3O33A

Crystal structure of trim24 phd-bromo in the free state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 47
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o33A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o33A01
3P1EA 1CHCA 4LRGA 5IIDA 4UIZA 4QUTA 1FP0A 1LDJB 4FIPA 2VPGA 5FH6A 2M6MA 4CLBA 4QC1A 5EVAA 5A85A 3UVDA 4LZ2A 3O7AA 3ZTGA 5LVQA 5FDZA 4HXOA 5EWDA 5AD2A 5CZGA 5G4RA 5A5NA 5ACYA 3N9MA 4LKAA 4QSPA 5LVRA 2KWJA 4TS8A 5CPEA 4WIVA 4XUAA 5HFRA 2L43A 3DWYA 5I80A 5EWWA 2ECGA 5G05B 2LGGA 2JRJA 5IG6A 5AD3A 5LKUA 4PY6A 5E9LA 5KTXA 4QSTA 3P1DA 3I2DA 4QC3A 4N4IA 2RS9B 2VPEA 3M63A 4O70A 4L58A 4RVRA 4HXPA 2KU3A 2QJ0A 2QIZA 4UYGA 1JM4B 3KQIA 5E73A 4YY4A 2KWOA 2KWKA 5C8GA 1F68A 4N4FA 3ZYUA 4NN2A 2KR4A 2MA5A 1X4IA 3O36A 5JWMA 5D3RA 4KV1A 4A9MA 1N72A 2VJFA 3UVYA 5D24A 1EQFA 5BT5A 5FE9A 3ASLA 4MEPA 4NYXA 5D3HA 5FBXA 3P1FA 5EWCA 4V3LC 4W4UA 2D8SA 1JM7A 4UYDA 2RNYA 5D25A 2KFTA 2MIQA 3GV4A 2VJEA 2MNZA 4MSXA 2E3KA 4GNEA 5HM0A 3ZVYA 5CQ6A 4FO9A 1K2FA 2RO1A 5ETBA 3SOWA 5ETDA 4BW4A 5FE5A 2ZETC 5D3JA 4HXMA 4IR5A 4YABA 1WEUA 4O76A 1V87A 3DAIA 3MXFA 4UIVA 4A9LA 2QICA 3RTRB 2M3HA 4GNGA 5A83A 5I7XA 4QEVA 5FE4A 2RNXA 4QR4A 2CT2A 5CQ5A 4ZUXU 5F5ZA 5CUDA 4O78A 2MA6A 4TU6A 4HXRA 1LDKC 1WEQA 3MQMA 4AKNA 4CUTA 1DVPA 4IC2A 4CFKA 4LYSA 4R2YA 2DVSA 5FE0A 2VPBA 2Y1MA 4AYCA 4A4CA 4TT6A 4NRAA 4Z1SA 2KTBB 3C5KA 3U5OA 4NUEA 4O64A 3O37A 2K17A 5C13A 5E3DA 2KYUA 3FL2A 4FJCA 5ENHA 1WFKA 2C2VS 4UYFB 5L8TA 4HXSA 2RNWA 5FE3A 5DKAA 4IC3A 2L84A 4XY9A 3RPGB 5DKCA 2FUUA 2H0DB 4N3WA 1BORA 2NAAA 2VPDA 4NR9A 3MB4A 4AUQB 5FE1A 2FSAA 5D3SA 4LZSA 2NXBA 3V43A 3LQHA 4YYJA 4NR4A 4MR4A 5EI4A 5FB0A 4V3KC 4IOQA 3PUQA 4HXKA 5CQ3A 5E9MA 3ZYQA 4F52B 5HCLA 4YK0A 2YU4A 5ENBA 2YYNA 3LXJA 3M62A 2I8NA 4E96A 1HYIA 1IYMA 2K16A 2F42A 2YDWA 4YBMA 4UYEA 5D1KB 2KGIA 4CUUA 4NR7A 2EODA 5H9MA 3IHPA 4WZ2A 4A9NA 5G04B 4Z6HA 4N4GA 2LDRA 2PNXA 4PKLA 2FUIA 5EM3A 5ENEA 5CU8A 2WP1A 3C6WA 5B78A 5H85A 4X2IA 5J0DA 2CKLA 5HJCA 2VP7A 5CRZA 5H1UA 3MB3A 4GNFA 4QSVA 5DW1A 3HMEA 5DX4A 4YYGA 5TCMA 5F36A 4YATA 2EA6A 3AADA 2F6NA 1X4JA 5I7YA 3JVKA 5EP7A 4YYKA 3HCSA 5B76A 2LGLA 3MHHA 4A0CD 5FH8A 4YYMA 5EPBA 5E9KA 5BT4A 4I7DA 4Z1QA 3RCWA 5C87A 4J1PA 5DYCA 1Z60A 5I1QA 4XYAA 4A4BA 5CS8A 5DYAA 2DVVA 3L11A 5IBNA 4MENA 5EQ1A 2MNYA 4QF2A 4UYFA 5E9YA 2XEUA 2MT5A 5TRBA 3T7LA 4Q0OA 5KH3A 4HXNA 4NUCA 4ZC9A 3U5LA 2MD7B 2MD8C 3ZPV1 5I3LA 4LR6A 1HYJA 1G25A 2PUYA 4QB3A 1WEEA 1WIMA 5EGUA 1XWHA 3LQJA 5ENGA 5FFVA 4YC9A 4R7EA 5F2PA 5H1VA 2DATA 5TB6A 5CUCA 3N9NA 4O7FA 2YEMA 3QZTA 5HEMA 5II2A 4CFLA 5I86A 5LJ1A 2WP2A 5D1LB 4O74A 2Y1NA 3N9QA 2ECTA 4TZ8A 4UP5A 4CUPA 4TTEA 2Y43A 2YHNA 4CUSA 5G4SA 2YT5A 2VNFA 3O35A 2L80A 2E6SA 5EPRA 2KREA 4ZDTA 3RPGC 4NQNA 5ENCA 4Q0NA 3PHDA 4C9ZA 4NXJA 5D0CA 5CQAA 5D3NA 1N87A 4TKPB 3TLPA 5EISA 3NG2A 5HFQA 5KU3A 4QF3A 1FBVA 4QEUA 4ALHA 4QSUA 5B75A 1WEOA 4UYHA 3G0LA 2L5EA 4YY6A 2R0SA 4NRCA 5DY7A 4UIUA 3SVFA 5I29A 4NQMA 5EWVA 2HDPA 5COIA 2YURA 5A5SA 2L0BA 4YYIA 2LGVA 5IGLA 4YH4A 5FH7A 5A7CA 5F63A 5C7NA 2F6JA 4MEOA 4P5OB 2E7NA 4UITA 4Z93A 2N9GA 4WA6A 5AIUA 4X3GA 2OSSA 5C85A 5IGNA 4GPJA 4CURA 1MM3A 1X4UA 4ZW1A 3GG3A 2OO1A 1WILA 1E4UA 5KHMA 3L1XA 4IORA 4TZ2A 2R0YA 5CUGA 4XY8A 1JOCA 1WEPA 