3O33A

Crystal structure of trim24 phd-bromo in the free state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription intermediary factor 1-alpha
total genus 47
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o33A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o33A01
4YBSA 3P1FA 3IU6A 2HYED 5TDWA 5C87A 4YH4A 2K17A 3ZVZB 4O7BA 4O71A 3U5LA 2DVRA 4NRBA 3RCWA 5LUUA 4N4GA 4X3GA 4UYEA 3O35A 2VJFB 4KV1A 1Z60A 2KREA 4AYCB 2VP7A 3IHPA 5E73A 5CY9A 4CL9A 3G0LA 2C2LA 2K16A 4NR6A 5F61A 5FE9A 5FERA 5CRMA 1JOCA 2R0VA 2OXQC 5ENJA 1Z6UA 5DBMA 2H0DB 4IR6A 5KH9A 4YBMA 4YYHA 2AN6A 1LDJB 4MEQA 4YH3A 5I1QA 5CQ4A 5DFBA 1WE9A 5TDRA 5D24A 2YREA 4J0SA 1WEVA 5F5ZA 3LQHA 3GV4A 3O7AA 4QC3A 4HXRA 5D3JA 3MQMA 5I88A 3HCUA 4P5OB 4NR9A 2KTBB 5E9LA 5E9KA 5FE5A 1E4UA 3HCSA 4CFLA 4YYJA 5AITA 3QZVA 5A82A 4YYNA 2MA5A 5EM3A 5DKDA 4O74A 2D9EA 5A5RA 1WEPA 2LRIC 3O36A 5LKZA 4X2IA 5I7XA 5EVAA 4OGJA 5FB1A 5I80A 4O75A 4LDFA 5ENEA 5EWVA 4CURA 2GRCA 2YYNA 1ZBDB 4UYGA 5EWDA 4F52B 3HCTA 2DX8A 3O33A 2ECIA 3UVYA 4UP5A 4MR3A 2RS9B 2Y1NA 4LKAA 4O70A 5CQTA 5A5QA 4WHWA 5DKHA 4ZQLA 2YHNA 4R7EA 1N72A 4O72A 5D1MB 5LJ1A 3MXFA 4CA1A 5CUAA 5HENA 3UV4A 3U5NA 4O77A 5B76A 4UYFB 1VFYA 3PUQA 1WEQA 4QB3A 3MB3A 2YEKA 3KQIA 4LYWA 1Z2QA 4QUTA 3ZPV1 4R8PK 5D3PA 2RNXA 3ZVYA 5COIA 4HBXA 4YBTA 2ECGA 2R0YA 3O70A 5HRXA 1X0JA 3SOUA 1JM7A 4B7YC 5ENGA 4BW1A 4LC2A 5DINA 3L1ZB 5EISA 3I2DA 4WZ2A 3I3JA 4XYAA 2CT2A 2KR4A 1FP0A 5LVQA 5E9YA 2YEMA 2YSMA 2KWOA 5HEMA 5DFCA 4FO9A 3L1XA 3N9QA 5DW2A 5D3RA 2MUMA 4QSQA 5E9VA 4ZW1A 5B79A 4QSVA 4O7EA 4Z6HA 2L43A 2MIQA 1HYJA 3MULA 4Z93A 3LRQA 5EV9A 4Z6IA 1E6IA 5KTUA 4V3LC 4XUBA 2N9GA 5LJ0A 5AMEA 4MR4A 2L75A 3FL2A 5B78A 4LLBA 2LXHC 4TZ2A 1WUMA 2RI7A 3KV5A 3JVLA 2EODA 5H1VA 3QZTA 1DVPA 3SVGA 4A9NA 4FIPA 5HCLA 4QF3A 5KO4A 2JMJA 3EB6A 5CUGA 4LK9A 2I7KA 4KV4A 5CQ8A 4ZDTA 5A5SA 5A85A 2PUYA 3NXBA 5FE0A 3JVJA 1WENA 2VPBA 3ZNIA 2YW8A 2CKLA 4L58A 4YY6A 3NG2A 3IU5A 5CGPA 2E6RA 5HRVA 5DKAA 2ECJA 1WEWA 4I7DA 4QSUA 5ENHA 4CUPA 4NYVA 3U5PA 2NXBA 5EYAF 4LZSA 4GNEA 2M3HA 4N4FA 5L98A 5C11A 5FBXA 2MJVB 3UVWA 4MENA 5LKXA 2KE1A 4AP4A 5D3HA 5HLSA 5A7CA 5ENBA 4UYHA 5G4RA 4UIXA 4AVXA 3LQJA 5FDZA 4PPEA 4CUTA 2MNYA 4Z1SA 4XY9A 5CZGA 2PNXA 2KGGA 5FG4A 4WA6A 5FH8A 4XY8A 4LR6A 2M6MA 2NAAA 3SHBA 5FFWA 2VJEA 5G05B 2YHOA 5I7YA 2YT5A 4TT6A 2I8NA 2CKLB 5HQ6A 4MEPA 3N9LA 2KFTA 2YU4A 2R0SA 3UVDA 3MB4A 1CHCA 5CTLA 1WEMA 5DLXA 5D3TA 5AIUA 4YYIA 4QSTA 3S92A 5H1UA 5L99A 3HMEA 4NR8A 2HDPA 1F62A 4IORA 4V3KC 2OUOA 4PCIA 2VNFA 2L80A 5LVRA 2L5EA 3ZPVE 4CUSA 1WUGA 4A9EA 3SVFA 4QEUA 2E7NA 4YY4A 5C7NA 4XUAA 4TT2A 2RNYA 3DAIA 3AADA 2D82A 4AUQB 5E7DA 4Q0NA 2OO1A 3G0JA 1K2FA 2LQ6A 3SVHA 5EQ1A 5CP5A 5D3LA 5FG6A 1X4IA 3N9MA 3LJWA 5C8GA 4BJXA 2YQLA 5IGNA 3M62A 4YK0A 2C2VS 2LSPB 4QNSA 4QEWA 5CQAA 4PY6A 3P1EA 5E3DA 5DX4A 5B8DA 1U6GB 4NYXA 4C67A 4S3OB 5IGMA 3QZSA 4HXMA 4MR6A 2XEUA 1JM7B 1BORA 4QSRA 5HM0A 5F1HA 5EK9A 4YYKA 4GB0A 5LKUA 5FH7A 5D3NA 3TLPA 4A9LA 1WILA 4TZ8A 2F42A 1LDKC 2ECVA 5D26A 4NQMA 5CQ6A 4CUQA 2M1RA 2YURA 5DKCA 4UYFA 3UV5A 4ZUXU 4CLBA 1WEUA 5D1LB 3LXJA 5D25A 4A9KA 5I86A 4CUUA 5HQ5A 3AQAA 4NR4A 3ZYUA 4PCEA 2K4DA 5FE4A 2DKWA 4WZ3B 5KH7A 5IGKA 3U5MA 5I40A 5J0DA 3DQVR 2WP2A 2G4AA 5I89A 5KTXA 5ACYA 5FE2A 5FE7A 4FJCA 5HRWA 4NUDA 4HXSA 4NRAA 4HXLA 5C13A 2KU3A 4A9MA 3N9OA 3HMFA 2QICA 4XI1A 4YABA 4QF2A 1JSPB 4QEVA 3MHSA 1RMDA 5ETBA 4N4HA 4TTEA 4ZC9A 4ALHA 4IR3A 5DY7A 5LKTA 4FLPA 5CRZA 2VJFA 4UIWA 5HELA 5L8TA 2IDAA 4LRGA 5FE6A 4Y03A 4YATA 1T1HA 1WEEA 2FUUA 5D1KB 2JMDA 5FG5A 5BT3A 3KNVA 2ECTA 4MVTA 3N9NA 4LYSA 3PHDA 4A0CD 2EA6A 5TABA 3M63A 4LZ2A 4OGIA 4UIUA 2DWWA 1VD4A 1WFKA 4W4UA 4TU6A 3U5JA 5C4QA 2MD7B 3MHHA 5BT4A 5J3XA 4J0RA 4O7AA 3V43A 4HXPA 4NRCA 4QC1A 5BT5A 2ECWA 4LADB 5DYUA 4NQNA 5L96A 5H9MA 4YYMA 4IOOA 5TBNA 2OSSA 3S91A 3ZTGA 5A5OA 2LGKA 5H85A 1G25A 4A9FA 1WEOA 1X4UA 2YUCA 4HXKA 4YADA 4AKNA 4A4CA 4QSPA 4O78A 4C9ZA 2YSJA 4CFKA 4NR7A 4ALGA 4I7CA 5TRBA 4QY4A 4UITA 4IC2A 2KWJA 4I7BA 5DYAA 2LN0A 5DYCA 5C85A 4UP0A 5L97A 3RPGC 5CUBA 3DWYA 4Q0OA 2I50A 2DVQA 4QSXA 5G04B 4PTBA 5D7XA 2L84A 5KHMA 5G0FA 4NS5A 5FE3A 5CUCA 5A5NA 2MT5A 5FFVA 2XB1A 3Q2FA 2JRJA 3U5OA 5E9MA 5D0CA 4QZSA 2YQDA 4YAXA 3P1CA 5EU1A 5EPRA 2MNZA 3M99A 5CQ3A 5EA1A 5EPSA 5EICA 2RSDA 5F62A 5EWCA 3GL6A 4KCXA 2L0BA 4GNFA 4MR5A 4QUUA 4YYDA 1JM4B 2Y1MA 2LGVA 3PURA 1F68A 1XWHA 5FB0A 4BHWA 5FE1A 3L11A 5E74A 4O76A 3C6WA 4QR5A 5JWMA 4PS5A 4A9HA 2Y43A 3EB5A 4F3IA 4Q6FA 4BW4A 5K29A 2MD8C 1X4JA 2QIZA 3MUKA 4L7XA 4TYLA 2BAYA 5EGUA 2MA6A 5FE8A 4IR5A 2KWNA 4A9OA 4J3IA 5IBNA 4A4BA 4N4IA 2R10A 3O34A 4TQNA 5F36A 5G4SA 3U5KA 3O37A 2LGGA 5A83A 2L85A 5IIDA 4QYDA 2L5UA 5II2A 2EGPA 5B77A 5CUEA 4A9IA 5A81A 1MM2A 4TT4A 4QYLA 2CSZA 3D7CA 4NUEA 2VPEA 2ECNA 2F6NA 5CQ7A 2YQMA 3KV6A 4HBWA 5CQ5A 2LV9A 5DYXA 5KU3A 1WESA 4AYCA 4IC3A 2WP1A 4WIVA 4QBMA 4QSSA 2E6SA 2K1JA 5HQ7A 4J1PA 2LDRA 4IR4A 4BW3A 4PKLA 3JVKA 5FEYA 4CCGX 4GPJA 2QJ0A 5EPBA 5F63A 4S3OC 5LCWB 2YYRA 5KTWA 4B86C 2YDWA 4QR3A 4O64A 5EWHA 5JI8A 3HMHA 1VYXA 5F3AA 2KIZA 5HFRA 2VJEB 2G6QA 2F6JA 5AMFA 4N3WA 5EWWA 3ASLA 4A49A 2FSAA 3UW9A 4R2YA 4WHUA 4BBQA 4MSXA 2RO1A 5ENCA 5II1A 3T6RA 4FK5A 5B75A 3RTRB 2FUIA 5DLZA 5HJCA 4YYGA 3FKMX 3ZYQA 4O7FA 4TU4A 2KYUA 3UVXA 4TS8A 5KH3A 4YC9A 5ETDA 2RNWA 2VPGA 5H1TA 5E0RA 3C5KA 4GNDA 3P5OA 4NUCA 4C66A 4UIVA 4LZRA 5CU8A 5I29A 2KGIA 5CS8A 5AD3A 3K2JA 4NYWA 2KWKA 5TCMA 2M85A 2VPDA 4Z1QA 2E3KA 4IOQA 2YELA 1MM3A 5DFDA 4HXNA 3DPLR 5FFYA 1N87A 2DATA 5I3LA 5EP7A 3GG3A 5F60A 3ONIA 4DONA 1V87A 4UIZA 1FBVA 5IGLA 5CFWA 4HBYA 2YW5A 4OUFA 4O7CA 4NN2A 2RFJA 4A9JA 5AD2A 4UI9B 5E3GA 5HFQA 5F1LA 5ENFA 5CUDA 2DVVA 1WGMA 4MEOA 5TB6A 3RPGB 1HYIA 3SOWA 3HTKC 4QSWA 2LXPC 4BW2A 4HBVA 2H0DA 2LGLA 3UV2A 5IG6A 4GNGA 5D3SA 5CPEA 5F2PA 2G45A 5L8UA 2UZGA 5I83A 3JVMA 4WZ0A 1IYMA 2DVSA 4NXJA 4E96A 4LJNA 3N9PA 4RVRA 1WIMA 3T7LA 4QR4A 3Q2EA 4UYDA 5JG6A 5A5PA 5LJ2A 1ZS5A 3SOXA 5ENIA 2JMIA 5F25A 2ZETC 4UIYA 3VK6A 5EI4A 5C89A 2E7OA 2H60A 4LYIA 4NR5A 2CSYA 2G43A 5E9IA 5FH6A 1EQFA 2D8SA 4HXOA 4TKPB 3P1DA 5DW1A 3LQIA
