNA 5CQ7A 5BT5A 1LDKC 2ECIA 3Q2FA 5HJCA 4KV1A 3DQVR 4YBTA 5F1HA 5G04B 3KV5A 1WEUA 4Z1QA 4NR9A 4UIXA 2EXUA 1WE9A 5EA1A 4CUPA 4UIVA 2VJEB 4UI9B 2VPBA 5IGNA 2H0DA 4GNFA 2MA6A 2C2VS 1JOCA 4NUEA 4O78A 5DW2A 4QF3A 4ZW1A 5F25A 4HBVA 5D3RA 4UITA 3GG3A 2PUYA 5ACYA 4MENA 3D7CA 3LQHA 1JSPB 5I88A 5E73A 3VKHA 2FSAA 3NXBA 4XYAA 5LJ0A 3ERRA 3AQAA 5F60A 4NR5A 5CQTA 3FEHA 3HCUA 4O7FA 4YADA 4TT2A 3EB5A 4I7DA 5IG6A 4QSXA 4LYSA 5LKXA 5LUUA 4O75A 3U5JA 1X4JA 2ECTA 3I3JA 4GB0A 1WEQA 5JI8A 3JVMA 4HXMA 5E9IA 1WGMA 4NRAA 5C13A 5CZGA 5LVRA 4CL9A 5CRMA 4CURA 4FK5A 2G45A 4WZ2A 5EK9A 2R0SA 4UYFA 4Z93A 4BJXA 2HDPA 3Q1DA 2DKWA 3ZTGA 3ZYQA 4TQNA 2JMDA 2VPEA 4DONA 4NUCA 5I80A 5D24A 2K4DA 2EGMA 3QZTA 2YW5A 3D1DA 1VYXA 2KGGA 3ZPVE 4NRBA 4PKLA 4QYLA 4AKGA 5EPRA 3U5KA 2L75A 3O70A 4TTEA 4YY6A 4YBSA 5DX4A 2F42A 5TRBA 2MD8C 2FUUA 3RTRB 4B7YC 4AI6A 5FE3A 4QEUA 2VP7A 4BHWA 5EV9A 2H60A 5KTWA 2L5EA 3ASLA 4WHWA 2YYNA 1U6GB 2I8NA 3JUEA 4GNEA 2KKYA 4CUTA 2RSDA 3T6RA 4NYWA 4CUUA 2M1RA 3IHPA 4QSRA 4QEWA 4A9NA 4YBMA 5LVQA 4YABA 4WIVA 2KYUA 5ENHA 5DKHA 1V87A 4MEOA 3S92A 2NXBA 2YUCA 5L99A 5CQAA 2DJAA 3DAIA 2LRIC 2XOYA 3LVRE 5HELA 5FFVA 4FIPA 5L8UA 5IGMA 4XI1A 5HLSA 2DVVA 4NYVA 2DX8A 4CFLA 5BT4A 5AMEA 3UVXA 3O47A 4UIZA 4MEPA 3LQJA 5C85A 5D3HA 4NN2A 2N9GA 2KIZA 2LGVA 3FAOA 4LK9A 5BT3A 5CUGA 2NAAA 5HEMA 2C2LA 3L1ZB 4HXSA 2MJVB 3PHDA 4LDFA 3P1EA 3SOUA 5FE7A 3JVJA 4X3GA 3O34A 5I3LA 2MKEA 3ZVZB 4ZC9A 3M7KA 5I89A 3JVLA 5B77A 4Z1SA 4N4GA 5C87A 3PLWA 2Y1MA 4QB3A 5K3QA 4UIYA 5FE6A 5HRXA 4P5OB 4QYDA 5D3SA 1JM4B 2M13A 4QF2A 3O7AA 1JM7A 5IIDA 4PS5A 5C89A 5D0CA 2CRWA 2XOCA 4LJNA 3SUBA 5FH6A 3P1CA 4A9FA 4OGJA 4XY9A 2LGLA 3HCTA 2VPGA 4QR5A 2YYRA 5SVIB 4A9LA 2MUMA 5EWVA 5E0RA 5HM0A 3U5OA 5H1UA 5KH9A 3AADA 4QZSA 2YREA 5FDZA 4HXKA 5D7XA 5F61A 4NR6A 5L96A 5HQ5A 2ECWA 5DKDA 4N4FA 5L97A 2OO1A 5K29A 2ECNA 2RNYA 5KTUA 4R8PK 5F63A 4PY6A 3RCWA 2B0OE 1E6IA 1WEOA 5ENIA 4LZ2A 4HBYA 2LGKA 5EU1A 4HXPA 5A5OA 2XP0A 1X4UA 1LDJB 4X2IA 3O33A 2K16A 4TYLA 5IBNA 2OXQC 3KV6A 5CGPA 4N4HA 2JMJA 2JMIA 4RVRA 2RO1A 5I7XA 4IR4A 2E6RA 5LKUA 3SVGA 3M63A 2CSYA 2DVSA 5CY9A 2D82A 5H9MA 5KH7A 4NYXA 4O76A 2LN0A 3ZVYA 4AYCB 2RI7A 4O72A 4Q0NA 5FG6A 2KWOA 2DSMA 4YYNA 3E2DA 4CUSA 4NR4A 5AIUA 4QSTA 4E96A 4LKAA 4QQ4A 4NS5A 5G4RA 2UZGA 5FE2A 4HBWA 5F5ZA 1RMDA 3C5KA 2XOZA 4HXLA 3HMHA 5FBXA 2VJFA 3DPLR 2G4AA 4AUQB 4BW1A 5B8DA 5EPBA 5HCLA 2OSSA 4LC2A 2KWKA 3SOXA 3SVFA 1ZKRA 4YYDA 3ZPV1 4YY4A 2MNZA 4F3IA 2YEKA 2DATA 4WA6A 4A4BA 5EWCA 5F62A 3NG2A 2YQMA 2KFTA 5E7DA 5J3XA 2R10A 5A5QA 5HFRA 5JWMA 5HFQA 4V3KC 3LXJA 5D25A 4CA1A 5EQ1A 1WIMA 5LKZA 2KR4A 1XWHA 2KWNA 2L7PA 3M99A 4OGEA 5D1KB 3U5PA 4YH4A 5DBMA 2JM3A 2ECJA 5F36A 4HXOA 1VFYA 3MUKA 4J0SA 5ETDA 3RPGB 3U5NA 3DWYA 4N3WA 2JRJA 4A9IA 5IGLA 4HXNA 5H85A 3O37A 1WUGA 3JVKA 3MDBC 4A0CD 5AMFA 3I2DA 3U5MA 4UYGA 1VD4A 1Z2QA 2KWJA 4I7CA 2D8SA 5EYAF 2BAYA 4HXRA 5A5NA 5I83A 5D3TA 5ENFA 4O7AA 2YURA 3EB6A 4O77A 4WZ3B 5CUAA 5G0FA 4UIWA 2F6NA 4ZUXU 2E6SA 4QNSA 2P57A 5A5PA 5E9VA 5G4SA 5KTXA 4YK0A 4NR7A 2LDRA 4A49A 3K2JA 5I29A 2R0YA 4GPJA 4IC3A 5EVAA 2EJNA 5DLXA 2CKLA 2XB1A 2OWAA 5ENEA 3ZYUA 5F2PA 4O70A 4UYDA 5D26A 5DLZA 2DVQA
chains in the Genus database with same CATH topology
5CUEA 5D3LA 3IU5A 5FH7A 4O7EA 2K17A 4QR3A 4AKNA 4UYFB 5TABA 1EQFA 1WUMA 1WEMA 2XEUA 4O7CA 4MR3A 4QSVA 2KTBB 2RNXA 5B76A 1WEWA 2LXPC 4MEQA 5L98A 2YQDA 5G05B 4QSUA 4XY8A 4O7BA 3QZSA 4ALHA 5DYAA 4NXJA 2LGGA 2YHNA 4BBQA 5FB1A 2ECVA 5EWDA 2L80A 4A9EA 1FP0A 1X0JA 3L11A 3M62A 2E3KA 5KHMA 2KU3A 4TU6A 5TBNA 4TU4A 2L0BA 4TT4A 4FLPA 3FL2A 1G25A 2YEMA 3IU6A 1WEVA 3T7LA 5I1QA 4WHUA 4IC2A 4YYHA 4TZ2A 5A7CA 1WEPA 3UV4A 4YYJA 4UYHA 4IR3A 4BW3A 1Z60A 5B79A 4QBMA 5LKTA 5FE9A 5FE5A 5ETBA 5HQ7A 4L7XA 2IDAA 3N9PA 5CUBA 5EGUA 2VJEA 5CFWA 4MVTA 4QSPA 4YYIA 2CSZA 2KGIA 4OUFA 4A9HA 2Y1NA 4QC3A 2KREA 4PCIA 4QSWA 5CQ4A 2VNFA 4UP0A 5CQ5A 4LRGA 5CUCA 5HRWA 4QUUA 5FE1A 3U5LA 2DWWA 5CU8A 2OUOA 1HYJA 2EGPA 4V3LC 3ZNIA 4UP5A 2M6MA 4HBXA 3P1DA 1F62A 2AN6A 5A81A 4L58A 4YC9A 5KH3A 4QY4A 2LQ6A 3C6WA 5ENCA 1IYMA 2D9EA 4R2YA 4CUQA 1WILA 4NR8A 3ONIA 5D1LB 5E9LA 4S3OB 4NRCA 5II1A 5LJ2A 4PTBA 1X4IA 5FFWA 1WENA 2M85A 4C9ZA 4A9KA 4LZRA 2E7OA 4XUAA 5DFBA 4CFKA 5C8GA 3SHBA 5ENJA 3UVWA 3PURA 4AP4A 3V43A 4QC1A 3S91A 3G0LA 4F52B 5A82A 1WESA 4C67A 5E3GA 5KO4A 5DW1A 3FKMX 2MIQA 5EWHA 5FE4A 3GV4A 5DINA 3VK6A 2Y43A 5CRZA 5CQ6A 4QEVA 5CTLA 2MA5A 5EWWA 4J3IA 4OGIA 3P1FA 1N87A 4LYIA 4WZ0A 4TT6A 5TDRA 2YW8A 5E9KA 2DVRA 2YQLA 