2KWNA 2G45A 3VK6A 5F25A 5HLSA 1WEVA 5FEYA 2ECVA 2YSMA 3S91A 4CL9A 4QSXA 4YH3A 5E9VA 2YREA 5I83A 4TQNA 2YEKA 4CUQA 4BJXA 5A5PA 5K29A 3DPLR 5E0RA 4FK5A 3UVWA 5CQTA 4TU4A 1WENA 4S3OB 4J3IA 4YADA 5DBMA 4NRBA 5A5QA 5HRVA 5LUUA 2LGKA 4QSRA 5DFBA 4TYLA 5CY9A 2I50A 2MJVB 4HXLA 4B7YC 3U5PA 5A5RA 3MULA 3SVHA 2LV9A 1Z6UA 4IR6A 3MHSA 5IGKA 4XI1A 1WE9A 4IR4A 4LJNA 2E7OA 3QZSA 4NR5A 4O7BA 3QZVA 5CP5A 5FG5A 3MUKA 5FE2A 5KH7A 3LRQA 3UV4A 5E3GA 2K1JA 3JVMA 3G0JA 3GL6A 5AITA 3SVGA 5I88A 5DYUA 2ECJA 4LADB 5EV9A 4QY4A 2LRIC 3N9PA 5D3LA 4NYVA 1JM7B 2YYRA 2DKWA 4MVTA 5L96A 4PS5A 2VJEB 4O7AA 4IR3A 3P5OA 3KV5A 5HQ7A 5G0FA 4WHUA 2KGGA 4MEQA 2RI7A 1VFYA 4A49A 4YYDA 2LXHC 1WUMA 3O70A 5DFCA 5CQ8A 4YBSA 4WHWA 2G43A 3HMHA 5KH9A 4A9IA 3HTKC 2MUMA 5L99A 3SOUA 1F62A 5LJ2A 2ECNA 4AP4A 4MR3A 5F61A 3HCTA 2D82A 4UIWA 5EYAF 2R0VA 1E6IA 5HRWA 5TDWA 3ZVZB 5D3TA 4QR3A 1WUGA 4HBYA 3ZNIA 4O72A 2CSZA 2GRCA 5CUBA 5IGMA 2JMJA 2G4AA 3N9OA 5HQ5A 4DONA 5D7XA 5CQ7A 4Q6FA 3M99A 3D7CA 1WGMA 2M85A 2XB1A 2ECIA 2H0DA 4A9KA 5LJ0A 4CCGX 2M1RA 5FERA 4AYCB 3EB6A 4LDFA 2YHOA 5DINA 4OGIA 3JVLA 2EGPA 4YYHA 3O33A 2UZGA 3ONIA 5KTUA 3IU6A 5B77A 3DQVR 3AQAA 1MM2A 5A82A 4QBMA 1VD4A 2HYED 4PCIA 3IU5A 4QZSA 1ZS5A 3EB5A 4LYIA 4A9JA 3UV2A 4PCEA 5B79A 4GB0A 4QYLA 2KIZA 4QYDA 5CQ4A 4L7XA 5JG6A 5AMEA 4IOOA 2E6RA 1WEWA 5TBNA 5BT3A 4LYWA 4S3OC 5F1HA 5A81A 5ENIA 5DYXA 2I7KA 4TT4A 4QUUA 4PPEA 4OUFA 4LC2A 4MR6A 5DFDA 4LLBA 5LKZA 4J0SA 3NXBA 5HRXA 1T1HA 4I7BA 2BAYA 4LZRA 5E74A 3KV6A 5F3AA 5A5OA 3LJWA 2RFJA 5E7DA 3HMFA 4O7EA 4A9EA 5EPSA 5FE7A 3JVJA 3O34A 3UW9A 4A9FA 2OXQC 2LXPC 1WEMA 5I40A 4I7CA 2ECWA 5FE8A 2H60A 3UV5A 4HBWA 2LN0A 5D3PA 5FG6A 4C66A 4YYNA 2DX8A 2DVQA 5TDRA 4KCXA 2RSDA 4UP0A 4CA1A 4WZ3B 4NR8A 5LKTA 2CKLB 3Q2EA 1Z2QA 5L98A 4OGJA 4O75A 5EA1A 5ENFA 4XUBA 2YSJA 4N4HA 1U6GB 4O71A 3U5MA 3U5NA 4F3IA 5EWHA 4QR5A 2C2LA 5L97A 4A9OA 5CUAA 5DKDA 4BW1A 2KE1A 5II1A 5J3XA 3PURA 4UI9B 4PTBA 4Y03A 2LSPB 3P1CA 5TABA 1JSPB 5HENA 3T6RA 3I3JA 5FG4A 3LQIA 4J0RA 4YAXA 4C67A 5L8UA 1VYXA 5E9IA 5LCWB 4B86C 4TT2A 4R8PK 4GNDA 5DLXA 1RMDA 3Q2FA 5H1TA 4QNSA 3K2JA 5KTWA 2DVRA 4QSQA 2OUOA 2YW5A 4Z6IA 3N9LA 2JMDA 3HCUA 5CUEA 4ALGA 4O7CA 1X0JA 5HELA 5D1MB 4YBTA 5DKHA 5HQ6A 5F60A 5ENJA 4BW3A 4QEWA 5LKXA 2AN6A 2YUCA 5CGPA 4NYWA 5C89A 4LK9A 2L5UA 5F1LA 2LQ6A 4FLPA 5I89A 3UVXA 3ZPVE 4BBQA 5F62A 5CTLA 2DWWA 2YQLA 3U5JA 2R10A 4MR5A 2YW8A 2VJFB 5FFWA 5B8DA 5C11A 2G6QA 2L75A 5EU1A 2L85A 2CSYA 5CFWA 3SHBA 2YELA 5FB1A 3L1ZB 5FFYA 1WESA 3SOXA 2YQDA 2JMIA 3S92A 4BHWA 5AMFA 2K4DA 5DLZA 4ZQLA 4QSWA 5FE6A 5CRMA 4HBVA 5JI8A 4QSSA 3FKMX 5KO4A 5C4QA 4AVXA 4UIXA 5EICA 4NS5A 1ZBDB 4WZ0A 5DW2A 4KV4A 2D9EA 4A9HA 4HBXA 3U5KA 2YQMA 5EK9A 4O77A 3KNVA 4NR6A 4BW2A 2IDAA 4UIYA 4NUDA 5D26A
chains in the Genus database with same CATH superfamily