chains in the Genus database with same CATH superfamily
4YBSA 5SVXA 3P1FA 3IU6A 2HYED 5TDWA 5C87A 4YH4A 2K17A 3ZVZB 4O7BA 4O71A 3U5LA 2DVRA 4NRBA 3RCWA 5LUUA 4N4GA 4X3GA 4UYEA 3O35A 2VJFB 4KV1A 1Z60A 2KREA 2XOZA 4AYCB 2VP7A 3IHPA 5E73A 5CY9A 4CL9A 3G0LA 2C2LA 2K16A 4NR6A 5F61A 5FE9A 5FERA 5CRMA 1JOCA 2R0VA 2OXQC 5ENJA 1Z6UA 5DBMA 2H0DB 4IR6A 5KH9A 4AKGA 1PUOA 4YBMA 4YYHA 2AN6A 2EJNA 1LDJB 4MEQA 4YH3A 5I1QA 5CQ4A 5DFBA 2FD4A 1WE9A 3LVQE 5TDRA 5D24A 2YREA 4J0SA 1WEVA 5F5ZA 3LQHA 3GV4A 2LAUA 3DWDA 4QC3A 3O7AA 4HXRA 5D3JA 3MQMA 5I88A 3HCUA 4P5OB 4NR9A 2KTBB 5E9LA 5E9KA 5FE5A 1E4UA 3HCSA 4CFLA 4YYJA 2CRRA 3QZVA 5AITA 5A82A 2EGMA 4YYNA 2MA5A 5EM3A 5DKDA 4O74A 2D9EA 5A5RA 1WEPA 2LRIC 3O36A 5LKZA 4X2IA 5I7XA 5EVAA 4OGJA 5FB1A 5I80A 4O75A 4LDFA 5ENEA 5EWVA 4CURA 2GRCA 2YYNA 1ZBDB 4UYGA 5EWDA 4F52B 3HCTA 2DX8A 3O33A 2ECIA 3UVYA 4UP5A 4MR3A 5SVYA 2RS9B 3O47A 2Y1NA 3Q1DA 4LKAA 4O70A 5CQTA 5A5QA 4WHWA 5DKHA 4ZQLA 2YHNA 4R7EA 1N72A 4O72A 3SUBA 5D1MB 5LJ1A 3MXFA 2IQJA 4CA1A 5CUAA 5HENA 3UV4A 3U5NA 5SVIB 4O77A 5B76A 4UYFB 1VFYA 3PUQA 1WEQA 4QB3A 3MB3A 2YEKA 3KQIA 4LYWA 1Z2QA 4QUTA 3ZPV1 4R8PK 5D3PA 2RNXA 3ZVYA 5COIA 4HBXA 4YBTA 2ECGA 2R0YA 3FANA 3O70A 4OGEA 5HRXA 1X0JA 3SOUA 1JM7A 4B7YC 5ENGA 4BW1A 4LC2A 5DINA 3L1ZB 5EISA 3I2DA 4WZ2A 3I3JA 4XYAA 2CT2A 2KR4A 1FP0A 5LVQA 5E9YA 2YEMA 2YSMA 2KWOA 5HEMA 4Z0RA 5DFCA 4FO9A 3L1XA 3N9QA 5DW2A 5D3RA 2MUMA 4QSQA 5E9VA 4ZW1A 5B79A 4QSVA 4O7EA 4Z6HA 2L43A 2MIQA 1HYJA 3MULA 4Z93A 3LRQA 5EV9A 4Z6IA 1E6IA 5KTUA 4V3LC 4XUBA 4Z0OA 2N9GA 5LJ0A 5AMEA 4MR4A 2L75A 3FL2A 5B78A 4LLBA 2LXHC 4TZ2A 1WUMA 2RI7A 3KV5A 3JVLA 2EODA 5H1VA 3QZTA 1DVPA 3SVGA 4A9NA 4FIPA 5HCLA 4QF3A 5KO4A 2JMJA 3EB6A 5CUGA 4LK9A 2I7KA 4KV4A 5CQ8A 4ZDTA 5A5SA 2XP0A 5A85A 2PUYA 3NXBA 5FE0A 3JVJA 1WENA 2VPBA 3ZNIA 2YW8A 2CKLA 4L58A 4YY6A 3NG2A 3IU5A 5CGPA 2E6RA 5HRVA 5DKAA 2ECJA 1WEWA 4I7DA 4QSUA 5ENHA 4CUPA 4NYVA 3U5PA 2NXBA 5EYAF 4LZSA 4GNEA 2M3HA 4N4FA 2CSVA 5L98A 5C11A 5FBXA 2MJVB 3UVWA 4MENA 5LKXA 2KE1A 4AP4A 5D3HA 5HLSA 5A7CA 5ENBA 4UYHA 5G4RA 4UIXA 3DDTA 3LQJA 5FDZA 4PPEA 4AVXA 4CUTA 2MNYA 4Z1SA 4XY9A 5CZGA 2PNXA 3ERRA 2KGGA 2M13A 5FG4A 4WA6A 5FH8A 4XY8A 4LR6A 2M6MA 2E61A 2NAAA 3SHBA 5FFWA 3VKHA 2VJEA 5G05B 2YHOA 5I7YA 2YT5A 4TT6A 2P57A 2I8NA 2CKLB 5HQ6A 4MEPA 3N9LA 2KFTA 2YU4A 2R0SA 3UVDA 3MB4A 1CHCA 2RR4A 5CTLA 1WEMA 5DLXA 2D8UA 5D3TA 5AIUA 4YYIA 4QSTA 3S92A 5H1UA 5L99A 3HMEA 4NR8A 2HDPA 1F62A 4IORA 4V3KC 2OUOA 4PCIA 2VNFA 2L80A 5LVRA 2L5EA 3T9KA 3ZPVE 4CUSA 1WUGA 4A9EA 3SVFA 4QEUA 2DSMA 2E7NA 4YY4A 5C7NA 4XUAA 3LJUX 4TT2A 2RNYA 3DAIA 3AADA 2D82A 4AUQB 5E7DA 4Q0NA 2OO1A 3G0JA 1K2FA 2LQ6A 3SVHA 5EQ1A 5CP5A 5D3LA 5FG6A 1X4IA 3N9MA 3LJWA 5C8GA 4BJXA 4AKIA 5IGNA 2YQLA 4YK0A 2C2VS 3M62A 2LSPB 4QNSA 4QEWA 5CQAA 4PY6A 3P1EA 5E3DA 5DX4A 5B8DA 1U6GB 4NYXA 4C67A 4S3OB 5IGMA 3QZSA 4HXMA 4MR6A 2XEUA 1JM7B 1BORA 4QSRA 5HM0A 5F1HA 5EK9A 4YYKA 4GB0A 5LKUA 5FH7A 5D3NA 3TLPA 2JM3A 4A9LA 1WILA 4TZ8A 2F42A 1LDKC 2ECVA 5D26A 4NQMA 5CQ6A 4CUQA 2M1RA 2YURA 5DKCA 4UYFA 3UV5A 4ZUXU 4CLBA 1WEUA 5D1LB 3LXJA 5D25A 4A9KA 5I86A 4CUUA 5HQ5A 3AQAA 4NR4A 3ZYUA 4PCEA 2K4DA 5FE4A 2DKWA 4WZ3B 5KH7A 5IGKA 3U5MA 5I40A 5J0DA 3DQVR 2WP2A 2G4AA 5I89A 5KTXA 5ACYA 5FE2A 5FE7A 2FFWA 4FJCA 5HRWA 4NUDA 4HXSA 4NRAA 4HXLA 5C13A 2KU3A 4A9MA 3N9OA 3HMFA 2QICA 3PLWA 4YABA 4QF2A 4XI1A 3E2DA 1JSPB 4QEVA 3MHSA 1RMDA 5ETBA 4N4HA 4TTEA 4ZC9A 4ALHA 2OWAA 4IR3A 5DY7A 5LKTA 4FLPA 5CRZA 2VJFA 4UIWA 5HELA 5L8TA 2IDAA 4LRGA 5FE6A 4Y03A 4YATA 1T1HA 1WEEA 2FUUA 5D1KB 2JMDA 5FG5A 5BT3A 2YVRA 3KNVA 2ECTA 2B0OE 4MVTA 3N9NA 4LYSA 3PHDA 4A0CD 2EA6A 5TABA 3M63A 3M7KA 4LZ2A 4OGIA 4UIUA 2DWWA 1VD4A 1WFKA 4W4UA 4TU6A 3U5JA 5C4QA 2MD7B 3MHHA 5BT4A 5J3XA 4J0RA 4O7AA 3V43A 4HXPA 4NRCA 4QC1A 5BT5A 2ECWA 4LADB 5DYUA 4NQNA 5L96A 5H9MA 4YYMA 4IOOA 5TBNA 2OSSA 3S91A 3ZTGA 5A5OA 2LGKA 5H85A 1G25A 4A9FA 1WEOA 1X4UA 2YUCA 4HXKA 4YADA 4AKNA 4A4CA 4QSPA 4O78A 4C9ZA 2YSJA 4CFKA 4NR7A 4ALGA 4I7CA 5TRBA 4QY4A 4UITA 4IC2A 2KWJA 4I7BA 5DYAA 2LN0A 5DYCA 5C85A 4UP0A 5L97A 3RPGC 5CUBA 3DWYA 4Q0OA 2I50A 2DVQA 4QSXA 5G04B 4PTBA 5D7XA 2L84A 5KHMA 5G0FA 4NS5A 5FE3A 4OGCA 2XOYA 5CUCA 5A5NA 2MT5A 5FFVA 2XB1A 3Q2FA 1MBMA 2JRJA 3FM8C 3U5OA 5E9MA 5D0CA 4QZSA 2YQDA 4YAXA 3P1CA 5EU1A 5EPRA 2MNZA 3M99A 5CQ3A 5EA1A 5EPSA 5EICA 2RSDA 3FJUB 5F62A 5EWCA 3GL6A 4KCXA 2L0BA 4GNFA 4MR5A 4QUUA 4YYDA 1JM4B 2Y1MA 2LGVA 3PURA 1F68A 1XWHA 5FB0A 4BHWA 5FE1A 3L11A 5E74A 4O76A 3C6WA 4QR5A 5JWMA 4PS5A 4A9HA 2Y43A 3EB5A 4F3IA 4Q6FA 4BW4A 5K29A 2MD8C 1X4JA 2QIZA 3MUKA 4L7XA 4TYLA 2BAYA 5EGUA 2MA6A 5FE8A 4IR5A 2KWNA 2MKEA 4A9OA 4J3IA 5IBNA 4A4BA 4N4IA 2CRWA 2R10A 3D1DA 3O34A 4TQNA 5F36A 5G4SA 1DCQA 3U5KA 3O37A 2KKXA 2LGGA 3LDYA 5A83A 2L85A 3D1BA 4QYDA 5IIDA 2L5UA 5II2A 2EGPA 5B77A 5CUEA 4A9IA 5A81A 1MM2A 4TT4A 4QYLA 2DJAA 2CSZA 3D7CA 4NUEA 2L7PA 2VPEA 2ECNA 2F6NA 5CQ7A 2YQMA 3KDEC 3KV6A 4HBWA 5CQ5A 2LV9A 5DYXA 5KU3A 1WESA 4AYCA 4IC3A 2WP1A 4O62A 4WIVA 4QBMA 4QSSA 2E6SA 4AKHA 5HQ7A 4J1PA 2K1JA 2LDRA 4IR4A 4BW3A 4PKLA 3JVKA 5FEYA 4CCGX 4GPJA 2QJ0A 5EPBA 5F63A 4S3OC 5LCWB 2YYRA 5KTWA 4B86C 2YDWA 4QR3A 4O64A 5EWHA 5JI8A 3HMHA 1VYXA 5F3AA 2KIZA 5HFRA 2JUNA 2G6QA 2VJEB 