3N9QA 4Q0OA 5EM3A 5CQ8A 5E9MA 5FE8A 2HYED 4LLBA 1BORA 3RPGC 2ZETC 4Y03A 5F3AA 3MB3A 3SVHA 1ZS5A 2PNXA 5E74A 5DKAA 2FUIA 2ECGA 2QIZA 4PCEA 5I7YA 2H0DB 3LQIA 4I7BA 4TS8A 5EISA 1WFKA 4J0RA 3MB4A 4KV4A 4TZ8A 5EP7A 2G6QA 5DYCA 4YYGA 3GL6A 5EPSA 5FE0A 4AVXA 3O36A 5B78A 5TB6A 4B86C 2YHOA 2RS9B 3KNVA 3N9LA 3HMEA 2RNWA 2EODA 4QUTA 5FB0A 3UVYA 4ZDTA 3HCSA 4QSQA 2KE1A 2YSMA 4CCGX 2R0VA 5AD3A 4MR6A 2VJFB 5CPEA 4A9JA 5D1MB 5C4QA 4MR5A 5KU3A 4LYWA 2MNYA 2YSJA 3Q2EA 2L5UA 5L8TA 3LRQA 3G0JA 2YT5A 4LR6A 5LJ1A 5AITA 5I86A 3QZVA 5DFCA 1WEEA 4C66A 4FO9A 4NQMA 4GNDA 4CLBA 1DVPA 5CQ3A 4GNGA 1ZBDB 4R7EA 5FG4A 4O64A 4FJCA 4Q6FA 4UYEA 2I7KA 2YDWA 5J0DA 4IR6A 5EICA 2GRCA 5I40A 1FBVA 2MD7B 4LADB 4IORA 3UV2A 3MHSA 4A9OA 3MULA 4IOQA 3LJWA 5TCMA 3O35A 4A4CA 2I50A 1MM3A 4MR4A 2LSPB 5CUDA 5FH8A 1CHCA 3KQIA 4LZSA 4Z6IA 2MT5A 2CT2A 5E9YA 3N9OA 2YELA 3P5OA 4YYMA 2EA6A 4YATA 3HMFA 3MHHA 2L85A 5A5RA 2YU4A 4BW4A 2E7NA 2G43A 4O74A 5E3DA 3L1XA 4KCXA 5FG5A 4BW2A 1E4UA 2WP1A 5HENA 5AD2A 4XUBA 4ALGA 2CKLB 5DFDA 2QJ0A 5FERA 5D3PA 4IOOA 4AYCA 5CP5A 5DY7A 5EI4A 4J1PA 2F6JA 4N4IA 4IR5A 5C7NA 2K1JA 4Z6HA 2LV9A 4W4UA 5II2A 5COIA 5FFYA 2L84A 4YAXA 2LXHC 4MSXA 5DYXA 5C11A 4A9MA 5H1TA 1MM2A 5DKCA 5HRVA 3N9MA 3UW9A 2M3HA 3UV5A 4UIUA 5DYUA 4S3OC 1Z6UA 1T1HA 5F1LA 5IGKA 5A5SA 4QSSA 5A83A 4QR4A 1F68A 4NUDA 5JG6A 1HYIA 5TDWA 3SOWA 2L43A 3HTKC 5D3NA 2QICA 2VPDA 5D3JA 5HQ6A 4PPEA 1JM7B 5H1VA 5FEYA 5CS8A 2WP2A 5ENBA 4O71A 4TKPB 1N72A 4YYKA 4ZQLA 3MQMA 1K2FA 3PUQA 3UVDA 5LCWB 4YH3A 5A85A 3N9NA 3MXFA 5B75A 5ENGA 3TLPA 2RFJA 4NQNA 5CQ7A 5BT5A 1LDKC 2ECIA 3Q2FA 5HJCA 4KV1A 3DQVR 4YBTA 5F1HA 5G04B 3KV5A 1WEUA 4Z1QA 4NR9A 4UIXA 2VJEB 1WE9A 5EA1A 4CUPA 4UIVA 4UI9B 2VPBA 5IGNA 2H0DA 4GNFA 2MA6A 2C2VS 1JOCA 4NUEA 4O78A 5DW2A 4QF3A 4ZW1A 5F25A 4HBVA 5D3RA 4UITA 3GG3A 2PUYA 5ACYA 4MENA 3D7CA 3LQHA 1JSPB 5I88A 5E73A 2FSAA 3NXBA 4XYAA 5LJ0A 3AQAA 5F60A 4NR5A 5CQTA 3HCUA 4O7FA 4YADA 4TT2A 3EB5A 4I7DA 5IG6A 4QSXA 4LYSA 5LKXA 5LUUA 4O75A 3U5JA 1X4JA 2ECTA 3I3JA 4GB0A 1WEQA 5JI8A 3JVMA 4HXMA 5E9IA 1WGMA 4NRAA 5C13A 5CZGA 5LVRA 4CL9A 5CRMA 4CURA 4FK5A 2G45A 4WZ2A 5EK9A 4Z93A 2R0SA 4UYFA 4BJXA 2HDPA 3ZTGA 2DKWA 3ZYQA 4TQNA 2JMDA 2VPEA 4DONA 4NUCA 5I80A 5D24A 2K4DA 3QZTA 2YW5A 1VYXA 2KGGA 3ZPVE 4NRBA 4PKLA 4QYLA 5EPRA 3U5KA 2L75A 3O70A 4TTEA 4YY6A 4YBSA 5DX4A 2F42A 5TRBA 2MD8C 2FUUA 3RTRB 4B7YC 5FE3A 4QEUA 2VP7A 4BHWA 5EV9A 2H60A 5KTWA 2L5EA 3ASLA 4WHWA 2YYNA 1U6GB 2I8NA 4GNEA 4CUTA 2RSDA 3T6RA 4NYWA 4CUUA 2M1RA 3IHPA 4QSRA 4QEWA 4A9NA 4YBMA 5LVQA 4YABA 4WIVA 2KYUA 5ENHA 5DKHA 1V87A 4MEOA 3S92A 2NXBA 2YUCA 5L99A 5CQAA 3DAIA 2LRIC 5HELA 5FFVA 4FIPA 5L8UA 5IGMA 4XI1A 5HLSA 2DVVA 4NYVA 2DX8A 4CFLA 5BT4A 5AMEA 3UVXA 4UIZA 4MEPA 3LQJA 5C85A 5D3HA 4NN2A 2N9GA 2KIZA 2LGVA 4LK9A 5BT3A 5CUGA 2NAAA 5HEMA 2C2LA 3L1ZB 4HXSA 2MJVB 3PHDA 4LDFA 3P1EA 3SOUA 5FE7A 3JVJA 4X3GA 3O34A 5I3LA 3ZVZB 4ZC9A 5I89A 3JVLA 5B77A 4Z1SA 4N4GA 5C87A 2Y1MA 4QB3A 4UIYA 5FE6A 5HRXA 4P5OB 4QYDA 5D3SA 1JM4B 4QF2A 3O7AA 1JM7A 5IIDA 4PS5A 5C89A 5D0CA 4LJNA 5FH6A 3P1CA 4A9FA 4OGJA 4XY9A 2LGLA 3HCTA 2VPGA 4QR5A 2YYRA 4A9LA 2MUMA 5EWVA 5E0RA 5HM0A 3U5OA 5H1UA 5KH9A 3AADA 4QZSA 2YREA 5FDZA 4HXKA 5D7XA 5F61A 4NR6A 5L96A 5HQ5A 2ECWA 5DKDA 4N4FA 5L97A 2OO1A 5K29A 2ECNA 2RNYA 5KTUA 4R8PK 5F63A 4PY6A 3RCWA 1E6IA 1WEOA 5ENIA 4LZ2A 4HBYA 2LGKA 5EU1A 4HXPA 5A5OA 1X4UA 1LDJB 4X2IA 3O33A 2K16A 4TYLA 5IBNA 2OXQC 3KV6A 5CGPA 4N4HA 2JMJA 2JMIA 4RVRA 2RO1A 5I7XA 4IR4A 2E6RA 5LKUA 3SVGA 3M63A 2CSYA 2DVSA 5CY9A 2D82A 5H9MA 5KH7A 4NYXA 4O76A 2LN0A 3ZVYA 4AYCB 2RI7A 4O72A 4Q0NA 5FG6A 2KWOA 4YYNA 4CUSA 4NR4A 5AIUA 4QSTA 4E96A 4LKAA 4NS5A 5G4RA 2UZGA 5FE2A 4HBWA 5F5ZA 1RMDA 3C5KA 4HXLA 3HMHA 5FBXA 2VJFA 3DPLR 2G4AA 4AUQB 4BW1A 5B8DA 5EPBA 5HCLA 2OSSA 4LC2A 2KWKA 3SOXA 3SVFA 4YYDA 3ZPV1 4YY4A 2MNZA 4F3IA 2YEKA 2DATA 4WA6A 4A4BA 5EWCA 5F62A 3NG2A 2YQMA 2KFTA 5E7DA 5J3XA 2R10A 5A5QA 5HFRA 5JWMA 5HFQA 4V3KC 3LXJA 5D25A 4CA1A 5EQ1A 1WIMA 5LKZA 2KR4A 1XWHA 2KWNA 3M99A 5D1KB 3U5PA 4YH4A 5DBMA 2ECJA 5F36A 4HXOA 1VFYA 3MUKA 4J0SA 5ETDA 3RPGB 3U5NA 3DWYA 4N3WA 2JRJA 4A9IA 5IGLA 4HXNA 5H85A 3O37A 1WUGA 3JVKA 4A0CD 5AMFA 3I2DA 3U5MA 4UYGA 1VD4A 1Z2QA 2KWJA 4I7CA 2D8SA 5EYAF 2BAYA 4HXRA 5A5NA 5I83A 5D3TA 5ENFA 4O7AA 2YURA 3EB6A 4O77A 4WZ3B 5CUAA 5G0FA 4UIWA 2F6NA 4ZUXU 2E6SA 4QNSA 5A5PA 5E9VA 5G4SA 5KTXA 4YK0A 4NR7A 2LDRA 4A49A 3K2JA 5I29A 2R0YA 4GPJA 4IC3A 5EVAA 5DLXA 2CKLA 2XB1A 5ENEA 3ZYUA 5F2PA 4O70A 4UYDA 