3P1EA 1CHCA 2KKXA 4LRGA 5IIDA 4UIZA 4QUTA 5SVXA 1FP0A 1LDJB 4FIPA 5K3QA 2VPGA 5FH6A 2M6MA 4CLBA 4QC1A 5EVAA 5A85A 3UVDA 4LZ2A 3O7AA 3ZTGA 5LVQA 5FDZA 2CRRA 4HXOA 5EWDA 5AD2A 5CZGA 5G4RA 5A5NA 5ACYA 3N9MA 4LKAA 4QSPA 5LVRA 2KWJA 4TS8A 5CPEA 1MBMA 4WIVA 4XUAA 5HFRA 2L43A 3DWYA 5I80A 5EWWA 2ECGA 5G05B 2LGGA 2JRJA 5IG6A 3FEHA 5AD3A 5LKUA 3DWDA 4PY6A 5E9LA 5KTXA 4QSTA 3P1DA 3I2DA 4QC3A 4N4IA 2RS9B 2VPEA 2EGMA 3M63A 4O70A 4L58A 4RVRA 4HXPA 2KU3A 2QJ0A 2QIZA 4UYGA 1JM4B 3KQIA 5E73A 4YY4A 5SVIA 2KWOA 2KWKA 5C8GA 1F68A 4N4FA 3ZYUA 4NN2A 2KR4A 2MA5A 1X4IA 3O36A 5JWMA 5D3RA 4KV1A 4A9MA 1N72A 2VJFA 3UVYA 5D24A 1EQFA 5BT5A 5FE9A 3ASLA 4MEPA 4NYXA 5D3HA 5FBXA 3P1FA 5EWCA 2JUNA 4V3LC 4W4UA 3T9KA 4OGCA 2D8SA 1JM7A 4UYDA 2RNYA 5D25A 2KFTA 2MIQA 3GV4A 2VJEA 2MNZA 4MSXA 2E3KA 4GNEA 5HM0A 3ZVYA 5CQ6A 2FD4A 4FO9A 1K2FA 2RO1A 5ETBA 3SOWA 5ETDA 4BW4A 2D8UA 5FE5A 2ZETC 5D3JA 4HXMA 4IR5A 4YABA 1WEUA 4O76A 1V87A 3FJUB 3DAIA 3MXFA 4UIVA 4A9LA 2QICA 3RTRB 2M3HA 4GNGA 5A83A 5I7XA 4QEVA 5FE4A 2RNXA 4QR4A 2CT2A 5CQ5A 4ZUXU 5F5ZA 5CUDA 4O78A 2MA6A 4TU6A 4HXRA 1LDKC 1WEQA 3MQMA 4AKNA 4CUTA 1DVPA 3PLWA 4IC2A 4CFKA 4LYSA 4R2YA 2DVSA 3LVQE 5FE0A 2VPBA 2Y1MA 4AYCA 4A4CA 4TT6A 4NRAA 4Z1SA 2KTBB 3C5KA 3U5OA 4NUEA 4O64A 3O37A 2K17A 5C13A 5E3DA 2KYUA 3FL2A 4FJCA 2EJNA 5ENHA 1WFKA 2C2VS 4UYFB 5L8TA 4HXSA 2RNWA 5FE3A 3Q1DA 4AKIA 5DKAA 4IC3A 2L84A 4XY9A 3RPGB 5DKCA 2FUUA 2H0DB 4N3WA 1BORA 2NAAA 2VPDA 4NR9A 3MB4A 4AUQB 5FE1A 2FSAA 3E2DA 5D3SA 4LZSA 2NXBA 3V43A 3LQHA 4YYJA 4NR4A 4MR4A 5EI4A 5FB0A 4V3KC 4IOQA 3PUQA 4HXKA 5CQ3A 5E9MA 3ZYQA 2E61A 5HCLA 4F52B 4YK0A 2YU4A 5ENBA 2YYNA 3LXJA 2DJAA 2I8NA 4E96A 3M62A 1HYIA 1IYMA 2K16A 2F42A 2YDWA 4YBMA 4UYEA 5D1KB 2KGIA 4CUUA 2YVRA 4NR7A 2EODA 5H9MA 3IHPA 4WZ2A 4A9NA 5G04B 4Z6HA 4N4GA 2LDRA 2PNXA 4PKLA 2FUIA 5EM3A 5ENEA 5CU8A 2WP1A 3C6WA 5B78A 5H85A 4X2IA 5J0DA 2CKLA 5HJCA 2VP7A 5CRZA 5H1UA 3MB3A 4GNFA 4QSVA 5DW1A 3HMEA 5DX4A 4YYGA 5TCMA 5F36A 2CONA 4YATA 2EA6A 3AADA 2F6NA 1X4JA 5I7YA 3JVKA 5EP7A 4YYKA 3HCSA 5B76A 1DCQA 2LGLA 3MHHA 4A0CD 5FH8A 3LDYA 4YYMA 5EPBA 5E9KA 5BT4A 4I7DA 4Z1QA 3RCWA 2IQJA 5C87A 4J1PA 5DYCA 1Z60A 5I1QA 4XYAA 4A4BA 5CS8A 5DYAA 2DVVA 3L11A 5IBNA 4MENA 5EQ1A 2MNYA 4QF2A 4UYFA 5E9YA 2P57A 2MT5A 2XEUA 5TRBA 2EXUA 3T7LA 4Q0OA 2MKEA 5KH3A 4HXNA 4NUCA 4ZC9A 3U5LA 2MD7B 2MD8C 3ZPV1 5I3LA 4LR6A 1HYJA 1G25A 2PUYA 4QB3A 1WEEA 1WIMA 5EGUA 1XWHA 2XP0A 3LQJA 5ENGA 5FFVA 4YC9A 4AI6A 2M13A 4R7EA 5F2PA 5H1VA 2DATA 5TB6A 5CUCA 3N9NA 4O7FA 2YEMA 2LAUA 3QZTA 5HEMA 5II2A 4CFLA 5I86A 5LJ1A 4Z0OA 2WP2A 5D1LB 4O74A 2Y1NA 3N9QA 2ECTA 4TZ8A 4UP5A 4CUPA 4TTEA 2Y43A 2YHNA 4CUSA 5G4SA 2YT5A 2VNFA 3O35A 3LJUX 2L80A 2E6SA 5EPRA 2KREA 4ZDTA 3RPGC 4NQNA 5ENCA 4Q0NA 3PHDA 4C9ZA 4NXJA 5D0CA 5CQAA 5D3NA 1N87A 4TKPB 3JUEA 3TLPA 5EISA 3NG2A 5HFQA 5KU3A 4QF3A 1FBVA 4QEUA 4ALHA 4QSUA 5B75A 1WEOA 4UYHA 3G0LA 2L5EA 4YY6A 2R0SA 4NRCA 5DY7A 4UIUA 3SVFA 5I29A 4NQMA 5EWVA 2HDPA 5COIA 2YURA 5A5SA 2L0BA 4YYIA 2LGVA 5IGLA 4YH4A 5FH7A 5A7CA 5F63A 5C7NA 2F6JA 4MEOA 4P5OB 2E7NA 4UITA 4Z93A 2N9GA 4WA6A 5AIUA 4X3GA 2OSSA 5C85A 5IGNA 4GPJA 4CURA 3VKGA 1MM3A 1X4UA 4ZW1A 2KKYA 3GG3A 2OO1A 1WILA 1E4UA 5KHMA 3L1XA 4IORA 4TZ2A 2R0YA 5CUGA 4XY8A 1JOCA 1WEPA 4QQ4A 2KWNA 2G45A 3VK6A 5F25A 5HLSA 1WEVA 3FM8C 3H7HA 5FEYA 2ECVA 2YSMA 3S91A 4CL9A 4QSXA 4YH3A 5E9VA 2YREA 5I83A 4TQNA 2YEKA 4CUQA 4BJXA 5A5PA 5K29A 3DPLR 5E0RA 4FK5A 3UVWA 5CQTA 4TU4A 1WENA 4S3OB 4J3IA 4YADA 5DBMA 4NRBA 5A5QA 2XOCA 5HRVA 5LUUA 2CSVA 2LGKA 4QSRA 5DFBA 4TYLA 5CY9A 2I50A 2MJVB 4HXLA 4B7YC 2DSMA 2JM3A 3U5PA 5A5RA 3MULA 3SVHA 2LV9A 1Z6UA 4IR6A 3MHSA 5IGKA 4XI1A 4Z0RA 1WE9A 4IR4A 