2F6JA 5AMFA 4N3WA 5EWWA 2KKYA 3ASLA 2FSAA 3UW9A 4R2YA 4A49A 4WHUA 4BBQA 4AI6A 4MSXA 2RO1A 5ENCA 5II1A 5SVIA 3T6RA 4FK5A 5B75A 4H9DA 3RTRB 2FUIA 5DLZA 5HJCA 4YYGA 3FKMX 3FEHA 4O7FA 3ZYQA 4TU4A 2KYUA 3UVXA 4TS8A 5KH3A 4YC9A 5ETDA 2RNWA 2VPGA 5H1TA 5E0RA 4F1PA 3MDBC 3C5KA 4GNDA 3P5OA 4NUCA 3VKGA 4C66A 2CONA 4UIVA 2XOCA 3JUEA 4LZRA 5CU8A 5I29A 2KGIA 5CS8A 2EXUA 5AD3A 3K2JA 4NYWA 2KWKA 5TCMA 2M85A 3FAOA 2VPDA 4Z1QA 2E3KA 4IOQA 2YELA 1MM3A 5DFDA 4HXNA 3DPLR 5FFYA 1N87A 2DATA 5I3LA 5EP7A 3GG3A 5F60A 3ONIA 4DONA 1V87A 4UIZA 1FBVA 4QQ4A 5IGLA 5CFWA 3LVRE 4HBYA 2YW5A 4OUFA 4O7CA 4NN2A 2RFJA 4A9JA 5AD2A 4UI9B 5E3GA 5HFQA 5F1LA 5ENFA 5CUDA 2DVVA 1WGMA 4MEOA 5TB6A 3RPGB 1HYIA 3SOWA 3HTKC 4QSWA 2LXPC 4BW2A 4HBVA 2H0DA 2LGLA 3UV2A 5IG6A 4GNGA 5D3SA 5CPEA 5F2PA 2G45A 5L8UA 2UZGA 5I83A 3JVMA 3H7HA 4WZ0A 1IYMA 2DVSA 4NXJA 4E96A 5K3QA 4LJNA 3N9PA 4RVRA 1WIMA 3T7LA 4QR4A 3Q2EA 4UYDA 5JG6A 5A5PA 5LJ2A 1ZS5A 3SOXA 5ENIA 2JMIA 5F25A 2ZETC 4UIYA 3VK6A 5EI4A 5C89A 2E7OA 2H60A 4LYIA 4NR5A 2CSYA 2G43A 1ZKRA 5E9IA 5FH6A 1EQFA 2D8SA 4HXOA 4TKPB 3P1DA 5DW1A 3LQIA
chains in the Genus database with same CATH topology
4YBSA 3P1FA 3IU6A 2HYED 5TDWA 5C87A 4YH4A 2K17A 3ZVZB 4O7BA 4O71A 3U5LA 2DVRA 4NRBA 3RCWA 5LUUA 4N4GA 4X3GA 4UYEA 3O35A 2VJFB 4KV1A 1Z60A 2KREA 4AYCB 2VP7A 3IHPA 5E73A 5CY9A 4CL9A 3G0LA 2C2LA 2K16A 4NR6A 5F61A 5FE9A 5FERA 5CRMA 1JOCA 2R0VA 2OXQC 5ENJA 1Z6UA 5DBMA 2H0DB 4IR6A 5KH9A 4YBMA 4YYHA 2AN6A 1LDJB 4MEQA 4YH3A 5I1QA 5CQ4A 5DFBA 1WE9A 5TDRA 5D24A 2YREA 4J0SA 1WEVA 5F5ZA 3LQHA 3GV4A 3O7AA 4QC3A 4HXRA 5D3JA 3MQMA 5I88A 3HCUA 4P5OB 4NR9A 2KTBB 5E9LA 5E9KA 5FE5A 1E4UA 3HCSA 4CFLA 4YYJA 5AITA 3QZVA 5A82A 4YYNA 2MA5A 5EM3A 5DKDA 4O74A 2D9EA 5A5RA 1WEPA 2LRIC 3O36A 5LKZA 4X2IA 5I7XA 5EVAA 4OGJA 5FB1A 5I80A 4O75A 4LDFA 5ENEA 5EWVA 4CURA 2GRCA 2YYNA 1ZBDB 4UYGA 5EWDA 4F52B 3HCTA 2DX8A 3O33A 2ECIA 3UVYA 4UP5A 4MR3A 2RS9B 2Y1NA 4LKAA 4O70A 5CQTA 5A5QA 4WHWA 5DKHA 4ZQLA 2YHNA 4R7EA 1N72A 4O72A 5D1MB 5LJ1A 3MXFA 4CA1A 5CUAA 5HENA 3UV4A 3U5NA 4O77A 5B76A 4UYFB 1VFYA 3PUQA 1WEQA 4QB3A 3MB3A 2YEKA 3KQIA 4LYWA 1Z2QA 4QUTA 3ZPV1 4R8PK 5D3PA 2RNXA 3ZVYA 5COIA 4HBXA 4YBTA 2ECGA 2R0YA 3O70A 5HRXA 1X0JA 3SOUA 1JM7A 4B7YC 5ENGA 4BW1A 4LC2A 5DINA 3L1ZB 5EISA 3I2DA 4WZ2A 3I3JA 4XYAA 2CT2A 2KR4A 1FP0A 5LVQA 5E9YA 2YEMA 2YSMA 2KWOA 5HEMA 5DFCA 4FO9A 3L1XA 3N9QA 5DW2A 5D3RA 2MUMA 4QSQA 5E9VA 4ZW1A 5B79A 4QSVA 4O7EA 4Z6HA 2L43A 2MIQA 1HYJA 3MULA 4Z93A 3LRQA 5EV9A 4Z6IA 1E6IA 5KTUA 4V3LC 4XUBA 2N9GA 5LJ0A 5AMEA 4MR4A 2L75A 3FL2A 5B78A 4LLBA 2LXHC 4TZ2A 1WUMA 2RI7A 3KV5A 3JVLA 2EODA 5H1VA 3QZTA 1DVPA 3SVGA 4A9NA 4FIPA 5HCLA 4QF3A 5KO4A 2JMJA 3EB6A 5CUGA 4LK9A 2I7KA 4KV4A 5CQ8A 4ZDTA 5A5SA 5A85A 2PUYA 3NXBA 5FE0A 3JVJA 1WENA 2VPBA 3ZNIA 2YW8A 2CKLA 4L58A 4YY6A 3NG2A 3IU5A 5CGPA 2E6RA 5HRVA 5DKAA 2ECJA 1WEWA 4I7DA 4QSUA 5ENHA 4CUPA 4NYVA 3U5PA 2NXBA 5EYAF 4LZSA 4GNEA 2M3HA 4N4FA 5L98A 5C11A 5FBXA 2MJVB 3UVWA 4MENA 5LKXA 2KE1A 4AP4A 5D3HA 5HLSA 5A7CA 5ENBA 4UYHA 5G4RA 4UIXA 4AVXA 3LQJA 5FDZA 4PPEA 4CUTA 2MNYA 4Z1SA 4XY9A 5CZGA 2PNXA 2KGGA 5FG4A 4WA6A 5FH8A 4XY8A 4LR6A 2M6MA 2NAAA 3SHBA 5FFWA 2VJEA 5G05B 2YHOA 5I7YA 2YT5A 4TT6A 2I8NA 2CKLB 5HQ6A 4MEPA 3N9LA 2KFTA 2YU4A 2R0SA 3UVDA 3MB4A 1CHCA 5CTLA 1WEMA 5DLXA 5D3TA 5AIUA 4YYIA 4QSTA 3S92A 5H1UA 5L99A 3HMEA 4NR8A 2HDPA 1F62A 4IORA 4V3KC 2OUOA 4PCIA 2VNFA 2L80A 5LVRA 2L5EA 3ZPVE 4CUSA 1WUGA 4A9EA 3SVFA 4QEUA 2E7NA 4YY4A 5C7NA 4XUAA 4TT2A 2RNYA 3DAIA 3AADA 2D82A 4AUQB 5E7DA 4Q0NA 2OO1A 3G0JA 1K2FA 2LQ6A 3SVHA 5EQ1A 5CP5A 5D3LA 5FG6A 1X4IA 3N9MA 3LJWA 5C8GA 4BJXA 2YQLA 5IGNA 3M62A 4YK0A 2C2VS 2LSPB 4QNSA 4QEWA 5CQAA 4PY6A 3P1EA 5E3DA 5DX4A 5B8DA 1U6GB 4NYXA 4C67A 4S3OB 5IGMA 3QZSA 4HXMA 4MR6A 2XEUA 1JM7B 1BORA 4QSRA 5HM0A 5F1HA 5EK9A 4YYKA 4GB0A 5LKUA 5FH7A 5D3NA 3TLPA 4A9LA 1WILA 4TZ8A 2F42A 1LDKC 2ECVA 5D26A 4NQMA 5CQ6A 4CUQA 2M1RA 2YURA 5DKCA 4UYFA 3UV5A 4ZUXU 4CLBA 1WEUA 5D1LB 3LXJA 5D25A 4A9KA 5I86A 4CUUA 5HQ5A 3AQAA 4NR4A 3ZYUA 4PCEA 2K4DA 5FE4A 2DKWA 4WZ3B 5KH7A 5IGKA 3U5MA 5I40A 5J0DA 3DQVR 2WP2A 2G4AA 5I89A 5KTXA 5ACYA 5FE2A 5FE7A 4FJCA 5HRWA 4NUDA 4HXSA 4NRAA 4HXLA 5C13A 2KU3A 4A9MA 3N9OA 3HMFA 2QICA 4XI1A 4YABA 4QF2A 1JSPB 4QEVA 3MHSA 1RMDA 5ETBA 4N4HA 4TTEA 4ZC9A 4ALHA 4IR3A 5DY7A 5LKTA 4FLPA 5CRZA 2VJFA 4UIWA 5HELA 5L8TA 2IDAA 4LRGA 5FE6A 4Y03A 4YATA 1T1HA 1WEEA 2FUUA 5D1KB 2JMDA 5FG5A 5BT3A 3KNVA 2ECTA 4MVTA 3N9NA 4LYSA 3PHDA 4A0CD 2EA6A 5TABA 3M63A 4LZ2A 4OGIA 4UIUA 2DWWA 1VD4A 1WFKA 4W4UA 4TU6A 3U5JA 5C4QA 2MD7B 3MHHA 5BT4A 5J3XA 4J0RA 4O7AA 3V43A 4HXPA 4NRCA 4QC1A 5BT5A 2ECWA 4LADB 5DYUA 4NQNA 5L96A 5H9MA 4YYMA 4IOOA 5TBNA 2OSSA 3S91A 3ZTGA 5A5OA 2LGKA 5H85A 1G25A 4A9FA 1WEOA 1X4UA 2YUCA 4HXKA 4YADA 4AKNA 4A4CA 4QSPA 4O78A 4C9ZA 2YSJA 4CFKA 4NR7A 4ALGA 4I7CA 5TRBA 4QY4A 4UITA 4IC2A 2KWJA 4I7BA 5DYAA 2LN0A 5DYCA 5C85A 4UP0A 5L97A 3RPGC 5CUBA 3DWYA 4Q0OA 2I50A 2DVQA 4QSXA 5G04B 4PTBA 5D7XA 2L84A 5KHMA 5G0FA 4NS5A 5FE3A 5CUCA 5A5NA 2MT5A 5FFVA 2XB1A 3Q2FA 2JRJA 3U5OA 5E9MA 5D0CA 4QZSA 2YQDA 4YAXA 3P1CA 5EU1A 5EPRA 2MNZA 3M99A 5CQ3A 5EA1A 5EPSA 5EICA 2RSDA 5F62A 5EWCA 3GL6A 4KCXA 2L0BA 4GNFA 4MR5A 4QUUA 4YYDA 1JM4B 2Y1MA 2LGVA 3PURA 1F68A 1XWHA 5FB0A 4BHWA 5FE1A 3L11A 5E74A 4O76A 3C6WA 4QR5A 5JWMA 4PS5A 4A9HA 2Y43A 3EB5A 4F3IA 4Q6FA 4BW4A 5K29A 2MD8C 1X4JA 2QIZA 3MUKA 4L7XA 4TYLA 2BAYA 5EGUA 2MA6A 5FE8A 4IR5A 2KWNA 4A9OA 4J3IA 5IBNA 4A4BA 4N4IA 2R10A 3O34A 4TQNA 5F36A 5G4SA 3U5KA 3O37A 2LGGA 5A83A 2L85A 5IIDA 4QYDA 2L5UA 5II2A 2EGPA 5B77A 5CUEA 4A9IA 5A81A 1MM2A 4TT4A 4QYLA 2CSZA 3D7CA 4NUEA 2VPEA 2ECNA 2F6NA 5CQ7A 