5D26A 5DLZA 2DVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUE A;  5D3L A;  3IU5 A;  5FH7 A;  4O7E A;  2K17 A;  4QR3 A;  4AKN A;  4UYF B;  5TAB A;  1EQF A;  1WUM A;  1WEM A;  2XEU A;  4O7C A;  4MR3 A;  4QSV A;  2KTB B;  2RNX A;  5B76 A;  1WEW A;  2LXP C;  4MEQ A;  5L98 A;  2YQD A;  5G05 B;  4QSU A;  4XY8 A;  4O7B A;  3QZS A;  4ALH A;  5DYA A;  4NXJ A;  2LGG A;  2YHN A;  4BBQ A;  5FB1 A;  2ECV A;  5EWD A;  2L80 A;  4A9E A;  1FP0 A;  1X0J A;  3L11 A;  3M62 A;  2E3K A;  5KHM A;  2KU3 A;  4TU6 A;  5TBN A;  4TU4 A;  2L0B A;  4TT4 A;  4FLP A;  3FL2 A;  1G25 A;  2YEM A;  3IU6 A;  1WEV A;  3T7L A;  5I1Q A;  4WHU A;  4IC2 A;  4YYH A;  4TZ2 A;  5A7C A;  1WEP A;  3UV4 A;  4YYJ A;  4UYH A;  4IR3 A;  4BW3 A;  1Z60 A;  5B79 A;  4QBM A;  5LKT A;  5FE9 A;  5FE5 A;  5ETB A;  5HQ7 A;  4L7X A;  2IDA A;  3N9P A;  5CUB A;  5EGU A;  2VJE A;  5CFW A;  4MVT A;  4QSP A;  4YYI A;  2CSZ A;  2KGI A;  4OUF A;  4A9H A;  2Y1N A;  4QC3 A;  2KRE A;  4PCI A;  4QSW A;  5CQ4 A;  2VNF A;  4UP0 A;  5CQ5 A;  4LRG A;  5CUC A;  5HRW A;  4QUU A;  5FE1 A;  3U5L A;  2DWW A;  5CU8 A;  2OUO A;  1HYJ A;  2EGP A;  4V3L C;  3ZNI A;  4UP5 A;  2M6M A;  4HBX A;  3P1D A;  1F62 A;  2AN6 A;  5A81 A;  4L58 A;  4YC9 A;  5KH3 A;  4QY4 A;  2LQ6 A;  3C6W A;  5ENC A;  1IYM A;  2D9E A;  4R2Y A;  4CUQ A;  1WIL A;  4NR8 A;  3ONI A;  5D1L B;  5E9L A;  4S3O B;  4NRC A;  5II1 A;  5LJ2 A;  4PTB A;  1X4I A;  5FFW A;  1WEN A;  2M85 A;  4C9Z A;  4A9K A;  4LZR A;  2E7O A;  4XUA A;  5DFB A;  4CFK A;  5C8G A;  3SHB A;  5ENJ A;  3UVW A;  3PUR A;  4AP4 A;  3V43 A;  4QC1 A;  3S91 A;  3G0L A;  4F52 B;  5A82 A;  1WES A;  4C67 A;  5E3G A;  5KO4 A;  5DW1 A;  3FKM X;  2MIQ A;  5EWH A;  5FE4 A;  3GV4 A;  5DIN A;  3VK6 A;  2Y43 A;  5CRZ A;  5CQ6 A;  4QEV A;  5CTL A;  2MA5 A;  5EWW A;  4J3I A;  4OGI A;  3P1F A;  1N87 A;  4LYI A;  4WZ0 A;  4TT6 A;  5TDR A;  2YW8 A;  5E9K A;  2DVR A;  2YQL A;  3N9Q A;  4Q0O A;  5EM3 A;  5CQ8 A;  5E9M A;  5FE8 A;  2HYE D;  4LLB A;  1BOR A;  3RPG C;  2ZET C;  4Y03 A;  5F3A A;  3MB3 A;  3SVH A;  1ZS5 A;  2PNX A;  5E74 A;  5DKA A;  2FUI A;  2ECG A;  2QIZ A;  4PCE A;  5I7Y A;  2H0D B;  3LQI A;  4I7B A;  4TS8 A;  5EIS A;  1WFK A;  4J0R A;  3MB4 A;  4KV4 A;  4TZ8 A;  5EP7 A;  2G6Q A;  5DYC A;  4YYG A;  3GL6 A;  5EPS A;  5FE0 A;  4AVX A;  3O36 A;  5B78 A;  5TB6 A;  4B86 C;  2YHO A;  2RS9 B;  3KNV A;  3N9L A;  3HME A;  2RNW A;  2EOD A;  4QUT A;  5FB0 A;  3UVY A;  4ZDT A;  3HCS A;  4QSQ A;  2KE1 A;  2YSM A;  4CCG X;  2R0V A;  5AD3 A;  4MR6 A;  2VJF B;  5CPE A;  4A9J A;  5D1M B;  5C4Q A;  4MR5 A;  5KU3 A;  4LYW A;  2MNY A;  2YSJ A;  3Q2E A;  2L5U A;  5L8T A;  3LRQ A;  3G0J A;  2YT5 A;  4LR6 A;  5LJ1 A;  5AIT A;  5I86 A;  3QZV A;  5DFC A;  1WEE A;  4C66 A;  4FO9 A;  4NQM A;  4GND A;  4CLB A;  1DVP A;  5CQ3 A;  4GNG A;  1ZBD B;  4R7E A;  5FG4 A;  4O64 A;  4FJC A;  4Q6F A;  4UYE A;  2I7K A;  2YDW A;  5J0D A;  4IR6 A;  5EIC A;  2GRC A;  5I40 A;  1FBV A;  2MD7 B;  4LAD B;  4IOR A;  3UV2 A;  3MHS A;  4A9O A;  3MUL A;  4IOQ A;  3LJW A;  5TCM A;  3O35 A;  4A4C A;  2I50 A;  1MM3 A;  4MR4 A;  2LSP B;  5CUD A;  5FH8 A;  1CHC A;  3KQI A;  4LZS A;  4Z6I A;  2MT5 A;  2CT2 A;  5E9Y A;  3N9O A;  2YEL A;  3P5O A;  4YYM A;  2EA6 A;  4YAT A;  3HMF A;  3MHH A;  2L85 A;  5A5R A;  2YU4 A;  4BW4 A;  2E7N A;  2G43 A;  4O74 A;  5E3D A;  3L1X A;  4KCX A;  5FG5 A;  4BW2 A;  1E4U A;  2WP1 A;  5HEN A;  5AD2 A;  4XUB A;  4ALG A;  2CKL B;  5DFD A;  2QJ0 A;  5FER A;  5D3P A;  4IOO A;  4AYC A;  5CP5 A;  5DY7 A;  5EI4 A;  4J1P A;  2F6J A;  4N4I A;  4IR5 A;  5C7N A;  2K1J A;  4Z6H A;  2LV9 A;  4W4U A;  5II2 A;  5COI A;  5FFY A;  2L84 A;  4YAX A;  2LXH C;  4MSX A;  5DYX A;  5C11 A;  4A9M A;  5H1T A;  1MM2 A;  5DKC A;  5HRV A;  3N9M A;  3UW9 A;  2M3H A;  3UV5 A;  4UIU A;  5DYU A;  4S3O C;  1Z6U A;  1T1H A;  5F1L A;  5IGK A;  5A5S A;  4QSS A;  5A83 A;  4QR4 A;  1F68 A;  4NUD A;  5JG6 A;  1HYI A;  5TDW A;  3SOW A;  2L43 A;  3HTK C;  5D3N A;  2QIC A;  2VPD A;  5D3J A;  5HQ6 A;  4PPE A;  1JM7 B;  5H1V A;  5FEY A;  5CS8 A;  2WP2 A;  5ENB A;  4O71 A;  4TKP B;  1N72 A;  4YYK A;  4ZQL A;  3MQM A;  1K2F A;  3PUQ A;  3UVD A;  5LCW B;  4YH3 A;  5A85 A;  3N9N A;  3MXF A;  5B75 A;  5ENG A;  3TLP A;  2RFJ A;  4NQN A;  5CQ7 A;  5BT5 A;  1LDK C;  2ECI A;  3Q2F A;  5HJC A;  4KV1 A;  3DQV R;  4YBT A;  5F1H A;  5G04 B;  3KV5 A;  1WEU A;  4Z1Q A;  4NR9 A;  4UIX A;  2VJE