4LJNA 2E7OA 3QZSA 2XOYA 4F1PA 4NR5A 4O7BA 3QZVA 5CP5A 5FG5A 3MUKA 5FE2A 5SVIB 3LRQA 5KH7A 3UV4A 5E3GA 2K1JA 3JVMA 3G0JA 3GL6A 5AITA 3SVGA 5I88A 5DYUA 2ECJA 4LADB 5EV9A 4QY4A 2LRIC 3D1BA 3N9PA 5D3LA 4NYVA 1JM7B 2YYRA 2DKWA 4MVTA 5L96A 4PS5A 2VJEB 4O7AA 4IR3A 3P5OA 3KV5A 5HQ7A 5G0FA 4WHUA 2KGGA 4MEQA 2RI7A 1VFYA 4A49A 4YYDA 2LXHC 1WUMA 3O70A 5DFCA 5CQ8A 4YBSA 4WHWA 2G43A 3HMHA 5KH9A 4A9IA 3HTKC 2MUMA 5L99A 3SOUA 1F62A 5LJ2A 2ECNA 4AP4A 3LVRE 4MR3A 5F61A 3HCTA 2D82A 4UIWA 5EYAF 2R0VA 1E6IA 5HRWA 5TDWA 3ZVZB 4AKHA 5D3TA 4QR3A 1WUGA 4HBYA 1ZKRA 3ZNIA 4O72A 2CSZA 2GRCA 5CUBA 5IGMA 2JMJA 2G4AA 3N9OA 5HQ5A 4DONA 5D7XA 5CQ7A 4Q6FA 3M99A 3D7CA 1WGMA 2M85A 2XB1A 2ECIA 2H0DA 1PUOA 4A9KA 5LJ0A 4CCGX 2M1RA 5FERA 4AYCB 3EB6A 4LDFA 2YHOA 5DINA 4OGIA 3JVLA 2EGPA 4YYHA 3VKHA 2XOZA 3O33A 2UZGA 3ONIA 5KTUA 3IU6A 5B77A 3DQVR 3AQAA 1MM2A 5A82A 4QBMA 1VD4A 2HYED 4PCIA 3IU5A 4QZSA 1ZS5A 3EB5A 4LYIA 4A9JA 3UV2A 4PCEA 5B79A 2OWAA 4GB0A 4QYLA 2KIZA 4QYDA 5CQ4A 4L7XA 5JG6A 5AMEA 4IOOA 2E6RA 1WEWA 3ERRA 5TBNA 5BT3A 4LYWA 4S3OC 5F1HA 5A81A 5ENIA 5DYXA 2I7KA 4TT4A 4QUUA 4PPEA 4OUFA 4LC2A 4MR6A 5DFDA 4LLBA 5LKZA 4J0SA 3NXBA 5HRXA 1T1HA 4I7BA 4AKGA 2BAYA 2RR4A 4LZRA 5E74A 3KV6A 5F3AA 5A5OA 2L7PA 3LJWA 2RFJA 5E7DA 3HMFA 4O7EA 4A9EA 5EPSA 5FE7A 3JVJA 3O34A 3UW9A 4A9FA 2OXQC 2LXPC 1WEMA 5I40A 4I7CA 2FFWA 2ECWA 5FE8A 2H60A 3UV5A 4HBWA 2LN0A 5D3PA 5FG6A 4C66A 3DDTA 4YYNA 2DX8A 2DVQA 3MDBC 4KCXA 2RSDA 4UP0A 5TDRA 4CA1A 4WZ3B 4NR8A 5LKTA 2CKLB 3Q2EA 1Z2QA 5L98A 4OGJA 4O75A 5EA1A 5ENFA 4XUBA 2YSJA 2B0OE 4O62A 4N4HA 1U6GB 4O71A 3U5MA 3U5NA 4F3IA 5EWHA 4QR5A 2C2LA 5L97A 4A9OA 5CUAA 5DKDA 4BW1A 2KE1A 5II1A 5J3XA 3PURA 4UI9B 4PTBA 4Y03A 3O47A 2LSPB 3P1CA 5TABA 1JSPB 5HENA 3T6RA 3I3JA 5FG4A 3LQIA 4J0RA 4YAXA 4C67A 5L8UA 1VYXA 5E9IA 5LCWB 4B86C 3FAOA 4TT2A 3M7KA 4R8PK 4GNDA 5DLXA 1RMDA 3Q2FA 5H1TA 4QNSA 3K2JA 5KTWA 2DVRA 4QSQA 2OUOA 2YW5A 4Z6IA 3N9LA 2JMDA 3HCUA 5CUEA 4ALGA 4O7CA 1X0JA 5HELA 5D1MB 4YBTA 3KDEC 5DKHA 5HQ6A 5F60A 5ENJA 4BW3A 4QEWA 5LKXA 2AN6A 2YUCA 3SUBA 5CGPA 4NYWA 5C89A 4LK9A 2L5UA 5F1LA 4H9DA 2LQ6A 4FLPA 5I89A 3UVXA 3ZPVE 4BBQA 5F62A 5CTLA 2DWWA 3FANA 2YQLA 3U5JA 2R10A 4MR5A 2YW8A 2VJFB 5FFWA 5B8DA 5SVYA 2G6QA 2L75A 5C11A 5EU1A 2L85A 2CSYA 5CFWA 3SHBA 4OGEA 2YELA 3D1DA 5FB1A 3L1ZB 5FFYA 1WESA 3SOXA 2YQDA 2JMIA 3S92A 4BHWA 5AMFA 2K4DA 5DLZA 4ZQLA 4QSWA 5FE6A 5CRMA 4HBVA 5JI8A 4QSSA 3FKMX 2CRWA 5KO4A 5C4QA 4AVXA 4UIXA 5EICA 4NS5A 1ZBDB 4WZ0A 5DW2A 4KV4A 2D9EA 4A9HA 4HBXA 3U5KA 2YQMA 5EK9A 4O77A 3KNVA 4NR6A 4BW2A 2IDAA 4UIYA 4NUDA 5D26A
chains in the Genus database with same CATH topology
3P1EA 1CHCA 4LRGA 5IIDA 4UIZA 4QUTA 1FP0A 1LDJB 4FIPA 2VPGA 5FH6A 2M6MA 4CLBA 4QC1A 5EVAA 5A85A 3UVDA 4LZ2A 3O7AA 3ZTGA 5LVQA 5FDZA 4HXOA 5EWDA 5AD2A 5CZGA 5G4RA 5A5NA 5ACYA 3N9MA 4LKAA 4QSPA 5LVRA 2KWJA 4TS8A 5CPEA 4WIVA 4XUAA 5HFRA 2L43A 3DWYA 5I80A 5EWWA 2ECGA 5G05B 2LGGA 2JRJA 5IG6A 5AD3A 5LKUA 4PY6A 5E9LA 5KTXA 4QSTA 3P1DA 3I2DA 4QC3A 4N4IA 2RS9B 2VPEA 3M63A 4O70A 4L58A 4RVRA 4HXPA 2KU3A 2QJ0A 2QIZA 4UYGA 1JM4B 3KQIA 5E73A 4YY4A 2KWOA 2KWKA 5C8GA 1F68A 4N4FA 3ZYUA 4NN2A 2KR4A 2MA5A 1X4IA 3O36A 5JWMA 5D3RA 4KV1A 4A9MA 1N72A 2VJFA 3UVYA 5D24A 1EQFA 5BT5A 