2YQMA 3KV6A 4HBWA 5CQ5A 2LV9A 5DYXA 5KU3A 1WESA 4AYCA 4IC3A 2WP1A 4WIVA 4QBMA 4QSSA 2E6SA 2K1JA 5HQ7A 4J1PA 2LDRA 4IR4A 4BW3A 4PKLA 3JVKA 5FEYA 4CCGX 4GPJA 2QJ0A 5EPBA 5F63A 4S3OC 5LCWB 2YYRA 5KTWA 4B86C 2YDWA 4QR3A 4O64A 5EWHA 5JI8A 3HMHA 1VYXA 5F3AA 2KIZA 5HFRA 2VJEB 2G6QA 2F6JA 5AMFA 4N3WA 5EWWA 3ASLA 4A49A 2FSAA 3UW9A 4R2YA 4WHUA 4BBQA 4MSXA 2RO1A 5ENCA 5II1A 3T6RA 4FK5A 5B75A 3RTRB 2FUIA 5DLZA 5HJCA 4YYGA 3FKMX 3ZYQA 4O7FA 4TU4A 2KYUA 3UVXA 4TS8A 5KH3A 4YC9A 5ETDA 2RNWA 2VPGA 5H1TA 5E0RA 3C5KA 4GNDA 3P5OA 4NUCA 4C66A 4UIVA 4LZRA 5CU8A 5I29A 2KGIA 5CS8A 5AD3A 3K2JA 4NYWA 2KWKA 5TCMA 2M85A 2VPDA 4Z1QA 2E3KA 4IOQA 2YELA 1MM3A 5DFDA 4HXNA 3DPLR 5FFYA 1N87A 2DATA 5I3LA 5EP7A 3GG3A 5F60A 3ONIA 4DONA 1V87A 4UIZA 1FBVA 5IGLA 5CFWA 4HBYA 2YW5A 4OUFA 4O7CA 4NN2A 2RFJA 4A9JA 5AD2A 4UI9B 5E3GA 5HFQA 5F1LA 5ENFA 5CUDA 2DVVA 1WGMA 4MEOA 5TB6A 3RPGB 1HYIA 3SOWA 3HTKC 4QSWA 2LXPC 4BW2A 4HBVA 2H0DA 2LGLA 3UV2A 5IG6A 4GNGA 5D3SA 5CPEA 5F2PA 2G45A 5L8UA 2UZGA 5I83A 3JVMA 4WZ0A 1IYMA 2DVSA 4NXJA 4E96A 4LJNA 3N9PA 4RVRA 1WIMA 3T7LA 4QR4A 3Q2EA 4UYDA 5JG6A 5A5PA 5LJ2A 1ZS5A 3SOXA 5ENIA 2JMIA 5F25A 2ZETC 4UIYA 3VK6A 5EI4A 5C89A 2E7OA 2H60A 4LYIA 4NR5A 2CSYA 2G43A 5E9IA 5FH6A 1EQFA 2D8SA 4HXOA 4TKPB 3P1DA 5DW1A 3LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBS A;  3P1F A;  3IU6 A;  2HYE D;  5TDW A;  5C87 A;  4YH4 A;  2K17 A;  3ZVZ B;  4O7B A;  4O71 A;  3U5L A;  2DVR A;  4NRB A;  3RCW A;  5LUU A;  4N4G A;  4X3G A;  4UYE A;  3O35 A;  2VJF B;  4KV1 A;  1Z60 A;  2KRE A;  4AYC B;  2VP7 A;  3IHP A;  5E73 A;  5CY9 A;  4CL9 A;  3G0L A;  2C2L A;  2K16 A;  4NR6 A;  5F61 A;  5FE9 A;  5FER A;  5CRM A;  1JOC A;  2R0V A;  2OXQ C;  5ENJ A;  1Z6U A;  5DBM A;  2H0D B;  4IR6 A;  5KH9 A;  4YBM A;  4YYH A;  2AN6 A;  1LDJ B;  4MEQ A;  4YH3 A;  5I1Q A;  5CQ4 A;  5DFB A;  1WE9 A;  5TDR A;  5D24 A;  2YRE A;  4J0S A;  1WEV A;  5F5Z A;  3LQH A;  3GV4 A;  3O7A A;  4QC3 A;  4HXR A;  5D3J A;  3MQM A;  5I88 A;  3HCU A;  4P5O B;  4NR9 A;  2KTB B;  5E9L A;  5E9K A;  5FE5 A;  1E4U A;  3HCS A;  4CFL A;  4YYJ A;  5AIT A;  3QZV A;  5A82 A;  4YYN A;  2MA5 A;  5EM3 A;  5DKD A;  4O74 A;  2D9E A;  5A5R A;  1WEP A;  2LRI C;  3O36 A;  5LKZ A;  4X2I A;  5I7X A;  5EVA A;  4OGJ A;  5FB1 A;  5I80 A;  4O75 A;  4LDF A;  5ENE A;  5EWV A;  4CUR A;  2GRC A;  2YYN A;  1ZBD B;  4UYG A;  5EWD A;  4F52 B;  3HCT A;  2DX8 A;  3O33 A;  2ECI A;  3UVY A;  4UP5 A;  4MR3 A;  2RS9 B;  2Y1N A;  4LKA A;  4O70 A;  5CQT A;  5A5Q A;  4WHW A;  5DKH A;  4ZQL A;  2YHN A;  4R7E A;  1N72 A;  4O72 A;  5D1M B;  5LJ1 A;  3MXF A;  4CA1 A;  5CUA A;  5HEN A;  3UV4 A;  3U5N A;  4O77 A;  5B76 A;  4UYF B;  1VFY A;  3PUQ A;  1WEQ A;  4QB3 A;  3MB3 A;  2YEK A;  3KQI A;  4LYW A;  1Z2Q A;  4QUT A;  3ZPV 1;  4R8P K;  5D3P A;  2RNX A;  3ZVY A;  5COI A;  4HBX A;  4YBT A;  2ECG A;  2R0Y A;  3O70 A;  5HRX A;  1X0J A;  3SOU A;  1JM7 A;  4B7Y C;  5ENG A;  4BW1 A;  4LC2 A;  5DIN A;  3L1Z B;  5EIS A;  3I2D A;  4WZ2 A;  3I3J A;  4XYA A;  2CT2 A;  2KR4 A;  1FP0 A;  5LVQ A;  5E9Y A;  2YEM A;  2YSM A;  2KWO A;  5HEM A;  5DFC A;  4FO9 A;  3L1X A;  3N9Q A;  5DW2 A;  5D3R A;  2MUM A;  4QSQ A;  5E9V A;  4ZW1 A;  5B79 A;  4QSV A;  4O7E A;  4Z6H A;  2L43 A;  2MIQ A;  1HYJ A;  3MUL A;  4Z93 A;  3LRQ A;  5EV9 A;  4Z6I A;  1E6I A;  5KTU A;  4V3L C;  4XUB A;  2N9G A;  5LJ0 A;  5AME A;  4MR4 A;  2L75 A;  3FL2 A;  5B78 A;  4LLB A;  2LXH C;  4TZ2 A;  1WUM A;  2RI7 A;  3KV5 A;  3JVL A;  2EOD A;  5H1V A;  3QZT A;  1DVP A;  3SVG A;  4A9N A;  4FIP A;  5HCL A;  4QF3 A;  5KO4 A;  2JMJ A;  3EB6 A;  5CUG A;  4LK9 A;  2I7K A;  4KV4 A;  5CQ8 A;  4ZDT A;  5A5S A;  5A85 A;  2PUY A;  3NXB A;  5FE0 A;  3JVJ A;  1WEN A;  2VPB A;  3ZNI A;  2YW8 A;  2CKL A;  4L58 A;  4YY6 A;  3NG2 A;  3IU5 A;  5CGP A;  2E6R A;  5HRV A;  5DKA A;  2ECJ A;  1WEW A;  4I7D A;  4QSU A;  5ENH A;  4CUP A;  4NYV A;  3U5P A;  2NXB A;  5EYA F;  4LZS A;  4GNE A;  2M3H A;  4N4F A;  5L98 A;  5C11 A;  5FBX A;  2MJV B;  3UVW A;  4MEN A;  5LKX A;  2KE1 A;  4AP4 A;  5D3H A;  5HLS A;  5A7C A;  5ENB A;  4UYH A;  5G4R A;  4UIX A;  4AVX A;  3LQJ A;  5FDZ A;  4PPE A;  4CUT A;  2MNY A;  4Z1S A;  4XY9 A;  5CZG A;  2PNX A;  2KGG A;  5FG4 A;  4WA6 A;  5FH8 A;  4XY8 A;  4LR6 A;  2M6M A;  2NAA A;  3SHB A;  5FFW A;  2VJE A;  5G05 B;  2YHO A;  5I7Y A;  2YT5 A;  4TT6 A;  2I8N A;  2CKL B;  5HQ6 A;  4MEP A;  3N9L A;  2KFT A;  2YU4 A;  2R0S A;  3UVD A;  3MB4 A;  1CHC A;  5CTL A;  1WEM A;  5DLX A;  5D3T A;  5AIU A;  4YYI A;  4QST A;  3S92 A;  5H1U A;  5L99 A;  3HME A;  4NR8 A;  2HDP A;  1F62 A;  4IOR A;  4V3K C;  2OUO A;  4PCI A;  2VNF A;  2L80 A;  5LVR A;  2L5E A;  3ZPV E;  4CUS A;  1WUG A;  4A9E A;  3SVF A;  4QEU A;  2E7N A;  4YY4 A;  5C7N A;  4XUA A;  4TT2 A;  2RNY A;  3DAI A;  3AAD A;  2D82 A;  4AUQ B;  5E7D A;  4Q0N A;  2OO1 A;  3G0J A;  1K2F A;  2LQ6 A;  3SVH A;  5EQ1 A;  5CP5 A;  5D3L A;  5FG6 A;  1X4I A;  3N9M A;  3LJW A;  5C8G A;  4BJX A;  2YQL A;  5IGN A;  3M62 A;  4YK0 A;  2C2V S;  2LSP B;  4QNS A;  4QEW A;  5CQA A;  4PY6 A;  3P1E A;  5E3D A;  5DX4 A;  5B8D A;  1U6G B;  4NYX A;  4C67 A;  4S3O B;  5IGM A;  3QZS A;  4HXM A;  4MR6 A;  2XEU A;  1JM7 B;  1BOR A;  4QSR A;  5HM0 A;  5F1H A;  5EK9 A;  4YYK A;  4GB0 A;  5LKU A;  5FH7 A;  5D3N A;  3TLP A;  4A9L A;  1WIL A;  4TZ8 A;  2F42 A;  1LDK C;  2ECV A;  5D26 A;  4NQM A;  5CQ6 A;  4CUQ A;  2M1R A;  2YUR A;  5DKC A;  4UYF A;  3UV5 A;  4ZUX U;  4CLB A;  1WEU A;  5D1L B;  3LXJ A;  5D25 A;  4A9K A;  5I86 A;  4CUU A;  5HQ5 A;  3AQA A;  4NR4 A;  3ZYU A;  4PCE A;  