B;  1WE9 A;  5EA1 A;  4CUP A;  4UIV A;  4UI9 B;  2VPB A;  5IGN A;  2H0D A;  4GNF A;  2MA6 A;  2C2V S;  1JOC A;  4NUE A;  4O78 A;  5DW2 A;  4QF3 A;  4ZW1 A;  5F25 A;  4HBV A;  5D3R A;  4UIT A;  3GG3 A;  2PUY A;  5ACY A;  4MEN A;  3D7C A;  3LQH A;  1JSP B;  5I88 A;  5E73 A;  2FSA A;  3NXB A;  4XYA A;  5LJ0 A;  3AQA A;  5F60 A;  4NR5 A;  5CQT A;  3HCU A;  4O7F A;  4YAD A;  4TT2 A;  3EB5 A;  4I7D A;  5IG6 A;  4QSX A;  4LYS A;  5LKX A;  5LUU A;  4O75 A;  3U5J A;  1X4J A;  2ECT A;  3I3J A;  4GB0 A;  1WEQ A;  5JI8 A;  3JVM A;  4HXM A;  5E9I A;  1WGM A;  4NRA A;  5C13 A;  5CZG A;  5LVR A;  4CL9 A;  5CRM A;  4CUR A;  4FK5 A;  2G45 A;  4WZ2 A;  5EK9 A;  4Z93 A;  2R0S A;  4UYF A;  4BJX A;  2HDP A;  3ZTG A;  2DKW A;  3ZYQ A;  4TQN A;  2JMD A;  2VPE A;  4DON A;  4NUC A;  5I80 A;  5D24 A;  2K4D A;  3QZT A;  2YW5 A;  1VYX A;  2KGG A;  3ZPV E;  4NRB A;  4PKL A;  4QYL A;  5EPR A;  3U5K A;  2L75 A;  3O70 A;  4TTE A;  4YY6 A;  4YBS A;  5DX4 A;  2F42 A;  5TRB A;  2MD8 C;  2FUU A;  3RTR B;  4B7Y C;  5FE3 A;  4QEU A;  2VP7 A;  4BHW A;  5EV9 A;  2H60 A;  5KTW A;  2L5E A;  3ASL A;  4WHW A;  2YYN A;  1U6G B;  2I8N A;  4GNE A;  4CUT A;  2RSD A;  3T6R A;  4NYW A;  4CUU A;  2M1R A;  3IHP A;  4QSR A;  4QEW A;  4A9N A;  4YBM A;  5LVQ A;  4YAB A;  4WIV A;  2KYU A;  5ENH A;  5DKH A;  1V87 A;  4MEO A;  3S92 A;  2NXB A;  2YUC A;  5L99 A;  5CQA A;  3DAI A;  2LRI C;  5HEL A;  5FFV A;  4FIP A;  5L8U A;  5IGM A;  4XI1 A;  5HLS A;  2DVV A;  4NYV A;  2DX8 A;  4CFL A;  5BT4 A;  5AME A;  3UVX A;  4UIZ A;  4MEP A;  3LQJ A;  5C85 A;  5D3H A;  4NN2 A;  2N9G A;  2KIZ A;  2LGV A;  4LK9 A;  5BT3 A;  5CUG A;  2NAA A;  5HEM A;  2C2L A;  3L1Z B;  4HXS A;  2MJV B;  3PHD A;  4LDF A;  3P1E A;  3SOU A;  5FE7 A;  3JVJ A;  4X3G A;  3O34 A;  5I3L A;  3ZVZ B;  4ZC9 A;  5I89 A;  3JVL A;  5B77 A;  4Z1S A;  4N4G A;  5C87 A;  2Y1M A;  4QB3 A;  4UIY A;  5FE6 A;  5HRX A;  4P5O B;  4QYD A;  5D3S A;  1JM4 B;  4QF2 A;  3O7A A;  1JM7 A;  5IID A;  4PS5 A;  5C89 A;  5D0C A;  4LJN A;  5FH6 A;  3P1C A;  4A9F A;  4OGJ A;  4XY9 A;  2LGL A;  3HCT A;  2VPG A;  4QR5 A;  2YYR A;  4A9L A;  2MUM A;  5EWV A;  5E0R A;  5HM0 A;  3U5O A;  5H1U A;  5KH9 A;  3AAD A;  4QZS A;  2YRE A;  5FDZ A;  4HXK A;  5D7X A;  5F61 A;  4NR6 A;  5L96 A;  5HQ5 A;  2ECW A;  5DKD A;  4N4F A;  5L97 A;  2OO1 A;  5K29 A;  2ECN A;  2RNY A;  5KTU A;  4R8P K;  5F63 A;  4PY6 A;  3RCW A;  1E6I A;  1WEO A;  5ENI A;  4LZ2 A;  4HBY A;  2LGK A;  5EU1 A;  4HXP A;  5A5O A;  1X4U A;  1LDJ B;  4X2I A;  3O33 A;  2K16 A;  4TYL A;  5IBN A;  2OXQ C;  3KV6 A;  5CGP A;  4N4H A;  2JMJ A;  2JMI A;  4RVR A;  2RO1 A;  5I7X A;  4IR4 A;  2E6R A;  5LKU A;  3SVG A;  3M63 A;  2CSY A;  2DVS A;  5CY9 A;  2D82 A;  5H9M A;  5KH7 A;  4NYX A;  4O76 A;  2LN0 A;  3ZVY A;  4AYC B;  2RI7 A;  4O72 A;  4Q0N A;  5FG6 A;  2KWO A;  4YYN A;  4CUS A;  4NR4 A;  5AIU A;  4QST A;  4E96 A;  4LKA A;  4NS5 A;  5G4R A;  2UZG A;  5FE2 A;  4HBW A;  5F5Z A;  1RMD A;  3C5K A;  4HXL A;  3HMH A;  5FBX A;  2VJF A;  3DPL R;  2G4A A;  4AUQ B;  4BW1 A;  5B8D A;  5EPB A;  5HCL A;  2OSS A;  4LC2 A;  2KWK A;  3SOX A;  3SVF A;  4YYD A;  3ZPV 1;  4YY4 A;  2MNZ A;  4F3I A;  2YEK A;  2DAT A;  4WA6 A;  4A4B A;  5EWC A;  5F62 A;  3NG2 A;  2YQM A;  2KFT A;  5E7D A;  5J3X A;  2R10 A;  5A5Q A;  5HFR A;  5JWM A;  5HFQ A;  4V3K C;  3LXJ A;  5D25 A;  4CA1 A;  5EQ1 A;  1WIM A;  5LKZ A;  2KR4 A;  1XWH A;  2KWN A;  3M99 A;  5D1K B;  3U5P A;  4YH4 A;  5DBM A;  2ECJ A;  5F36 A;  4HXO A;  1VFY A;  3MUK A;  4J0S A;  5ETD A;  3RPG B;  3U5N A;  3DWY A;  4N3W A;  2JRJ A;  4A9I A;  5IGL A;  4HXN A;  5H85 A;  3O37 A;  1WUG A;  3JVK A;  4A0C D;  5AMF A;  3I2D A;  3U5M A;  4UYG A;  1VD4 A;  1Z2Q A;  2KWJ A;  4I7C A;  2D8S A;  5EYA F;  2BAY A;  4HXR A;  5A5N A;  5I83 A;  5D3T A;  5ENF A;  4O7A A;  2YUR A;  3EB6 A;  4O77 A;  4WZ3 B;  5CUA A;  5G0F A;  4UIW A;  2F6N A;  4ZUX U;  2E6S A;  4QNS A;  5A5P A;  5E9V A;  5G4S A;  5KTX A;  4YK0 A;  4NR7 A;  2LDR A;  4A49 A;  3K2J A;  5I29 A;  2R0Y A;  4GPJ A;  4IC3 A;  5EVA A;  5DLX A;  2CKL A;  2XB1 A;  5ENE A;  3ZYU A;  5F2P A;  4O70 A;  4UYD A;  5D26 A;  5DLZ A;  2DVQ A; 
#chains in the Genus database with same CATH topology