5FE9A 3ASLA 4MEPA 4NYXA 5D3HA 5FBXA 3P1FA 5EWCA 4V3LC 4W4UA 2D8SA 1JM7A 4UYDA 2RNYA 5D25A 2KFTA 2MIQA 3GV4A 2VJEA 2MNZA 4MSXA 2E3KA 4GNEA 5HM0A 3ZVYA 5CQ6A 4FO9A 1K2FA 2RO1A 5ETBA 3SOWA 5ETDA 4BW4A 5FE5A 2ZETC 5D3JA 4HXMA 4IR5A 4YABA 1WEUA 4O76A 1V87A 3DAIA 3MXFA 4UIVA 4A9LA 2QICA 3RTRB 2M3HA 4GNGA 5A83A 5I7XA 4QEVA 5FE4A 2RNXA 4QR4A 2CT2A 5CQ5A 4ZUXU 5F5ZA 5CUDA 4O78A 2MA6A 4TU6A 4HXRA 1LDKC 1WEQA 3MQMA 4AKNA 4CUTA 1DVPA 4IC2A 4CFKA 4LYSA 4R2YA 2DVSA 5FE0A 2VPBA 2Y1MA 4AYCA 4A4CA 4TT6A 4NRAA 4Z1SA 2KTBB 3C5KA 3U5OA 4NUEA 4O64A 3O37A 2K17A 5C13A 5E3DA 2KYUA 3FL2A 4FJCA 5ENHA 1WFKA 2C2VS 4UYFB 5L8TA 4HXSA 2RNWA 5FE3A 5DKAA 4IC3A 2L84A 4XY9A 3RPGB 5DKCA 2FUUA 2H0DB 4N3WA 1BORA 2NAAA 2VPDA 4NR9A 3MB4A 4AUQB 5FE1A 2FSAA 5D3SA 4LZSA 2NXBA 3V43A 3LQHA 4YYJA 4NR4A 4MR4A 5EI4A 5FB0A 4V3KC 4IOQA 3PUQA 4HXKA 5CQ3A 5E9MA 3ZYQA 4F52B 5HCLA 4YK0A 2YU4A 5ENBA 2YYNA 3LXJA 3M62A 2I8NA 4E96A 1HYIA 1IYMA 2K16A 2F42A 2YDWA 4YBMA 4UYEA 5D1KB 2KGIA 4CUUA 4NR7A 2EODA 5H9MA 3IHPA 4WZ2A 4A9NA 5G04B 4Z6HA 4N4GA 2LDRA 2PNXA 4PKLA 2FUIA 5EM3A 5ENEA 5CU8A 2WP1A 3C6WA 5B78A 5H85A 4X2IA 5J0DA 2CKLA 5HJCA 2VP7A 5CRZA 5H1UA 3MB3A 4GNFA 4QSVA 5DW1A 3HMEA 5DX4A 4YYGA 5TCMA 5F36A 4YATA 2EA6A 3AADA 2F6NA 1X4JA 5I7YA 3JVKA 5EP7A 4YYKA 3HCSA 5B76A 2LGLA 3MHHA 4A0CD 5FH8A 4YYMA 5EPBA 5E9KA 5BT4A 4I7DA 4Z1QA 3RCWA 5C87A 4J1PA 5DYCA 1Z60A 5I1QA 4XYAA 4A4BA 5CS8A 5DYAA 2DVVA 3L11A 5IBNA 4MENA 5EQ1A 2MNYA 4QF2A 4UYFA 5E9YA 2XEUA 2MT5A 5TRBA 3T7LA 4Q0OA 5KH3A 4HXNA 4NUCA 4ZC9A 3U5LA 2MD7B 2MD8C 3ZPV1 5I3LA 4LR6A 1HYJA 1G25A 2PUYA 4QB3A 1WEEA 1WIMA 5EGUA 1XWHA 3LQJA 5ENGA 5FFVA 4YC9A 4R7EA 5F2PA 5H1VA 2DATA 5TB6A 5CUCA 3N9NA 4O7FA 2YEMA 3QZTA 5HEMA 5II2A 4CFLA 5I86A 5LJ1A 2WP2A 5D1LB 4O74A 2Y1NA 3N9QA 2ECTA 4TZ8A 4UP5A 4CUPA 4TTEA 2Y43A 2YHNA 4CUSA 5G4SA 2YT5A 2VNFA 3O35A 2L80A 2E6SA 5EPRA 2KREA 4ZDTA 3RPGC 4NQNA 5ENCA 4Q0NA 3PHDA 4C9ZA 4NXJA 5D0CA 5CQAA 5D3NA 1N87A 4TKPB 3TLPA 5EISA 3NG2A 5HFQA 5KU3A 4QF3A 1FBVA 4QEUA 4ALHA 4QSUA 5B75A 1WEOA 4UYHA 3G0LA 2L5EA 4YY6A 2R0SA 4NRCA 5DY7A 4UIUA 3SVFA 5I29A 4NQMA 5EWVA 2HDPA 5COIA 2YURA 5A5SA 2L0BA 4YYIA 2LGVA 5IGLA 4YH4A 5FH7A 5A7CA 5F63A 5C7NA 2F6JA 4MEOA 4P5OB 2E7NA 4UITA 4Z93A 2N9GA 4WA6A 5AIUA 4X3GA 2OSSA 5C85A 5IGNA 4GPJA 4CURA 1MM3A 1X4UA 4ZW1A 3GG3A 2OO1A 1WILA 1E4UA 5KHMA 3L1XA 4IORA 4TZ2A 2R0YA 5CUGA 4XY8A 1JOCA 1WEPA 2KWNA 2G45A 3VK6A 5F25A 5HLSA 1WEVA 5FEYA 2ECVA 2YSMA 3S91A 4CL9A 4QSXA 4YH3A 5E9VA 2YREA 5I83A 4TQNA 2YEKA 4CUQA 4BJXA 5A5PA 5K29A 3DPLR 5E0RA 4FK5A 3UVWA 5CQTA 4TU4A 1WENA 4S3OB 4J3IA 4YADA 5DBMA 4NRBA 5A5QA 5HRVA 5LUUA 2LGKA 4QSRA 5DFBA 4TYLA 5CY9A 2I50A 2MJVB 4HXLA 4B7YC 3U5PA 5A5RA 3MULA 3SVHA 2LV9A 1Z6UA 4IR6A 3MHSA 5IGKA 4XI1A 1WE9A 4IR4A 4LJNA 2E7OA 3QZSA 4NR5A 4O7BA 3QZVA 5CP5A 5FG5A 3MUKA 5FE2A 5KH7A 3LRQA 3UV4A 5E3GA 2K1JA 3JVMA 3G0JA 3GL6A 5AITA 3SVGA 5I88A 5DYUA 2ECJA 4LADB 5EV9A 4QY4A 2LRIC 3N9PA 5D3LA 4NYVA 1JM7B 2YYRA 2DKWA 4MVTA 5L96A 4PS5A 2VJEB 4O7AA 4IR3A 3P5OA 3KV5A 5HQ7A 5G0FA 4WHUA 2KGGA 4MEQA 2RI7A 1VFYA 4A49A 4YYDA 2LXHC 1WUMA 3O70A 5DFCA 5CQ8A 4YBSA 4WHWA 2G43A 3HMHA 5KH9A 4A9IA 3HTKC 2MUMA 5L99A 3SOUA 1F62A 5LJ2A 2ECNA 4AP4A 4MR3A 5F61A 3HCTA 2D82A 4UIWA 5EYAF 2R0VA 