2K4D A;  5FE4 A;  2DKW A;  4WZ3 B;  5KH7 A;  5IGK A;  3U5M A;  5I40 A;  5J0D A;  3DQV R;  2WP2 A;  2G4A A;  5I89 A;  5KTX A;  5ACY A;  5FE2 A;  5FE7 A;  4FJC A;  5HRW A;  4NUD A;  4HXS A;  4NRA A;  4HXL A;  5C13 A;  2KU3 A;  4A9M A;  3N9O A;  3HMF A;  2QIC A;  4XI1 A;  4YAB A;  4QF2 A;  1JSP B;  4QEV A;  3MHS A;  1RMD A;  5ETB A;  4N4H A;  4TTE A;  4ZC9 A;  4ALH A;  4IR3 A;  5DY7 A;  5LKT A;  4FLP A;  5CRZ A;  2VJF A;  4UIW A;  5HEL A;  5L8T A;  2IDA A;  4LRG A;  5FE6 A;  4Y03 A;  4YAT A;  1T1H A;  1WEE A;  2FUU A;  5D1K B;  2JMD A;  5FG5 A;  5BT3 A;  3KNV A;  2ECT A;  4MVT A;  3N9N A;  4LYS A;  3PHD A;  4A0C D;  2EA6 A;  5TAB A;  3M63 A;  4LZ2 A;  4OGI A;  4UIU A;  2DWW A;  1VD4 A;  1WFK A;  4W4U A;  4TU6 A;  3U5J A;  5C4Q A;  2MD7 B;  3MHH A;  5BT4 A;  5J3X A;  4J0R A;  4O7A A;  3V43 A;  4HXP A;  4NRC A;  4QC1 A;  5BT5 A;  2ECW A;  4LAD B;  5DYU A;  4NQN A;  5L96 A;  5H9M A;  4YYM A;  4IOO A;  5TBN A;  2OSS A;  3S91 A;  3ZTG A;  5A5O A;  2LGK A;  5H85 A;  1G25 A;  4A9F A;  1WEO A;  1X4U A;  2YUC A;  4HXK A;  4YAD A;  4AKN A;  4A4C A;  4QSP A;  4O78 A;  4C9Z A;  2YSJ A;  4CFK A;  4NR7 A;  4ALG A;  4I7C A;  5TRB A;  4QY4 A;  4UIT A;  4IC2 A;  2KWJ A;  4I7B A;  5DYA A;  2LN0 A;  5DYC A;  5C85 A;  4UP0 A;  5L97 A;  3RPG C;  5CUB A;  3DWY A;  4Q0O A;  2I50 A;  2DVQ A;  4QSX A;  5G04 B;  4PTB A;  5D7X A;  2L84 A;  5KHM A;  5G0F A;  4NS5 A;  5FE3 A;  5CUC A;  5A5N A;  2MT5 A;  5FFV A;  2XB1 A;  3Q2F A;  2JRJ A;  3U5O A;  5E9M A;  5D0C A;  4QZS A;  2YQD A;  4YAX A;  3P1C A;  5EU1 A;  5EPR A;  2MNZ A;  3M99 A;  5CQ3 A;  5EA1 A;  5EPS A;  5EIC A;  2RSD A;  5F62 A;  5EWC A;  3GL6 A;  4KCX A;  2L0B A;  4GNF A;  4MR5 A;  4QUU A;  4YYD A;  1JM4 B;  2Y1M A;  2LGV A;  3PUR A;  1F68 A;  1XWH A;  5FB0 A;  4BHW A;  5FE1 A;  3L11 A;  5E74 A;  4O76 A;  3C6W A;  4QR5 A;  5JWM A;  4PS5 A;  4A9H A;  2Y43 A;  3EB5 A;  4F3I A;  4Q6F A;  4BW4 A;  5K29 A;  2MD8 C;  1X4J A;  2QIZ A;  3MUK A;  4L7X A;  4TYL A;  2BAY A;  5EGU A;  2MA6 A;  5FE8 A;  4IR5 A;  2KWN A;  4A9O A;  4J3I A;  5IBN A;  4A4B A;  4N4I A;  2R10 A;  3O34 A;  4TQN A;  5F36 A;  5G4S A;  3U5K A;  3O37 A;  2LGG A;  5A83 A;  2L85 A;  5IID A;  4QYD A;  2L5U A;  5II2 A;  2EGP A;  5B77 A;  5CUE A;  4A9I A;  5A81 A;  1MM2 A;  4TT4 A;  4QYL A;  2CSZ A;  3D7C A;  4NUE A;  2VPE A;  2ECN A;  2F6N A;  5CQ7 A;  2YQM A;  3KV6 A;  4HBW A;  5CQ5 A;  2LV9 A;  5DYX A;  5KU3 A;  1WES A;  4AYC A;  4IC3 A;  2WP1 A;  4WIV A;  4QBM A;  4QSS A;  2E6S A;  2K1J A;  5HQ7 A;  4J1P A;  2LDR A;  4IR4 A;  4BW3 A;  4PKL A;  3JVK A;  5FEY A;  4CCG X;  4GPJ A;  2QJ0 A;  5EPB A;  5F63 A;  4S3O C;  5LCW B;  2YYR A;  5KTW A;  4B86 C;  2YDW A;  4QR3 A;  4O64 A;  5EWH A;  5JI8 A;  3HMH A;  1VYX A;  5F3A A;  2KIZ A;  5HFR A;  2VJE B;  2G6Q A;  2F6J A;  5AMF A;  4N3W A;  5EWW A;  3ASL A;  4A49 A;  2FSA A;  3UW9 A;  4R2Y A;  4WHU A;  4BBQ A;  4MSX A;  2RO1 A;  5ENC A;  5II1 A;  3T6R A;  4FK5 A;  5B75 A;  3RTR B;  2FUI A;  5DLZ A;  5HJC A;  4YYG A;  3FKM X;  3ZYQ A;  4O7F A;  4TU4 A;  2KYU A;  3UVX A;  4TS8 A;  5KH3 A;  4YC9 A;  5ETD A;  2RNW A;  2VPG A;  5H1T A;  5E0R A;  3C5K A;  4GND A;  3P5O A;  4NUC A;  4C66 A;  4UIV A;  4LZR A;  5CU8 A;  5I29 A;  2KGI A;  5CS8 A;  5AD3 A;  3K2J A;  4NYW A;  2KWK A;  5TCM A;  2M85 A;  2VPD A;  4Z1Q A;  2E3K A;  4IOQ A;  2YEL A;  1MM3 A;  5DFD A;  4HXN A;  3DPL R;  5FFY A;  1N87 A;  2DAT A;  5I3L A;  5EP7 A;  3GG3 A;  5F60 A;  3ONI A;  4DON A;  1V87 A;  4UIZ A;  1FBV A;  5IGL A;  5CFW A;  4HBY A;  2YW5 A;  4OUF A;  4O7C A;  4NN2 A;  2RFJ A;  4A9J A;  5AD2 A;  4UI9 B;  5E3G A;  5HFQ A;  5F1L A;  5ENF A;  5CUD A;  2DVV A;  1WGM A;  4MEO A;  5TB6 A;  3RPG B;  1HYI A;  3SOW A;  3HTK C;  4QSW A;  2LXP C;  4BW2 A;  4HBV A;  2H0D A;  2LGL A;  3UV2 A;  5IG6 A;  4GNG A;  5D3S A;  5CPE A;  5F2P A;  2G45 A;  5L8U A;  2UZG A;  5I83 A;  3JVM A;  4WZ0 A;  1IYM A;  2DVS A;  4NXJ A;  4E96 A;  4LJN A;  3N9P A;  4RVR A;  1WIM A;  3T7L A;  4QR4 A;  3Q2E A;  4UYD A;  5JG6 A;  5A5P A;  5LJ2 A;  1ZS5 A;  3SOX A;  5ENI A;  2JMI A;  5F25 A;  2ZET C;  4UIY A;  3VK6 A;  5EI4 A;  5C89 A;  2E7O A;  2H60 A;  4LYI A;  4NR5 A;  2CSY A;  2G43 A;  5E9I A;  5FH6 A;  1EQF A;  2D8S A;  4HXO A;  4TKP B;  3P1D A;  5DW1 A;  3LQI A; 
#chains in the Genus database with same CATH topology
 4YBS A;  5SVX A;  3P1F A;  3IU6 A;  2HYE D;  5TDW A;  5C87 A;  4YH4 A;  2K17 A;  3ZVZ B;  4O7B A;  4O71 A;  3U5L A;  2DVR A;  4NRB A;  3RCW A;  5LUU A;  4N4G A;  4X3G A;  4UYE A;  3O35 A;  2VJF B;  4KV1 A;  1Z60 A;  2KRE A;  2XOZ A;  4AYC B;  2VP7 A;  3IHP A;  5E73 A;  5CY9 A;  4CL9 A;  3G0L A;  2C2L A;  2K16 A;  4NR6 A;  5F61 A;  5FE9 A;  5FER A;  5CRM A;  1JOC A;  2R0V A;  2OXQ C;  5ENJ A;  1Z6U A;  5DBM A;  2H0D B;  4IR6 A;  5KH9 A;  4AKG A;  1PUO A;  4YBM A;  4YYH A;  2AN6 A;  2EJN A;  1LDJ B;  4MEQ A;  4YH3 A;  5I1Q A;  5CQ4 A;  5DFB A;  2FD4 A;  1WE9 A;  3LVQ E;  5TDR A;  5D24 A;  2YRE A;  4J0S A;  1WEV A;  5F5Z A;  3LQH A;  3GV4 A;  2LAU A;  3DWD A;  4QC3 A;  3O7A A;  4HXR A;  5D3J A;  3MQM A;  5I88 A;  3HCU A;  4P5O B;  4NR9 A;  2KTB B;  5E9L A;  5E9K A;  5FE5 A;  1E4U A;  3HCS A;  4CFL A;  4YYJ A;  2CRR A;  3QZV A;  5AIT A;  5A82 A;  2EGM A;  4YYN A;  2MA5 A;  5EM3 A;  5DKD A;  4O74 A;  2D9E A;  5A5R A;  1WEP A;  2LRI C;  3O36 A;  5LKZ A;  4X2I A;  5I7X A;  5EVA A;  4OGJ A;  5FB1 A;  5I80 A;  4O75 A;  4LDF A;  5ENE A;  5EWV A;  4CUR A;  2GRC A;  2YYN A;  1ZBD B;  4UYG A;  5EWD A;  4F52 B;  3HCT A;  2DX8 A;  3O33 A;  2ECI A;  3UVY A;  4UP5 