 5CUE A;  5D3L A;  3IU5 A;  5FH7 A;  4O62 A;  4O7E A;  2K17 A;  4QR3 A;  4AKN A;  4UYF B;  5TAB A;  1EQF A;  1WUM A;  1WEM A;  2XEU A;  4O7C A;  4MR3 A;  4QSV A;  2KTB B;  2RNX A;  5B76 A;  1WEW A;  2LXP C;  4MEQ A;  5L98 A;  2JUN A;  2YQD A;  5G05 B;  4QSU A;  4XY8 A;  4O7B A;  3QZS A;  4ALH A;  5DYA A;  4NXJ A;  2LGG A;  2YHN A;  4BBQ A;  5FB1 A;  2ECV A;  5EWD A;  2L80 A;  4A9E A;  1FP0 A;  1X0J A;  3L11 A;  3M62 A;  2E3K A;  5KHM A;  2KU3 A;  4TU6 A;  5TBN A;  4TU4 A;  2L0B A;  4TT4 A;  4FLP A;  3FL2 A;  1G25 A;  2YEM A;  3IU6 A;  1WEV A;  3T7L A;  5I1Q A;  4WHU A;  4IC2 A;  4YYH A;  4TZ2 A;  5A7C A;  1WEP A;  3UV4 A;  4YYJ A;  4UYH A;  4IR3 A;  4BW3 A;  1Z60 A;  5B79 A;  4QBM A;  5LKT A;  2D8U A;  5FE9 A;  5FE5 A;  5ETB A;  5HQ7 A;  4L7X A;  2IDA A;  3N9P A;  5CUB A;  5EGU A;  2VJE A;  5CFW A;  4MVT A;  4QSP A;  4YYI A;  2CSZ A;  2KGI A;  4OUF A;  4A9H A;  2Y1N A;  4QC3 A;  2KRE A;  4PCI A;  4QSW A;  5CQ4 A;  2VNF A;  4UP0 A;  5CQ5 A;  4LRG A;  5CUC A;  5HRW A;  4QUU A;  1PUO A;  5FE1 A;  3U5L A;  2DWW A;  5CU8 A;  2OUO A;  1HYJ A;  2EGP A;  4V3L C;  3ZNI A;  2LAU A;  4UP5 A;  2M6M A;  4HBX A;  3P1D A;  1F62 A;  2AN6 A;  5A81 A;  3T9K A;  4L58 A;  4YC9 A;  5KH3 A;  4QY4 A;  2LQ6 A;  3C6W A;  5ENC A;  1IYM A;  2D9E A;  4R2Y A;  4CUQ A;  1WIL A;  4NR8 A;  3ONI A;  5D1L B;  1MBM A;  5E9L A;  4S3O B;  4NRC A;  5II1 A;  5LJ2 A;  4PTB A;  1X4I A;  5FFW A;  1WEN A;  2M85 A;  4C9Z A;  4A9K A;  3LVQ E;  4LZR A;  2E7O A;  4XUA A;  5DFB A;  4CFK A;  5C8G A;  3SHB A;  5ENJ A;  3UVW A;  3PUR A;  4AP4 A;  3V43 A;  4QC1 A;  3S91 A;  3G0L A;  4F52 B;  5A82 A;  1WES A;  4C67 A;  2KKX A;  5E3G A;  5KO4 A;  5DW1 A;  3FKM X;  2MIQ A;  5EWH A;  5FE4 A;  3GV4 A;  5DIN A;  3VK6 A;  2Y43 A;  5CRZ A;  5CQ6 A;  4QEV A;  5CTL A;  2MA5 A;  5EWW A;  4J3I A;  3DWD A;  4OGI A;  3P1F A;  1N87 A;  4LYI A;  4WZ0 A;  4TT6 A;  5TDR A;  2YW8 A;  5E9K A;  2DVR A;  2YQL A;  3N9Q A;  4Z0R A;  4Q0O A;  5EM3 A;  5CQ8 A;  1DCQ A;  5E9M A;  5FE8 A;  2HYE D;  3FJU B;  4Z0O A;  4LLB A;  1BOR A;  3RPG C;  2ZET C;  4Y03 A;  5F3A A;  3MB3 A;  5SVX A;  3SVH A;  1ZS5 A;  2PNX A;  5E74 A;  5DKA A;  2FUI A;  2ECG A;  2QIZ A;  4PCE A;  5I7Y A;  2H0D B;  3LDY A;  3LQI A;  4I7B A;  2E61 A;  3LJU X;  4TS8 A;  5EIS A;  1WFK A;  4J0R A;  3MB4 A;  4KV4 A;  4TZ8 A;  5EP7 A;  2G6Q A;  5DYC A;  4YYG A;  3GL6 A;  5EPS A;  5FE0 A;  4AVX A;  3O36 A;  5B78 A;  5TB6 A;  4B86 C;  2YHO A;  2RS9 B;  3KNV A;  3N9L A;  3HME A;  2RNW A;  2EOD A;  4QUT A;  5FB0 A;  3UVY A;  4H9D A;  4ZDT A;  3HCS A;  4QSQ A;  2KE1 A;  2YSM A;  4CCG X;  2R0V A;  5AD3 A;  4MR6 A;  2VJF B;  5CPE A;  4A9J A;  5D1M B;  5C4Q A;  4MR5 A;  5KU3 A;  4LYW A;  3KDE C;  2MNY A;  2CSV A;  3Q2E A;  2L5U A;  5L8T A;  2YSJ A;  3G0J A;  3LRQ A;  2YT5 A;  4LR6 A;  5LJ1 A;  5AIT A;  5I86 A;  3QZV A;  5DFC A;  1WEE A;  4C66 A;  4FO9 A;  4F1P A;  4NQM A;  4GND A;  2RR4 A;  4CLB A;  1DVP A;  5CQ3 A;  4GNG A;  3D1B A;  1ZBD B;  4R7E A;  5FG4 A;  4O64 A;  4FJC A;  5SVI A;  4Q6F A;  4UYE A;  2I7K A;  2YDW A;  5J0D A;  4IR6 A;  5EIC A;  2GRC A;  5I40 A;  1FBV A;  2MD7 B;  4LAD B;  4IOR A;  3UV2 A;  3MHS A;  4OGC A;  4A9O A;  3MUL A;  4IOQ A;  3LJW A;  5TCM A;  3O35 A;  4A4C A;  2I50 A;  1MM3 A;  4MR4 A;  2LSP B;  5CUD A;  5FH8 A;  1CHC A;  3KQI A;  4LZS A;  4Z6I A;  2MT5 A;  2CT2 A;  5E9Y A;  3N9O A;  2YEL A;  3P5O A;  2CRR A;  4YYM A;  2EA6 A;  4YAT A;  3FM8 C;  3HMF A;  3MHH A;  2L85 A;  5A5R A;  2YU4 A;  3DDT A;  4BW4 A;  2E7N A;  2G43 A;  4O74 A;  5E3D A;  3L1X A;  2IQJ A;  4KCX A;  5FG5 A;  4BW2 A;  1E4U A;  4AKI A;  2WP1 A;  5HEN A;  5AD2 A;  4XUB A;  4ALG A;  2CKL B;  5DFD A;  2QJ0 A;  5FER A;  5D3P A;  4IOO A;  4AYC A;  5CP5 A;  5SVY A;  5DY7 A;  5EI4 A;  4J1P A;  2F6J A;  4N4I A;  4IR5 A;  5C7N A;  2K1J A;  4Z6H A;  2LV9 A;  4W4U A;  5II2 A;  5COI A;  5FFY A;  2L84 A;  4YAX A;  2LXH C;  4MSX A;  5DYX A;  5C11 A;  4A9M A;  5H1T A;  1MM2 A;  5DKC A;  5HRV A;  2FFW A;  3N9M A;  3UW9 A;  2M3H A;  3UV5 A;  4UIU A;  5DYU A;  2FD4 A;  4S3O C;  1Z6U A;  1T1H A;  5F1L A;  5IGK A;  5A5S A;  4QSS A;  5A83 A;  4QR4 A;  1F68 A;  4NUD A;  5JG6 A;  1HYI A;  3H7H A;  5TDW A;  2CON A;  3SOW A;  2L43 A;  3HTK C;  5D3N A;  2QIC A;  2VPD A;  5D3J A;  5HQ6 A;  4PPE A;  1JM7 B;  3FAN A;  5H1V A;  5FEY A;  5CS8 A;  2WP2 A;  5ENB A;  4O71 A;  2YVR A;  4TKP B;  4AKH A;  1N72 A;  4YYK A;  4ZQL A;  3MQM A;  1K2F A;  3PUQ A;  3UVD A;  5LCW B;  4YH3 A;  3VKG A;  5A85 A;  3N9N A;  3MXF A;  5B75 A;  5ENG A;  3TLP A;  2RFJ A;  4NQN A;  5CQ7 A;  5BT5 A;  1LDK C;  2ECI A;  3Q2F A;  