1E6IA 5HRWA 5TDWA 3ZVZB 5D3TA 4QR3A 1WUGA 4HBYA 3ZNIA 4O72A 2CSZA 2GRCA 5CUBA 5IGMA 2JMJA 2G4AA 3N9OA 5HQ5A 4DONA 5D7XA 5CQ7A 4Q6FA 3M99A 3D7CA 1WGMA 2M85A 2XB1A 2ECIA 2H0DA 4A9KA 5LJ0A 4CCGX 2M1RA 5FERA 4AYCB 3EB6A 4LDFA 2YHOA 5DINA 4OGIA 3JVLA 2EGPA 4YYHA 3O33A 2UZGA 3ONIA 5KTUA 3IU6A 5B77A 3DQVR 3AQAA 1MM2A 5A82A 4QBMA 1VD4A 2HYED 4PCIA 3IU5A 4QZSA 1ZS5A 3EB5A 4LYIA 4A9JA 3UV2A 4PCEA 5B79A 4GB0A 4QYLA 2KIZA 4QYDA 5CQ4A 4L7XA 5JG6A 5AMEA 4IOOA 2E6RA 1WEWA 5TBNA 5BT3A 4LYWA 4S3OC 5F1HA 5A81A 5ENIA 5DYXA 2I7KA 4TT4A 4QUUA 4PPEA 4OUFA 4LC2A 4MR6A 5DFDA 4LLBA 5LKZA 4J0SA 3NXBA 5HRXA 1T1HA 4I7BA 2BAYA 4LZRA 5E74A 3KV6A 5F3AA 5A5OA 3LJWA 2RFJA 5E7DA 3HMFA 4O7EA 4A9EA 5EPSA 5FE7A 3JVJA 3O34A 3UW9A 4A9FA 2OXQC 2LXPC 1WEMA 5I40A 4I7CA 2ECWA 5FE8A 2H60A 3UV5A 4HBWA 2LN0A 5D3PA 5FG6A 4C66A 4YYNA 2DX8A 2DVQA 5TDRA 4KCXA 2RSDA 4UP0A 4CA1A 4WZ3B 4NR8A 5LKTA 2CKLB 3Q2EA 1Z2QA 5L98A 4OGJA 4O75A 5EA1A 5ENFA 4XUBA 2YSJA 4N4HA 1U6GB 4O71A 3U5MA 3U5NA 4F3IA 5EWHA 4QR5A 2C2LA 5L97A 4A9OA 5CUAA 5DKDA 4BW1A 2KE1A 5II1A 5J3XA 3PURA 4UI9B 4PTBA 4Y03A 2LSPB 3P1CA 5TABA 1JSPB 5HENA 3T6RA 3I3JA 5FG4A 3LQIA 4J0RA 4YAXA 4C67A 5L8UA 1VYXA 5E9IA 5LCWB 4B86C 4TT2A 4R8PK 4GNDA 5DLXA 1RMDA 3Q2FA 5H1TA 4QNSA 3K2JA 5KTWA 2DVRA 4QSQA 2OUOA 2YW5A 4Z6IA 3N9LA 2JMDA 3HCUA 5CUEA 4ALGA 4O7CA 1X0JA 5HELA 5D1MB 4YBTA 5DKHA 5HQ6A 5F60A 5ENJA 4BW3A 4QEWA 5LKXA 2AN6A 2YUCA 5CGPA 4NYWA 5C89A 4LK9A 2L5UA 5F1LA 2LQ6A 4FLPA 5I89A 3UVXA 3ZPVE 4BBQA 5F62A 5CTLA 2DWWA 2YQLA 3U5JA 2R10A 4MR5A 2YW8A 2VJFB 5FFWA 5B8DA 5C11A 2G6QA 2L75A 5EU1A 2L85A 2CSYA 5CFWA 3SHBA 2YELA 5FB1A 3L1ZB 5FFYA 1WESA 3SOXA 2YQDA 2JMIA 3S92A 4BHWA 5AMFA 2K4DA 5DLZA 4ZQLA 4QSWA 5FE6A 5CRMA 4HBVA 5JI8A 4QSSA 3FKMX 5KO4A 5C4QA 4AVXA 4UIXA 5EICA 4NS5A 1ZBDB 4WZ0A 5DW2A 4KV4A 2D9EA 4A9HA 4HBXA 3U5KA 2YQMA 5EK9A 4O77A 3KNVA 4NR6A 4BW2A 2IDAA 4UIYA 4NUDA 5D26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1E A;  1CHC A;  4LRG A;  5IID A;  4UIZ A;  4QUT A;  1FP0 A;  1LDJ B;  4FIP A;  2VPG A;  5FH6 A;  2M6M A;  4CLB A;  4QC1 A;  5EVA A;  5A85 A;  3UVD A;  4LZ2 A;  3O7A A;  3ZTG A;  5LVQ A;  5FDZ A;  4HXO A;  5EWD A;  5AD2 A;  5CZG A;  5G4R A;  5A5N A;  5ACY A;  3N9M A;  4LKA A;  4QSP A;  5LVR A;  2KWJ A;  4TS8 A;  5CPE A;  4WIV A;  4XUA A;  5HFR A;  2L43 A;  3DWY A;  5I80 A;  5EWW A;  2ECG A;  5G05 B;  2LGG A;  2JRJ A;  5IG6 A;  5AD3 A;  5LKU A;  4PY6 A;  5E9L A;  5KTX A;  4QST A;  3P1D A;  3I2D A;  4QC3 A;  4N4I A;  2RS9 B;  2VPE A;  3M63 A;  4O70 A;  4L58 A;  4RVR A;  4HXP A;  2KU3 A;  2QJ0 A;  2QIZ A;  4UYG A;  1JM4 B;  3KQI A;  5E73 A;  4YY4 A;  2KWO A;  2KWK A;  5C8G A;  1F68 A;  4N4F A;  3ZYU A;  4NN2 A;  2KR4 A;  2MA5 A;  1X4I A;  3O36 A;  5JWM A;  5D3R A;  4KV1 A;  4A9M A;  1N72 A;  2VJF A;  3UVY A;  5D24 A;  1EQF A;  5BT5 A;  5FE9 A;  3ASL A;  4MEP A;  4NYX A;  5D3H A;  5FBX A;  3P1F A;  5EWC A;  4V3L C;  4W4U A;  2D8S A;  1JM7 A;  4UYD A;  2RNY A;  5D25 A;  2KFT A;  2MIQ A;  3GV4 A;  2VJE A;  2MNZ A;  4MSX A;  2E3K A;  4GNE A;  5HM0 A;  3ZVY A;  5CQ6 A;  4FO9 A;  1K2F A;  2RO1 A;  5ETB A;  3SOW A;  5ETD A;  4BW4 A;  5FE5 A;  2ZET C;  5D3J A;  4HXM A;  4IR5 A;  4YAB A;  1WEU A;  4O76 