A;  4MR3 A;  5SVY A;  2RS9 B;  3O47 A;  2Y1N A;  3Q1D A;  4LKA A;  4O70 A;  5CQT A;  5A5Q A;  4WHW A;  5DKH A;  4ZQL A;  2YHN A;  4R7E A;  1N72 A;  4O72 A;  3SUB A;  5D1M B;  5LJ1 A;  3MXF A;  2IQJ A;  4CA1 A;  5CUA A;  5HEN A;  3UV4 A;  3U5N A;  5SVI B;  4O77 A;  5B76 A;  4UYF B;  1VFY A;  3PUQ A;  1WEQ A;  4QB3 A;  3MB3 A;  2YEK A;  3KQI A;  4LYW A;  1Z2Q A;  4QUT A;  3ZPV 1;  4R8P K;  5D3P A;  2RNX A;  3ZVY A;  5COI A;  4HBX A;  4YBT A;  2ECG A;  2R0Y A;  3FAN A;  3O70 A;  4OGE A;  5HRX A;  1X0J A;  3SOU A;  1JM7 A;  4B7Y C;  5ENG A;  4BW1 A;  4LC2 A;  5DIN A;  3L1Z B;  5EIS A;  3I2D A;  4WZ2 A;  3I3J A;  4XYA A;  2CT2 A;  2KR4 A;  1FP0 A;  5LVQ A;  5E9Y A;  2YEM A;  2YSM A;  2KWO A;  5HEM A;  4Z0R A;  5DFC A;  4FO9 A;  3L1X A;  3N9Q A;  5DW2 A;  5D3R A;  2MUM A;  4QSQ A;  5E9V A;  4ZW1 A;  5B79 A;  4QSV A;  4O7E A;  4Z6H A;  2L43 A;  2MIQ A;  1HYJ A;  3MUL A;  4Z93 A;  3LRQ A;  5EV9 A;  4Z6I A;  1E6I A;  5KTU A;  4V3L C;  4XUB A;  4Z0O A;  2N9G A;  5LJ0 A;  5AME A;  4MR4 A;  2L75 A;  3FL2 A;  5B78 A;  4LLB A;  2LXH C;  4TZ2 A;  1WUM A;  2RI7 A;  3KV5 A;  3JVL A;  2EOD A;  5H1V A;  3QZT A;  1DVP A;  3SVG A;  4A9N A;  4FIP A;  5HCL A;  4QF3 A;  5KO4 A;  2JMJ A;  3EB6 A;  5CUG A;  4LK9 A;  2I7K A;  4KV4 A;  5CQ8 A;  4ZDT A;  5A5S A;  2XP0 A;  5A85 A;  2PUY A;  3NXB A;  5FE0 A;  3JVJ A;  1WEN A;  2VPB A;  3ZNI A;  2YW8 A;  2CKL A;  4L58 A;  4YY6 A;  3NG2 A;  3IU5 A;  5CGP A;  2E6R A;  5HRV A;  5DKA A;  2ECJ A;  1WEW A;  4I7D A;  4QSU A;  5ENH A;  4CUP A;  4NYV A;  3U5P A;  2NXB A;  5EYA F;  4LZS A;  4GNE A;  2M3H A;  4N4F A;  2CSV A;  5L98 A;  5C11 A;  5FBX A;  2MJV B;  3UVW A;  4MEN A;  5LKX A;  2KE1 A;  4AP4 A;  5D3H A;  5HLS A;  5A7C A;  5ENB A;  4UYH A;  5G4R A;  4UIX A;  3DDT A;  3LQJ A;  5FDZ A;  4PPE A;  4AVX A;  4CUT A;  2MNY A;  4Z1S A;  4XY9 A;  5CZG A;  2PNX A;  3ERR A;  2KGG A;  2M13 A;  5FG4 A;  4WA6 A;  5FH8 A;  4XY8 A;  4LR6 A;  2M6M A;  2E61 A;  2NAA A;  3SHB A;  5FFW A;  3VKH A;  2VJE A;  5G05 B;  2YHO A;  5I7Y A;  2YT5 A;  4TT6 A;  2P57 A;  2I8N A;  2CKL B;  5HQ6 A;  4MEP A;  3N9L A;  2KFT A;  2YU4 A;  2R0S A;  3UVD A;  3MB4 A;  1CHC A;  2RR4 A;  5CTL A;  1WEM A;  5DLX A;  2D8U A;  5D3T A;  5AIU A;  4YYI A;  4QST A;  3S92 A;  5H1U A;  5L99 A;  3HME A;  4NR8 A;  2HDP A;  1F62 A;  4IOR A;  4V3K C;  2OUO A;  4PCI A;  2VNF A;  2L80 A;  5LVR A;  2L5E A;  3T9K A;  3ZPV E;  4CUS A;  1WUG A;  4A9E A;  3SVF A;  4QEU A;  2DSM A;  2E7N A;  4YY4 A;  5C7N A;  4XUA A;  3LJU X;  4TT2 A;  2RNY A;  3DAI A;  3AAD A;  2D82 A;  4AUQ B;  5E7D A;  4Q0N A;  2OO1 A;  3G0J A;  1K2F A;  2LQ6 A;  3SVH A;  5EQ1 A;  5CP5 A;  5D3L A;  5FG6 A;  1X4I A;  3N9M A;  3LJW A;  5C8G A;  4BJX A;  4AKI A;  5IGN A;  2YQL A;  4YK0 A;  2C2V S;  3M62 A;  2LSP B;  4QNS A;  4QEW A;  5CQA A;  4PY6 A;  3P1E A;  5E3D A;  5DX4 A;  5B8D A;  1U6G B;  4NYX A;  4C67 A;  4S3O B;  5IGM A;  3QZS A;  4HXM A;  4MR6 A;  2XEU A;  1JM7 B;  1BOR A;  4QSR A;  5HM0 A;  5F1H A;  5EK9 A;  4YYK A;  4GB0 A;  5LKU A;  5FH7 A;  5D3N A;  3TLP A;  2JM3 A;  4A9L A;  1WIL A;  4TZ8 A;  2F42 A;  1LDK C;  2ECV A;  5D26 A;  4NQM A;  5CQ6 A;  4CUQ A;  2M1R A;  2YUR A;  5DKC A;  4UYF A;  3UV5 A;  4ZUX U;  4CLB A;  1WEU A;  5D1L B;  3LXJ A;  5D25 A;  4A9K A;  5I86 A;  4CUU A;  5HQ5 A;  3AQA A;  4NR4 A;  3ZYU A;  4PCE A;  2K4D A;  5FE4 A;  2DKW A;  4WZ3 B;  5KH7 A;  5IGK A;  3U5M A;  5I40 A;  5J0D A;  3DQV R;  2WP2 A;  2G4A A;  5I89 A;  5KTX A;  5ACY A;  5FE2 A;  5FE7 A;  2FFW A;  4FJC A;  5HRW A;  4NUD A;  4HXS A;  4NRA A;  4HXL A;  5C13 A;  2KU3 A;  4A9M A;  3N9O A;  3HMF A;  2QIC A;  3PLW A;  4YAB A;  4QF2 A;  4XI1 A;  3E2D A;  1JSP B;  4QEV A;  3MHS A;  1RMD A;  5ETB A;  4N4H A;  4TTE A;  4ZC9 A;  4ALH A;  2OWA A;  4IR3 A;  5DY7 A;  5LKT A;  4FLP A;  5CRZ A;  2VJF A;  4UIW A;  5HEL A;  5L8T A;  2IDA A;  4LRG A;  5FE6 A;  4Y03 A;  4YAT A;  1T1H A;  1WEE A;  2FUU A;  5D1K B;  2JMD A;  5FG5 A;  5BT3 A;  2YVR A;  3KNV A;  2ECT A;  2B0O E;  4MVT A;  3N9N A;  4LYS A;  3PHD A;  4A0C D;  2EA6 A;  5TAB A;  3M63 A;  3M7K A;  4LZ2 A;  4OGI A;  4UIU A;  2DWW A;  1VD4 A;  1WFK A;  4W4U A;  4TU6 A;  3U5J A;  5C4Q A;  2MD7 B;  3MHH A;  5BT4 A;  5J3X A;  4J0R A;  4O7A A;  3V43 A;  4HXP A;  4NRC A;  4QC1 A;  5BT5 A;  2ECW A;  4LAD B;  5DYU A;  4NQN A;  5L96 A;  5H9M A;  4YYM A;  4IOO A;  5TBN A;  2OSS A;  3S91 A;  3ZTG A;  5A5O A;  2LGK A;  5H85 A;  1G25 A;  4A9F A;  1WEO A;  1X4U A;  2YUC A;  4HXK A;  4YAD A;  4AKN A;  4A4C A;  4QSP A;  4O78 A;  4C9Z A;  2YSJ A;  4CFK A;  4NR7 A;  4ALG A;  4I7C A;  5TRB A;  4QY4 A;  4UIT A;  4IC2 A;  2KWJ A;  4I7B A;  5DYA A;  2LN0 A;  5DYC A;  5C85 A;  4UP0 A;  5L97 A;  3RPG C;  5CUB A;  3DWY A;  4Q0O A;  2I50 A;  2DVQ A;  4QSX A;  5G04 B;  4PTB A;  5D7X A;  2L84 A;  5KHM A;  5G0F A;  4NS5 A;  5FE3 A;  4OGC A;  2XOY A;  5CUC A;  5A5N A;  2MT5 A;  5FFV A;  2XB1 A;  3Q2F A;  1MBM A;  2JRJ A;  3FM8 C;  3U5O A;  5E9M A;  5D0C A;  4QZS A;  2YQD A;  4YAX A;  3P1C A;  5EU1 A;  5EPR A;  2MNZ A;  3M99 A;  5CQ3 A;  5EA1 A;  5EPS A;  5EIC A;  2RSD A;  3FJU B;  5F62 A;  5EWC A;  3GL6 A;  4KCX A;  2L0B A;  4GNF A;  4MR5 A;  4QUU A;  4YYD A;  1JM4 B;  2Y1M A;  2LGV A;  3PUR A;  1F68 A;  1XWH A;  5FB0 A;  4BHW A;  5FE1 A;  3L11 A;  5E74 A;  4O76 A;  3C6W A;  4QR5 A;  5JWM A;  4PS5 A;  4A9H A;  2Y43 A;  3EB5 A;  4F3I A;  4Q6F A;  4BW4 A;  5K29 A;  2MD8 C;  1X4J A;  2QIZ A;  3MUK A;  4L7X A;  4TYL A;  2BAY A;  5EGU A;  2MA6 A;  5FE8 A;  4IR5 A;  2KWN A;  2MKE A;  4A9O A;  4J3I A;  