5HJC A;  4KV1 A;  3DQV R;  4YBT A;  5F1H A;  5G04 B;  3KV5 A;  1WEU A;  4Z1Q A;  4NR9 A;  4UIX A;  2EXU A;  1WE9 A;  5EA1 A;  4CUP A;  4UIV A;  2VJE B;  4UI9 B;  2VPB A;  5IGN A;  2H0D A;  4GNF A;  2MA6 A;  2C2V S;  1JOC A;  4NUE A;  4O78 A;  5DW2 A;  4QF3 A;  4ZW1 A;  5F25 A;  4HBV A;  5D3R A;  4UIT A;  3GG3 A;  2PUY A;  5ACY A;  4MEN A;  3D7C A;  3LQH A;  1JSP B;  5I88 A;  5E73 A;  3VKH A;  2FSA A;  3NXB A;  4XYA A;  5LJ0 A;  3ERR A;  3AQA A;  5F60 A;  4NR5 A;  5CQT A;  3FEH A;  3HCU A;  4O7F A;  4YAD A;  4TT2 A;  3EB5 A;  4I7D A;  5IG6 A;  4QSX A;  4LYS A;  5LKX A;  5LUU A;  4O75 A;  3U5J A;  1X4J A;  2ECT A;  3I3J A;  4GB0 A;  1WEQ A;  5JI8 A;  3JVM A;  4HXM A;  5E9I A;  1WGM A;  4NRA A;  5C13 A;  5CZG A;  5LVR A;  4CL9 A;  5CRM A;  4CUR A;  4FK5 A;  2G45 A;  4WZ2 A;  5EK9 A;  2R0S A;  4UYF A;  4Z93 A;  4BJX A;  2HDP A;  3Q1D A;  2DKW A;  3ZTG A;  3ZYQ A;  4TQN A;  2JMD A;  2VPE A;  4DON A;  4NUC A;  5I80 A;  5D24 A;  2K4D A;  2EGM A;  3QZT A;  2YW5 A;  3D1D A;  1VYX A;  2KGG A;  3ZPV E;  4NRB A;  4PKL A;  4QYL A;  4AKG A;  5EPR A;  3U5K A;  2L75 A;  3O70 A;  4TTE A;  4YY6 A;  4YBS A;  5DX4 A;  2F42 A;  5TRB A;  2MD8 C;  2FUU A;  3RTR B;  4B7Y C;  4AI6 A;  5FE3 A;  4QEU A;  2VP7 A;  4BHW A;  5EV9 A;  2H60 A;  5KTW A;  2L5E A;  3ASL A;  4WHW A;  2YYN A;  1U6G B;  2I8N A;  3JUE A;  4GNE A;  2KKY A;  4CUT A;  2RSD A;  3T6R A;  4NYW A;  4CUU A;  2M1R A;  3IHP A;  4QSR A;  4QEW A;  4A9N A;  4YBM A;  5LVQ A;  4YAB A;  4WIV A;  2KYU A;  5ENH A;  5DKH A;  1V87 A;  4MEO A;  3S92 A;  2NXB A;  2YUC A;  5L99 A;  5CQA A;  2DJA A;  3DAI A;  2LRI C;  2XOY A;  3LVR E;  5HEL A;  5FFV A;  4FIP A;  5L8U A;  5IGM A;  4XI1 A;  5HLS A;  2DVV A;  4NYV A;  2DX8 A;  4CFL A;  5BT4 A;  5AME A;  3UVX A;  3O47 A;  4UIZ A;  4MEP A;  3LQJ A;  5C85 A;  5D3H A;  4NN2 A;  2N9G A;  2KIZ A;  2LGV A;  3FAO A;  4LK9 A;  5BT3 A;  5CUG A;  2NAA A;  5HEM A;  2C2L A;  3L1Z B;  4HXS A;  2MJV B;  3PHD A;  4LDF A;  3P1E A;  3SOU A;  5FE7 A;  3JVJ A;  4X3G A;  3O34 A;  5I3L A;  2MKE A;  3ZVZ B;  4ZC9 A;  3M7K A;  5I89 A;  3JVL A;  5B77 A;  4Z1S A;  4N4G A;  5C87 A;  3PLW A;  2Y1M A;  4QB3 A;  5K3Q A;  4UIY A;  5FE6 A;  5HRX A;  4P5O B;  4QYD A;  5D3S A;  1JM4 B;  2M13 A;  4QF2 A;  3O7A A;  1JM7 A;  5IID A;  4PS5 A;  5C89 A;  5D0C A;  2CRW A;  2XOC A;  4LJN A;  3SUB A;  5FH6 A;  3P1C A;  4A9F A;  4OGJ A;  4XY9 A;  2LGL A;  3HCT A;  2VPG A;  4QR5 A;  2YYR A;  5SVI B;  4A9L A;  2MUM A;  5EWV A;  5E0R A;  5HM0 A;  3U5O A;  5H1U A;  5KH9 A;  3AAD A;  4QZS A;  2YRE A;  5FDZ A;  4HXK A;  5D7X A;  5F61 A;  4NR6 A;  5L96 A;  5HQ5 A;  2ECW A;  5DKD A;  4N4F A;  5L97 A;  2OO1 A;  5K29 A;  2ECN A;  2RNY A;  5KTU A;  4R8P K;  5F63 A;  4PY6 A;  3RCW A;  2B0O E;  1E6I A;  1WEO A;  5ENI A;  4LZ2 A;  4HBY A;  2LGK A;  5EU1 A;  4HXP A;  5A5O A;  2XP0 A;  1X4U A;  1LDJ B;  4X2I A;  3O33 A;  2K16 A;  4TYL A;  5IBN A;  2OXQ C;  3KV6 A;  5CGP A;  4N4H A;  2JMJ A;  2JMI A;  4RVR A;  2RO1 A;  5I7X A;  4IR4 A;  2E6R A;  5LKU A;  3SVG A;  3M63 A;  2CSY A;  2DVS A;  5CY9 A;  2D82 A;  5H9M A;  5KH7 A;  4NYX A;  4O76 A;  2LN0 A;  3ZVY A;  4AYC B;  2RI7 A;  4O72 A;  4Q0N A;  5FG6 A;  2KWO A;  2DSM A;  4YYN A;  3E2D A;  4CUS A;  4NR4 A;  5AIU A;  4QST A;  4E96 A;  4LKA A;  4QQ4 A;  4NS5 A;  5G4R A;  2UZG A;  5FE2 A;  4HBW A;  5F5Z A;  1RMD A;  3C5K A;  2XOZ A;  4HXL A;  3HMH A;  5FBX A;  2VJF A;  3DPL R;  2G4A A;  4AUQ B;  4BW1 A;  5B8D A;  5EPB A;  5HCL A;  2OSS A;  4LC2 A;  2KWK A;  3SOX A;  3SVF A;  1ZKR A;  4YYD A;  3ZPV 1;  4YY4 A;  2MNZ A;  4F3I A;  2YEK A;  2DAT A;  4WA6 A;  4A4B A;  5EWC A;  5F62 A;  3NG2 A;  2YQM A;  2KFT A;  5E7D A;  5J3X A;  2R10 A;  5A5Q A;  5HFR A;  5JWM A;  5HFQ A;  4V3K C;  3LXJ A;  5D25 A;  4CA1 A;  5EQ1 A;  1WIM A;  5LKZ A;  2KR4 A;  1XWH A;  2KWN A;  2L7P A;  3M99 A;  4OGE A;  5D1K B;  3U5P A;  4YH4 A;  5DBM A;  2JM3 A;  2ECJ A;  5F36 A;  4HXO A;  1VFY A;  3MUK A;  4J0S A;  5ETD A;  3RPG B;  3U5N A;  3DWY A;  4N3W A;  2JRJ A;  4A9I A;  5IGL A;  4HXN A;  5H85 A;  3O37 A;  1WUG A;  3JVK A;  3MDB C;  4A0C D;  5AMF A;  3I2D A;  3U5M A;  4UYG A;  1VD4 A;  1Z2Q A;  2KWJ A;  4I7C A;  2D8S A;  5EYA F;  2BAY A;  4HXR A;  5A5N A;  5I83 A;  5D3T A;  5ENF A;  4O7A A;  2YUR A;  3EB6 A;  4O77 A;  4WZ3 B;  5CUA A;  5G0F A;  4UIW A;  2F6N A;  4ZUX U;  2E6S A;  4QNS A;  2P57 A;  5A5P A;  5E9V A;  5G4S A;  5KTX A;  4YK0 A;  4NR7 A;  2LDR A;  4A49 A;  3K2J A;  5I29 A;  2R0Y A;  4GPJ A;  4IC3 A;  5EVA A;  2EJN A;  5DLX A;  2CKL A;  2XB1 A;  2OWA A;  5ENE A;  3ZYU A;  5F2P A;  4O70 A;  4UYD A;  5D26 A;  5DLZ A;  2DVQ A; 