A;  1V87 A;  3DAI A;  3MXF A;  4UIV A;  4A9L A;  2QIC A;  3RTR B;  2M3H A;  4GNG A;  5A83 A;  5I7X A;  4QEV A;  5FE4 A;  2RNX A;  4QR4 A;  2CT2 A;  5CQ5 A;  4ZUX U;  5F5Z A;  5CUD A;  4O78 A;  2MA6 A;  4TU6 A;  4HXR A;  1LDK C;  1WEQ A;  3MQM A;  4AKN A;  4CUT A;  1DVP A;  4IC2 A;  4CFK A;  4LYS A;  4R2Y A;  2DVS A;  5FE0 A;  2VPB A;  2Y1M A;  4AYC A;  4A4C A;  4TT6 A;  4NRA A;  4Z1S A;  2KTB B;  3C5K A;  3U5O A;  4NUE A;  4O64 A;  3O37 A;  2K17 A;  5C13 A;  5E3D A;  2KYU A;  3FL2 A;  4FJC A;  5ENH A;  1WFK A;  2C2V S;  4UYF B;  5L8T A;  4HXS A;  2RNW A;  5FE3 A;  5DKA A;  4IC3 A;  2L84 A;  4XY9 A;  3RPG B;  5DKC A;  2FUU A;  2H0D B;  4N3W A;  1BOR A;  2NAA A;  2VPD A;  4NR9 A;  3MB4 A;  4AUQ B;  5FE1 A;  2FSA A;  5D3S A;  4LZS A;  2NXB A;  3V43 A;  3LQH A;  4YYJ A;  4NR4 A;  4MR4 A;  5EI4 A;  5FB0 A;  4V3K C;  4IOQ A;  3PUQ A;  4HXK A;  5CQ3 A;  5E9M A;  3ZYQ A;  4F52 B;  5HCL A;  4YK0 A;  2YU4 A;  5ENB A;  2YYN A;  3LXJ A;  3M62 A;  2I8N A;  4E96 A;  1HYI A;  1IYM A;  2K16 A;  2F42 A;  2YDW A;  4YBM A;  4UYE A;  5D1K B;  2KGI A;  4CUU A;  4NR7 A;  2EOD A;  5H9M A;  3IHP A;  4WZ2 A;  4A9N A;  5G04 B;  4Z6H A;  4N4G A;  2LDR A;  2PNX A;  4PKL A;  2FUI A;  5EM3 A;  5ENE A;  5CU8 A;  2WP1 A;  3C6W A;  5B78 A;  5H85 A;  4X2I A;  5J0D A;  2CKL A;  5HJC A;  2VP7 A;  5CRZ A;  5H1U A;  3MB3 A;  4GNF A;  4QSV A;  5DW1 A;  3HME A;  5DX4 A;  4YYG A;  5TCM A;  5F36 A;  4YAT A;  2EA6 A;  3AAD A;  2F6N A;  1X4J A;  5I7Y A;  3JVK A;  5EP7 A;  4YYK A;  3HCS A;  5B76 A;  2LGL A;  3MHH A;  4A0C D;  5FH8 A;  4YYM A;  5EPB A;  5E9K A;  5BT4 A;  4I7D A;  4Z1Q A;  3RCW A;  5C87 A;  4J1P A;  5DYC A;  1Z60 A;  5I1Q A;  4XYA A;  4A4B A;  5CS8 A;  5DYA A;  2DVV A;  3L11 A;  5IBN A;  4MEN A;  5EQ1 A;  2MNY A;  4QF2 A;  4UYF A;  5E9Y A;  2XEU A;  2MT5 A;  5TRB A;  3T7L A;  4Q0O A;  5KH3 A;  4HXN A;  4NUC A;  4ZC9 A;  3U5L A;  2MD7 B;  2MD8 C;  3ZPV 1;  5I3L A;  4LR6 A;  1HYJ A;  1G25 A;  2PUY A;  4QB3 A;  1WEE A;  1WIM A;  5EGU A;  1XWH A;  3LQJ A;  5ENG A;  5FFV A;  4YC9 A;  4R7E A;  5F2P A;  5H1V A;  2DAT A;  5TB6 A;  5CUC A;  3N9N A;  4O7F A;  2YEM A;  3QZT A;  5HEM A;  5II2 A;  4CFL A;  5I86 A;  5LJ1 A;  2WP2 A;  5D1L B;  4O74 A;  2Y1N A;  3N9Q A;  2ECT A;  4TZ8 A;  4UP5 A;  4CUP A;  4TTE A;  2Y43 A;  2YHN A;  4CUS A;  5G4S A;  2YT5 A;  2VNF A;  3O35 A;  2L80 A;  2E6S A;  5EPR A;  2KRE A;  4ZDT A;  3RPG C;  4NQN A;  5ENC A;  4Q0N A;  3PHD A;  4C9Z A;  4NXJ A;  5D0C A;  5CQA A;  5D3N A;  1N87 A;  4TKP B;  3TLP A;  5EIS A;  3NG2 A;  5HFQ A;  5KU3 A;  4QF3 A;  1FBV A;  4QEU A;  4ALH A;  4QSU A;  5B75 A;  1WEO A;  4UYH A;  3G0L A;  2L5E A;  4YY6 A;  2R0S A;  4NRC A;  5DY7 A;  4UIU A;  3SVF A;  5I29 A;  4NQM A;  5EWV A;  2HDP A;  5COI A;  2YUR A;  5A5S A;  2L0B A;  4YYI A;  2LGV A;  5IGL A;  4YH4 A;  5FH7 A;  5A7C A;  5F63 A;  5C7N A;  2F6J A;  4MEO A;  4P5O B;  2E7N A;  4UIT A;  4Z93 A;  2N9G A;  4WA6 A;  5AIU A;  4X3G A;  2OSS A;  5C85 A;  5IGN A;  4GPJ A;  4CUR A;  1MM3 A;  1X4U A;  4ZW1 A;  3GG3 A;  2OO1 A;  1WIL A;  1E4U A;  5KHM A;  3L1X A;  4IOR A;  4TZ2 A;  2R0Y A;  5CUG A;  4XY8 A;  1JOC A;  1WEP A;  2KWN A;  2G45 A;  3VK6 A;  5F25 