5IBN A;  4A4B A;  4N4I A;  2CRW A;  2R10 A;  3D1D A;  3O34 A;  4TQN A;  5F36 A;  5G4S A;  1DCQ A;  3U5K A;  3O37 A;  2KKX A;  2LGG A;  3LDY A;  5A83 A;  2L85 A;  3D1B A;  4QYD A;  5IID A;  2L5U A;  5II2 A;  2EGP A;  5B77 A;  5CUE A;  4A9I A;  5A81 A;  1MM2 A;  4TT4 A;  4QYL A;  2DJA A;  2CSZ A;  3D7C A;  4NUE A;  2L7P A;  2VPE A;  2ECN A;  2F6N A;  5CQ7 A;  2YQM A;  3KDE C;  3KV6 A;  4HBW A;  5CQ5 A;  2LV9 A;  5DYX A;  5KU3 A;  1WES A;  4AYC A;  4IC3 A;  2WP1 A;  4O62 A;  4WIV A;  4QBM A;  4QSS A;  2E6S A;  4AKH A;  5HQ7 A;  4J1P A;  2K1J A;  2LDR A;  4IR4 A;  4BW3 A;  4PKL A;  3JVK A;  5FEY A;  4CCG X;  4GPJ A;  2QJ0 A;  5EPB A;  5F63 A;  4S3O C;  5LCW B;  2YYR A;  5KTW A;  4B86 C;  2YDW A;  4QR3 A;  4O64 A;  5EWH A;  5JI8 A;  3HMH A;  1VYX A;  5F3A A;  2KIZ A;  5HFR A;  2JUN A;  2G6Q A;  2VJE B;  2F6J A;  5AMF A;  4N3W A;  5EWW A;  2KKY A;  3ASL A;  2FSA A;  3UW9 A;  4R2Y A;  4A49 A;  4WHU A;  4BBQ A;  4AI6 A;  4MSX A;  2RO1 A;  5ENC A;  5II1 A;  5SVI A;  3T6R A;  4FK5 A;  5B75 A;  4H9D A;  3RTR B;  2FUI A;  5DLZ A;  5HJC A;  4YYG A;  3FKM X;  3FEH A;  4O7F A;  3ZYQ A;  4TU4 A;  2KYU A;  3UVX A;  4TS8 A;  5KH3 A;  4YC9 A;  5ETD A;  2RNW A;  2VPG A;  5H1T A;  5E0R A;  4F1P A;  3MDB C;  3C5K A;  4GND A;  3P5O A;  4NUC A;  3VKG A;  4C66 A;  2CON A;  4UIV A;  2XOC A;  3JUE A;  4LZR A;  5CU8 A;  5I29 A;  2KGI A;  5CS8 A;  2EXU A;  5AD3 A;  3K2J A;  4NYW A;  2KWK A;  5TCM A;  2M85 A;  3FAO A;  2VPD A;  4Z1Q A;  2E3K A;  4IOQ A;  2YEL A;  1MM3 A;  5DFD A;  4HXN A;  3DPL R;  5FFY A;  1N87 A;  2DAT A;  5I3L A;  5EP7 A;  3GG3 A;  5F60 A;  3ONI A;  4DON A;  1V87 A;  4UIZ A;  1FBV A;  4QQ4 A;  5IGL A;  5CFW A;  3LVR E;  4HBY A;  2YW5 A;  4OUF A;  4O7C A;  4NN2 A;  2RFJ A;  4A9J A;  5AD2 A;  4UI9 B;  5E3G A;  5HFQ A;  5F1L A;  5ENF A;  5CUD A;  2DVV A;  1WGM A;  4MEO A;  5TB6 A;  3RPG B;  1HYI A;  3SOW A;  3HTK C;  4QSW A;  2LXP C;  4BW2 A;  4HBV A;  2H0D A;  2LGL A;  3UV2 A;  5IG6 A;  4GNG A;  5D3S A;  5CPE A;  5F2P A;  2G45 A;  5L8U A;  2UZG A;  5I83 A;  3JVM A;  3H7H A;  4WZ0 A;  1IYM A;  2DVS A;  4NXJ A;  4E96 A;  5K3Q A;  4LJN A;  3N9P A;  4RVR A;  1WIM A;  3T7L A;  4QR4 A;  3Q2E A;  4UYD A;  5JG6 A;  5A5P A;  5LJ2 A;  1ZS5 A;  3SOX A;  5ENI A;  2JMI A;  5F25 A;  2ZET C;  4UIY A;  3VK6 A;  5EI4 A;  5C89 A;  2E7O A;  2H60 A;  4LYI A;  4NR5 A;  2CSY A;  2G43 A;  1ZKR A;  5E9I A;  5FH6 A;  1EQF A;  2D8S A;  4HXO A;  4TKP B;  3P1D A;  5DW1 A;  3LQI A; 
#chains in the Genus database with same CATH homology
 4YBS A;  3P1F A;  3IU6 A;  2HYE D;  5TDW A;  5C87 A;  4YH4 A;  2K17 A;  3ZVZ B;  4O7B A;  4O71 A;  3U5L A;  2DVR A;  4NRB A;  3RCW A;  5LUU A;  4N4G A;  4X3G A;  4UYE A;  3O35 A;  2VJF B;  4KV1 A;  1Z60 A;  2KRE A;  4AYC B;  2VP7 A;  3IHP A;  5E73 A;  5CY9 A;  4CL9 A;  3G0L A;  2C2L A;  2K16 A;  4NR6 A;  5F61 A;  5FE9 A;  5FER A;  5CRM A;  1JOC A;  2R0V A;  2OXQ C;  5ENJ A;  1Z6U A;  5DBM A;  2H0D B;  4IR6 A;  5KH9 A;  4YBM A;  4YYH A;  2AN6 A;  1LDJ B;  4MEQ A;  4YH3 A;  5I1Q A;  5CQ4 A;  5DFB A;  1WE9 A;  5TDR A;  5D24 A;  2YRE A;  4J0S A;  1WEV A;  5F5Z A;  3LQH A;  3GV4 A;  3O7A A;  4QC3 A;  4HXR A;  5D3J A;  3MQM A;  5I88 A;  3HCU A;  4P5O B;  4NR9 A;  2KTB B;  5E9L A;  5E9K A;  5FE5 A;  1E4U A;  3HCS A;  4CFL A;  4YYJ A;  5AIT A;  3QZV A;  5A82 A;  4YYN A;  2MA5 A;  5EM3 A;  5DKD A;  4O74 A;  2D9E A;  5A5R A;  1WEP A;  2LRI C;  3O36 A;  5LKZ A;  4X2I A;  5I7X A;  5EVA A;  4OGJ A;  5FB1 A;  5I80 A;  4O75 A;  4LDF A;  5ENE A;  5EWV A;  4CUR A;  2GRC A;  2YYN A;  1ZBD B;  4UYG A;  5EWD A;  4F52 B;  3HCT A;  2DX8 A;  3O33 A;  2ECI A;  3UVY A;  4UP5 A;  4MR3 A;  2RS9 B;  2Y1N A;  4LKA A;  4O70 A;  5CQT A;  5A5Q A;  4WHW A;  5DKH A;  4ZQL A;  2YHN A;  4R7E A;  1N72 A;  4O72 A;  5D1M B;  5LJ1 A;  3MXF A;  4CA1 A;  5CUA A;  5HEN A;  3UV4 A;  3U5N A;  4O77 A;  5B76 A;  4UYF B;  1VFY A;  3PUQ A;  1WEQ A;  4QB3 A;  3MB3 A;  2YEK A;  3KQI A;  4LYW A;  1Z2Q A;  4QUT A;  3ZPV 1;  4R8P K;  5D3P A;  2RNX A;  3ZVY A;  5COI A;  4HBX A;  4YBT A;  2ECG A;  2R0Y A;  3O70 A;  5HRX A;  1X0J A;  3SOU A;  1JM7 A;  4B7Y C;  5ENG A;  4BW1 A;  4LC2 A;  5DIN A;  3L1Z B;  5EIS A;  3I2D A;  4WZ2 A;  3I3J A;  4XYA A;  2CT2 A;  2KR4 A;  1FP0 A;  5LVQ A;  5E9Y A;  2YEM A;  2YSM A;  2KWO A;  5HEM A;  5DFC A;  4FO9 A;  3L1X A;  3N9Q A;  5DW2 A;  5D3R A;  2MUM A;  4QSQ A;  5E9V A;  4ZW1 A;  5B79 A;  4QSV A;  4O7E A;  4Z6H A;  2L43 A;  2MIQ A;  1HYJ A;  3MUL A;  4Z93 A;  3LRQ A;  5EV9 A;  4Z6I A;  1E6I A;  5KTU A;  4V3L C;  4XUB A;  2N9G A;  5LJ0 A;  5AME A;  4MR4 A;  2L75 A;  3FL2 A;  5B78 A;  4LLB A;  2LXH C;  4TZ2 A;  1WUM A;  2RI7 A;  3KV5 A;  3JVL A;  2EOD A;  5H1V A;  3QZT A;  1DVP A;  3SVG A;  4A9N A;  4FIP A;  5HCL A;  4QF3 A;  5KO4 A;  2JMJ A;  3EB6 A;  5CUG A;  4LK9 A;  2I7K A;  4KV4 A;  5CQ8 A;  4ZDT A;  5A5S A;  5A85 A;  2PUY A;  3NXB A;  5FE0 A;  3JVJ A;  1WEN A;  2VPB A;  3ZNI A;  2YW8 A;  2CKL A;  4L58 A;  4YY6 A;  3NG2 A;  3IU5 A;  5CGP A;  2E6R A;  5HRV A;  5DKA A;  2ECJ A;  1WEW A;  4I7D A;  4QSU A;  5ENH A;  4CUP A;  4NYV A;  3U5P A;  2NXB A;  5EYA F;  4LZS A;  4GNE A;  2M3H A;  4N4F A;  5L98 A;  5C11 A;  5FBX A;  2MJV B;  3UVW A;  4MEN A;  5LKX A;  2KE1 A;  4AP4 A;  5D3H A;  5HLS A;  5A7C A;  5ENB A;  4UYH A;  5G4R A;  4UIX A;  4AVX A;  3LQJ A;  5FDZ A;  4PPE A;  4CUT A;  2MNY A;  4Z1S A;  4XY9 A;  5CZG A;  2PNX A;  2KGG A;  5FG4 A;  4WA6 A;  5FH8 A;  4XY8 A;  4LR6 A;  2M6M A;  2NAA A;  3SHB A;  5FFW A;  2VJE A;  5G05 B;  2YHO A;  5I7Y A;  2YT5 A;  