#chains in the Genus database with same CATH homology
 5CUE A;  5D3L A;  3IU5 A;  5FH7 A;  4O7E A;  2K17 A;  4QR3 A;  4AKN A;  4UYF B;  5TAB A;  1EQF A;  1WUM A;  1WEM A;  2XEU A;  4O7C A;  4MR3 A;  4QSV A;  2KTB B;  2RNX A;  5B76 A;  1WEW A;  2LXP C;  4MEQ A;  5L98 A;  2YQD A;  5G05 B;  4QSU A;  4XY8 A;  4O7B A;  3QZS A;  4ALH A;  5DYA A;  4NXJ A;  2LGG A;  2YHN A;  4BBQ A;  5FB1 A;  2ECV A;  5EWD A;  2L80 A;  4A9E A;  1FP0 A;  1X0J A;  3L11 A;  3M62 A;  2E3K A;  5KHM A;  2KU3 A;  4TU6 A;  5TBN A;  4TU4 A;  2L0B A;  4TT4 A;  4FLP A;  3FL2 A;  1G25 A;  2YEM A;  3IU6 A;  1WEV A;  3T7L A;  5I1Q A;  4WHU A;  4IC2 A;  4YYH A;  4TZ2 A;  5A7C A;  1WEP A;  3UV4 A;  4YYJ A;  4UYH A;  4IR3 A;  4BW3 A;  1Z60 A;  5B79 A;  4QBM A;  5LKT A;  5FE9 A;  5FE5 A;  5ETB A;  5HQ7 A;  4L7X A;  2IDA A;  3N9P A;  5CUB A;  5EGU A;  2VJE A;  5CFW A;  4MVT A;  4QSP A;  4YYI A;  2CSZ A;  2KGI A;  4OUF A;  4A9H A;  2Y1N A;  4QC3 A;  2KRE A;  4PCI A;  4QSW A;  5CQ4 A;  2VNF A;  4UP0 A;  5CQ5 A;  4LRG A;  5CUC A;  5HRW A;  4QUU A;  5FE1 A;  3U5L A;  2DWW A;  5CU8 A;  2OUO A;  1HYJ A;  2EGP A;  4V3L C;  3ZNI A;  4UP5 A;  2M6M A;  4HBX A;  3P1D A;  1F62 A;  2AN6 A;  5A81 A;  4L58 A;  4YC9 A;  5KH3 A;  4QY4 A;  2LQ6 A;  3C6W A;  5ENC A;  1IYM A;  2D9E A;  4R2Y A;  4CUQ A;  1WIL A;  4NR8 A;  3ONI A;  5D1L B;  5E9L A;  4S3O B;  4NRC A;  5II1 A;  5LJ2 A;  4PTB A;  1X4I A;  5FFW A;  1WEN A;  2M85 A;  4C9Z A;  4A9K A;  4LZR A;  2E7O A;  4XUA A;  5DFB A;  4CFK A;  5C8G A;  3SHB A;  5ENJ A;  3UVW A;  3PUR A;  4AP4 A;  3V43 A;  4QC1 A;  3S91 A;  3G0L A;  4F52 B;  5A82 A;  1WES A;  4C67 A;  5E3G A;  5KO4 A;  5DW1 A;  3FKM X;  2MIQ A;  5EWH A;  5FE4 A;  3GV4 A;  5DIN A;  3VK6 A;  2Y43 A;  5CRZ A;  5CQ6 A;  4QEV A;  5CTL A;  2MA5 A;  5EWW A;  4J3I A;  4OGI A;  3P1F A;  1N87 A;  4LYI A;  4WZ0 A;  4TT6 A;  5TDR A;  2YW8 A;  5E9K A;  2DVR A;  2YQL A;  3N9Q A;  4Q0O A;  5EM3 A;  5CQ8 A;  5E9M A;  5FE8 A;  2HYE D;  4LLB A;  1BOR A;  3RPG C;  2ZET C;  4Y03 A;  5F3A A;  3MB3 A;  3SVH A;  1ZS5 A;  2PNX A;  5E74 A;  5DKA A;  2FUI A;  2ECG A;  2QIZ A;  4PCE A;  5I7Y A;  2H0D B;  3LQI A;  4I7B A;  4TS8 A;  5EIS A;  1WFK A;  4J0R A;  3MB4 A;  4KV4 A;  4TZ8 A;  5EP7 A;  2G6Q A;  5DYC A;  4YYG A;  3GL6 A;  5EPS A;  5FE0 A;  4AVX A;  3O36 A;  5B78 A;  5TB6 A;  4B86 C;  2YHO A;  2RS9 B;  3KNV A;  3N9L A;  3HME A;  2RNW A;  2EOD A;  4QUT A;  5FB0 A;  3UVY A;  4ZDT A;  3HCS A;  4QSQ A;  2KE1 A;  2YSM A;  4CCG X;  2R0V A;  5AD3 A;  4MR6 A;  2VJF B;  5CPE A;  4A9J A;  5D1M B;  5C4Q A;  4MR5 A;  5KU3 A;  4LYW A;  2MNY A;  2YSJ A;  3Q2E A;  2L5U A;  5L8T A;  3LRQ A;  3G0J A;  2YT5 A;  4LR6 A;  5LJ1 A;  5AIT A;  5I86 A;  3QZV A;  5DFC A;  1WEE A;  4C66 A;  4FO9 A;  4NQM A;  4GND A;  4CLB A;  1DVP A;  5CQ3 A;  4GNG A;  1ZBD B;  4R7E A;  5FG4 A;  4O64 A;  4FJC A;  4Q6F A;  4UYE A;  2I7K A;  2YDW A;  5J0D A;  4IR6 A;  5EIC A;  2GRC A;  5I40 A;  1FBV A;  2MD7 B;  4LAD B;  4IOR A;  3UV2 A;  3MHS A;  4A9O A;  3MUL A;  4IOQ A;  3LJW A;  5TCM A;  3O35 A;  4A4C A;  2I50 A;  1MM3 A;  4MR4 A;  2LSP B;  5CUD A;  5FH8 A;  1CHC A;  3KQI A;  4LZS A;  4Z6I A;  2MT5 A;  2CT2 A;  5E9Y A;  3N9O A;  2YEL A;  3P5O A;  4YYM A;  2EA6 A;  4YAT A;  3HMF A;  3MHH A;  2L85 A;  5A5R A;  2YU4 A;  4BW4 A;  2E7N A;  2G43 A;  4O74 A;  5E3D A;  3L1X A;  4KCX A;  5FG5 A;  4BW2 A;  1E4U A;  2WP1 A;  5HEN A;  5AD2 A;  4XUB A;  4ALG A;  2CKL B;  5DFD A;  2QJ0 A;  5FER A;  5D3P A;  4IOO A;  4AYC A;  5CP5 A;  5DY7 A;  5EI4 A;  4J1P A;  2F6J A;  4N4I A;  4IR5 A;  5C7N A;  2K1J A;  4Z6H A;  2LV9 A;  4W4U A;  5II2 A;  5COI A;  5FFY A;  2L84 A;  4YAX A;  2LXH C;  4MSX A;  5DYX A;  5C11 A;  4A9M A;  5H1T A;  1MM2 A;  5DKC A;  5HRV A;  3N9M A;  3UW9 A;  2M3H A;  3UV5 A;  4UIU A;  5DYU A;  4S3O C;  1Z6U A;  1T1H A;  5F1L A;  5IGK A;  5A5S A;  4QSS A;  5A83 A;  4QR4 A;  1F68 A;  4NUD A;  5JG6 A;  1HYI A;  5TDW A;  3SOW A;  2L43 A;  3HTK C;  5D3N A;  2QIC A;  2VPD A;  5D3J A;  5HQ6 A;  4PPE A;  1JM7 B;  5H1V A;  5FEY A;  5CS8 A;  2WP2 A;  5ENB A;  4O71 A;  4TKP B;  1N72 A;  4YYK A;  4ZQL A;  3MQM A;  1K2F A;  3PUQ A;  3UVD A;  5LCW B;  4YH3 A;  5A85 A;  3N9N A;  3MXF