4TT6 A;  2I8N A;  2CKL B;  5HQ6 A;  4MEP A;  3N9L A;  2KFT A;  2YU4 A;  2R0S A;  3UVD A;  3MB4 A;  1CHC A;  5CTL A;  1WEM A;  5DLX A;  5D3T A;  5AIU A;  4YYI A;  4QST A;  3S92 A;  5H1U A;  5L99 A;  3HME A;  4NR8 A;  2HDP A;  1F62 A;  4IOR A;  4V3K C;  2OUO A;  4PCI A;  2VNF A;  2L80 A;  5LVR A;  2L5E A;  3ZPV E;  4CUS A;  1WUG A;  4A9E A;  3SVF A;  4QEU A;  2E7N A;  4YY4 A;  5C7N A;  4XUA A;  4TT2 A;  2RNY A;  3DAI A;  3AAD A;  2D82 A;  4AUQ B;  5E7D A;  4Q0N A;  2OO1 A;  3G0J A;  1K2F A;  2LQ6 A;  3SVH A;  5EQ1 A;  5CP5 A;  5D3L A;  5FG6 A;  1X4I A;  3N9M A;  3LJW A;  5C8G A;  4BJX A;  2YQL A;  5IGN A;  3M62 A;  4YK0 A;  2C2V S;  2LSP B;  4QNS A;  4QEW A;  5CQA A;  4PY6 A;  3P1E A;  5E3D A;  5DX4 A;  5B8D A;  1U6G B;  4NYX A;  4C67 A;  4S3O B;  5IGM A;  3QZS A;  4HXM A;  4MR6 A;  2XEU A;  1JM7 B;  1BOR A;  4QSR A;  5HM0 A;  5F1H A;  5EK9 A;  4YYK A;  4GB0 A;  5LKU A;  5FH7 A;  5D3N A;  3TLP A;  4A9L A;  1WIL A;  4TZ8 A;  2F42 A;  1LDK C;  2ECV A;  5D26 A;  4NQM A;  5CQ6 A;  4CUQ A;  2M1R A;  2YUR A;  5DKC A;  4UYF A;  3UV5 A;  4ZUX U;  4CLB A;  1WEU A;  5D1L B;  3LXJ A;  5D25 A;  4A9K A;  5I86 A;  4CUU A;  5HQ5 A;  3AQA A;  4NR4 A;  3ZYU A;  4PCE A;  2K4D A;  5FE4 A;  2DKW A;  4WZ3 B;  5KH7 A;  5IGK A;  3U5M A;  5I40 A;  5J0D A;  3DQV R;  2WP2 A;  2G4A A;  5I89 A;  5KTX A;  5ACY A;  5FE2 A;  5FE7 A;  4FJC A;  5HRW A;  4NUD A;  4HXS A;  4NRA A;  4HXL A;  5C13 A;  2KU3 A;  4A9M A;  3N9O A;  3HMF A;  2QIC A;  4XI1 A;  4YAB A;  4QF2 A;  1JSP B;  4QEV A;  3MHS A;  1RMD A;  5ETB A;  4N4H A;  4TTE A;  4ZC9 A;  4ALH A;  4IR3 A;  5DY7 A;  5LKT A;  4FLP A;  5CRZ A;  2VJF A;  4UIW A;  5HEL A;  5L8T A;  2IDA A;  4LRG A;  5FE6 A;  4Y03 A;  4YAT A;  1T1H A;  1WEE A;  2FUU A;  5D1K B;  2JMD A;  5FG5 A;  5BT3 A;  3KNV A;  2ECT A;  4MVT A;  3N9N A;  4LYS A;  3PHD A;  4A0C D;  2EA6 A;  5TAB A;  3M63 A;  4LZ2 A;  4OGI A;  4UIU A;  2DWW A;  1VD4 A;  1WFK A;  4W4U A;  4TU6 A;  3U5J A;  5C4Q A;  2MD7 B;  3MHH A;  5BT4 A;  5J3X A;  4J0R A;  4O7A A;  3V43 A;  4HXP A;  4NRC A;  4QC1 A;  5BT5 A;  2ECW A;  4LAD B;  5DYU A;  4NQN A;  5L96 A;  5H9M A;  4YYM A;  4IOO A;  5TBN A;  2OSS A;  3S91 A;  3ZTG A;  5A5O A;  2LGK A;  5H85 A;  1G25 A;  4A9F A;  1WEO A;  1X4U A;  2YUC A;  4HXK A;  4YAD A;  4AKN A;  4A4C A;  4QSP A;  4O78 A;  4C9Z A;  2YSJ A;  4CFK A;  4NR7 A;  4ALG A;  4I7C A;  5TRB A;  4QY4 A;  4UIT A;  4IC2 A;  2KWJ A;  4I7B A;  5DYA A;  2LN0 A;  5DYC A;  5C85 A;  4UP0 A;  5L97 A;  3RPG C;  5CUB A;  3DWY A;  4Q0O A;  2I50 A;  2DVQ A;  4QSX A;  5G04 B;  4PTB A;  5D7X A;  2L84 A;  5KHM A;  5G0F A;  4NS5 A;  5FE3 A;  5CUC A;  5A5N A;  2MT5 A;  5FFV A;  2XB1 A;  3Q2F A;  2JRJ A;  3U5O A;  5E9M A;  5D0C A;  4QZS A;  2YQD A;  4YAX A;  3P1C A;  5EU1 A;  5EPR A;  2MNZ A;  3M99 A;  5CQ3 A;  5EA1 A;  5EPS A;  5EIC A;  2RSD A;  5F62 A;  5EWC A;  3GL6 A;  4KCX A;  2L0B A;  4GNF A;  4MR5 A;  4QUU A;  4YYD A;  1JM4 B;  2Y1M A;  2LGV A;  3PUR A;  1F68 A;  1XWH A;  5FB0 A;  4BHW A;  5FE1 A;  3L11 A;  5E74 A;  4O76 A;  3C6W A;  4QR5 A;  5JWM A;  4PS5 A;  4A9H A;  2Y43 A;  3EB5 A;  4F3I A;  4Q6F A;  4BW4 A;  5K29 A;  2MD8 C;  1X4J A;  2QIZ A;  3MUK A;  4L7X A;  4TYL A;  2BAY A;  5EGU A;  2MA6 A;  5FE8 A;  4IR5 A;  2KWN A;  4A9O A;  4J3I A;  5IBN A;  4A4B A;  4N4I A;  2R10 A;  3O34 A;  4TQN A;  5F36 A;  5G4S A;  3U5K A;  3O37 A;  2LGG A;  5A83 A;  2L85 A;  5IID A;  4QYD A;  2L5U A;  5II2 A;  2EGP A;  5B77 A;  5CUE A;  4A9I A;  5A81 A;  1MM2 A;  4TT4 A;  4QYL A;  2CSZ A;  3D7C A;  4NUE A;  2VPE A;  2ECN A;  2F6N A;  5CQ7 A;  2YQM A;  3KV6 A;  4HBW A;  5CQ5 A;  2LV9 A;  5DYX A;  5KU3 A;  1WES A;  4AYC A;  4IC3 A;  2WP1 A;  4WIV A;  4QBM A;  4QSS A;  2E6S A;  2K1J A;  5HQ7 A;  4J1P A;  2LDR A;  4IR4 A;  4BW3 A;  4PKL A;  3JVK A;  5FEY A;  4CCG X;  4GPJ A;  2QJ0 A;  5EPB A;  5F63 A;  4S3O C;  5LCW B;  2YYR A;  5KTW A;  4B86 C;  2YDW A;  4QR3 A;  4O64 A;  5EWH A;  5JI8 A;  3HMH A;  1VYX A;  5F3A A;  2KIZ A;  5HFR A;  2VJE B;  2G6Q A;  2F6J A;  5AMF A;  4N3W A;  5EWW A;  3ASL A;  4A49 A;  2FSA A;  3UW9 A;  4R2Y A;  4WHU A;  4BBQ A;  4MSX A;  2RO1 A;  5ENC A;  5II1 A;  3T6R A;  4FK5 A;  5B75 A;  3RTR B;  2FUI A;  5DLZ A;  5HJC A;  4YYG A;  3FKM X;  3ZYQ A;  4O7F A;  4TU4 A;  2KYU A;  3UVX A;  4TS8 A;  5KH3 A;  4YC9 A;  5ETD A;  2RNW A;  2VPG A;  5H1T A;  5E0R A;  3C5K A;  4GND A;  3P5O A;  4NUC A;  4C66 A;  4UIV A;  4LZR A;  5CU8 A;  5I29 A;  2KGI A;  5CS8 A;  5AD3 A;  3K2J A;  4NYW A;  2KWK A;  5TCM A;  2M85 A;  2VPD A;  4Z1Q A;  2E3K A;  4IOQ A;  2YEL A;  1MM3 A;  5DFD A;  4HXN A;  3DPL R;  5FFY A;  1N87 A;  2DAT A;  5I3L A;  5EP7 A;  3GG3 A;  5F60 A;  3ONI A;  4DON A;  1V87 A;  4UIZ A;  1FBV A;  5IGL A;  5CFW A;  4HBY A;  2YW5 A;  4OUF A;  4O7C A;  4NN2 A;  2RFJ A;  4A9J A;  5AD2 A;  4UI9 B;  5E3G A;  5HFQ A;  5F1L A;  5ENF A;  5CUD A;  2DVV A;  1WGM A;  4MEO A;  5TB6 A;  3RPG B;  1HYI A;  3SOW A;  3HTK C;  4QSW A;  2LXP C;  4BW2 A;  4HBV A;  2H0D A;  2LGL A;  3UV2 A;  5IG6 A;  4GNG A;  5D3S A;  5CPE A;  5F2P A;  2G45 A;  5L8U A;  2UZG A;  5I83 A;  3JVM A;  4WZ0 A;  1IYM A;  2DVS A;  4NXJ A;  4E96 A;  4LJN A;  3N9P A;  4RVR A;  1WIM A;  3T7L A;  4QR4 A;  3Q2E A;  4UYD A;  5JG6 A;  5A5P A;  5LJ2 A;  1ZS5 A;  3SOX A;  5ENI A;  2JMI A;  5F25 A;  2ZET C;  4UIY A;  3VK6 A;  5EI4 A;  5C89 A;  2E7O A;  2H60 A;  4LYI A;  4NR5 A;  2CSY A;  2G43 A;  5E9I A;  5FH6 A;  1EQF A;  2D8S A;  4HXO A;  4TKP B;  3P1D A;  5DW1 A;  3LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...