A;  5B75 A;  5ENG A;  3TLP A;  2RFJ A;  4NQN A;  5CQ7 A;  5BT5 A;  1LDK C;  2ECI A;  3Q2F A;  5HJC A;  4KV1 A;  3DQV R;  4YBT A;  5F1H A;  5G04 B;  3KV5 A;  1WEU A;  4Z1Q A;  4NR9 A;  4UIX A;  2VJE B;  1WE9 A;  5EA1 A;  4CUP A;  4UIV A;  4UI9 B;  2VPB A;  5IGN A;  2H0D A;  4GNF A;  2MA6 A;  2C2V S;  1JOC A;  4NUE A;  4O78 A;  5DW2 A;  4QF3 A;  4ZW1 A;  5F25 A;  4HBV A;  5D3R A;  4UIT A;  3GG3 A;  2PUY A;  5ACY A;  4MEN A;  3D7C A;  3LQH A;  1JSP B;  5I88 A;  5E73 A;  2FSA A;  3NXB A;  4XYA A;  5LJ0 A;  3AQA A;  5F60 A;  4NR5 A;  5CQT A;  3HCU A;  4O7F A;  4YAD A;  4TT2 A;  3EB5 A;  4I7D A;  5IG6 A;  4QSX A;  4LYS A;  5LKX A;  5LUU A;  4O75 A;  3U5J A;  1X4J A;  2ECT A;  3I3J A;  4GB0 A;  1WEQ A;  5JI8 A;  3JVM A;  4HXM A;  5E9I A;  1WGM A;  4NRA A;  5C13 A;  5CZG A;  5LVR A;  4CL9 A;  5CRM A;  4CUR A;  4FK5 A;  2G45 A;  4WZ2 A;  5EK9 A;  4Z93 A;  2R0S A;  4UYF A;  4BJX A;  2HDP A;  3ZTG A;  2DKW A;  3ZYQ A;  4TQN A;  2JMD A;  2VPE A;  4DON A;  4NUC A;  5I80 A;  5D24 A;  2K4D A;  3QZT A;  2YW5 A;  1VYX A;  2KGG A;  3ZPV E;  4NRB A;  4PKL A;  4QYL A;  5EPR A;  3U5K A;  2L75 A;  3O70 A;  4TTE A;  4YY6 A;  4YBS A;  5DX4 A;  2F42 A;  5TRB A;  2MD8 C;  2FUU A;  3RTR B;  4B7Y C;  5FE3 A;  4QEU A;  2VP7 A;  4BHW A;  5EV9 A;  2H60 A;  5KTW A;  2L5E A;  3ASL A;  4WHW A;  2YYN A;  1U6G B;  2I8N A;  4GNE A;  4CUT A;  2RSD A;  3T6R A;  4NYW A;  4CUU A;  2M1R A;  3IHP A;  4QSR A;  4QEW A;  4A9N A;  4YBM A;  5LVQ A;  4YAB A;  4WIV A;  2KYU A;  5ENH A;  5DKH A;  1V87 A;  4MEO A;  3S92 A;  2NXB A;  2YUC A;  5L99 A;  5CQA A;  3DAI A;  2LRI C;  5HEL A;  5FFV A;  4FIP A;  5L8U A;  5IGM A;  4XI1 A;  5HLS A;  2DVV A;  4NYV A;  2DX8 A;  4CFL A;  5BT4 A;  5AME A;  3UVX A;  4UIZ A;  4MEP A;  3LQJ A;  5C85 A;  5D3H A;  4NN2 A;  2N9G A;  2KIZ A;  2LGV A;  4LK9 A;  5BT3 A;  5CUG A;  2NAA A;  5HEM A;  2C2L A;  3L1Z B;  4HXS A;  2MJV B;  3PHD A;  4LDF A;  3P1E A;  3SOU A;  5FE7 A;  3JVJ A;  4X3G A;  3O34 A;  5I3L A;  3ZVZ B;  4ZC9 A;  5I89 A;  3JVL A;  5B77 A;  4Z1S A;  4N4G A;  5C87 A;  2Y1M A;  4QB3 A;  4UIY A;  5FE6 A;  5HRX A;  4P5O B;  4QYD A;  5D3S A;  1JM4 B;  4QF2 A;  3O7A A;  1JM7 A;  5IID A;  4PS5 A;  5C89 A;  5D0C A;  4LJN A;  5FH6 A;  3P1C A;  4A9F A;  4OGJ A;  4XY9 A;  2LGL A;  3HCT A;  2VPG A;  4QR5 A;  2YYR A;  4A9L A;  2MUM A;  5EWV A;  5E0R A;  5HM0 A;  3U5O A;  5H1U A;  5KH9 A;  3AAD A;  4QZS A;  2YRE A;  5FDZ A;  4HXK A;  5D7X A;  5F61 A;  4NR6 A;  5L96 A;  5HQ5 A;  2ECW A;  5DKD A;  4N4F A;  5L97 A;  2OO1 A;  5K29 A;  2ECN A;  2RNY A;  5KTU A;  4R8P K;  5F63 A;  4PY6 A;  3RCW A;  1E6I A;  1WEO A;  5ENI A;  4LZ2 A;  4HBY A;  2LGK A;  5EU1 A;  4HXP A;  5A5O A;  1X4U A;  1LDJ B;  4X2I A;  3O33 A;  2K16 A;  4TYL A;  5IBN A;  2OXQ C;  3KV6 A;  5CGP A;  4N4H A;  2JMJ A;  2JMI A;  4RVR A;  2RO1 A;  5I7X A;  4IR4 A;  2E6R A;  5LKU A;  3SVG A;  3M63 A;  2CSY A;  2DVS A;  5CY9 A;  2D82 A;  5H9M A;  5KH7 A;  4NYX A;  4O76 A;  2LN0 A;  3ZVY A;  4AYC B;  2RI7 A;  4O72 A;  4Q0N A;  5FG6 A;  2KWO A;  4YYN A;  4CUS A;  4NR4 A;  5AIU A;  4QST A;  4E96 A;  4LKA A;  4NS5 A;  5G4R A;  2UZG A;  5FE2 A;  4HBW A;  5F5Z A;  1RMD A;  3C5K A;  4HXL A;  3HMH A;  5FBX A;  2VJF A;  3DPL R;  2G4A A;  4AUQ B;  4BW1 A;  5B8D A;  5EPB A;  5HCL A;  2OSS A;  4LC2 A;  2KWK A;  3SOX A;  3SVF A;  4YYD A;  3ZPV 1;  4YY4 A;  2MNZ A;  4F3I A;  2YEK A;  2DAT A;  4WA6 A;  4A4B A;  5EWC A;  5F62 A;  3NG2 A;  2YQM A;  2KFT A;  5E7D A;  5J3X A;  2R10 A;  5A5Q A;  5HFR A;  5JWM A;  5HFQ A;  4V3K C;  3LXJ A;  5D25 A;  4CA1 A;  5EQ1 A;  1WIM A;  5LKZ A;  2KR4 A;  1XWH A;  2KWN A;  3M99 A;  5D1K B;  3U5P A;  4YH4 A;  5DBM A;  2ECJ A;  5F36 A;  4HXO A;  1VFY A;  3MUK A;  4J0S A;  5ETD A;  3RPG B;  3U5N A;  3DWY A;  4N3W A;  2JRJ A;  4A9I A;  5IGL A;  4HXN A;  5H85 A;  3O37 A;  1WUG A;  3JVK A;  4A0C D;  5AMF A;  3I2D A;  3U5M A;  4UYG A;  1VD4 A;  1Z2Q A;  2KWJ A;  4I7C A;  2D8S A;  5EYA F;  2BAY A;  4HXR A;  5A5N A;  5I83 A;  5D3T A;  5ENF A;  4O7A A;  2YUR A;  3EB6 A;  4O77 A;  4WZ3 B;  5CUA A;  5G0F A;  4UIW A;  2F6N A;  4ZUX U;  2E6S A;  4QNS A;  5A5P A;  5E9V A;  5G4S A;  5KTX A;  4YK0 A;  4NR7 A;  2LDR A;  4A49 A;  3K2J A;  5I29 A;  2R0Y A;  4GPJ A;  4IC3 A;  5EVA A;  5DLX A;  2CKL A;  2XB1 A;  5ENE A;  3ZYU A;  5F2P A;  4O70 A;  4UYD A;  5D26 A;  5DLZ A;  2DVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...