A;  5HLS A;  1WEV A;  5FEY A;  2ECV A;  2YSM A;  3S91 A;  4CL9 A;  4QSX A;  4YH3 A;  5E9V A;  2YRE A;  5I83 A;  4TQN A;  2YEK A;  4CUQ A;  4BJX A;  5A5P A;  5K29 A;  3DPL R;  5E0R A;  4FK5 A;  3UVW A;  5CQT A;  4TU4 A;  1WEN A;  4S3O B;  4J3I A;  4YAD A;  5DBM A;  4NRB A;  5A5Q A;  5HRV A;  5LUU A;  2LGK A;  4QSR A;  5DFB A;  4TYL A;  5CY9 A;  2I50 A;  2MJV B;  4HXL A;  4B7Y C;  3U5P A;  5A5R A;  3MUL A;  3SVH A;  2LV9 A;  1Z6U A;  4IR6 A;  3MHS A;  5IGK A;  4XI1 A;  1WE9 A;  4IR4 A;  4LJN A;  2E7O A;  3QZS A;  4NR5 A;  4O7B A;  3QZV A;  5CP5 A;  5FG5 A;  3MUK A;  5FE2 A;  5KH7 A;  3LRQ A;  3UV4 A;  5E3G A;  2K1J A;  3JVM A;  3G0J A;  3GL6 A;  5AIT A;  3SVG A;  5I88 A;  5DYU A;  2ECJ A;  4LAD B;  5EV9 A;  4QY4 A;  2LRI C;  3N9P A;  5D3L A;  4NYV A;  1JM7 B;  2YYR A;  2DKW A;  4MVT A;  5L96 A;  4PS5 A;  2VJE B;  4O7A A;  4IR3 A;  3P5O A;  3KV5 A;  5HQ7 A;  5G0F A;  4WHU A;  2KGG A;  4MEQ A;  2RI7 A;  1VFY A;  4A49 A;  4YYD A;  2LXH C;  1WUM A;  3O70 A;  5DFC A;  5CQ8 A;  4YBS A;  4WHW A;  2G43 A;  3HMH A;  5KH9 A;  4A9I A;  3HTK C;  2MUM A;  5L99 A;  3SOU A;  1F62 A;  5LJ2 A;  2ECN A;  4AP4 A;  4MR3 A;  5F61 A;  3HCT A;  2D82 A;  4UIW A;  5EYA F;  2R0V A;  1E6I A;  5HRW A;  5TDW A;  3ZVZ B;  5D3T A;  4QR3 A;  1WUG A;  4HBY A;  3ZNI A;  4O72 A;  2CSZ A;  2GRC A;  5CUB A;  5IGM A;  2JMJ A;  2G4A A;  3N9O A;  5HQ5 A;  4DON A;  5D7X A;  5CQ7 A;  4Q6F A;  3M99 A;  3D7C A;  1WGM A;  2M85 A;  2XB1 A;  2ECI A;  2H0D A;  4A9K A;  5LJ0 A;  4CCG X;  2M1R A;  5FER A;  4AYC B;  3EB6 A;  4LDF A;  2YHO A;  5DIN A;  4OGI A;  3JVL A;  2EGP A;  4YYH A;  3O33 A;  2UZG A;  3ONI A;  5KTU A;  3IU6 A;  5B77 A;  3DQV R;  3AQA A;  1MM2 A;  5A82 A;  4QBM A;  1VD4 A;  2HYE D;  4PCI A;  3IU5 A;  4QZS A;  1ZS5 A;  3EB5 A;  4LYI A;  4A9J A;  3UV2 A;  4PCE A;  5B79 A;  4GB0 A;  4QYL A;  2KIZ A;  4QYD A;  5CQ4 A;  4L7X A;  5JG6 A;  5AME A;  4IOO A;  2E6R A;  1WEW A;  5TBN A;  5BT3 A;  4LYW A;  4S3O C;  5F1H A;  5A81 A;  5ENI A;  5DYX A;  2I7K A;  4TT4 A;  4QUU A;  4PPE A;  4OUF A;  4LC2 A;  4MR6 A;  5DFD A;  4LLB A;  5LKZ A;  4J0S A;  3NXB A;  5HRX A;  1T1H A;  4I7B A;  2BAY A;  4LZR A;  5E74 A;  3KV6 A;  5F3A A;  5A5O A;  3LJW A;  2RFJ A;  5E7D A;  3HMF A;  4O7E A;  4A9E A;  5EPS A;  5FE7 A;  3JVJ A;  3O34 A;  3UW9 A;  4A9F A;  2OXQ C;  2LXP C;  1WEM A;  5I40 A;  4I7C A;  2ECW A;  5FE8 A;  2H60 A;  3UV5 A;  4HBW A;  2LN0 A;  5D3P A;  5FG6 A;  4C66 A;  4YYN A;  2DX8 A;  2DVQ A;  5TDR A;  4KCX A;  2RSD A;  4UP0 A;  4CA1 A;  4WZ3 B;  4NR8 A;  5LKT A;  2CKL B;  3Q2E A;  1Z2Q A;  5L98 A;  4OGJ A;  4O75 A;  5EA1 A;  5ENF A;  4XUB A;  2YSJ A;  4N4H A;  1U6G B;  4O71 A;  3U5M A;  3U5N A;  4F3I A;  5EWH A;  4QR5 A;  2C2L A;  5L97 A;  4A9O A;  5CUA A;  5DKD A;  4BW1 A;  2KE1 A;  5II1 A;  5J3X A;  3PUR A;  4UI9 B;  4PTB A;  4Y03 A;  2LSP B;  3P1C A;  5TAB A;  1JSP B;  5HEN A;  3T6R A;  3I3J A;  5FG4 A;  3LQI A;  4J0R A;  4YAX A;  4C67 A;  5L8U A;  1VYX A;  5E9I A;  5LCW B;  4B86 C;  4TT2 A;  4R8P K;  4GND A;  5DLX A;  1RMD A;  3Q2F A;  5H1T A;  4QNS A;  3K2J A;  5KTW A;  2DVR A;  4QSQ A;  2OUO A;  2YW5 A;  4Z6I A;  3N9L A;  2JMD A;  3HCU A;  5CUE A;  4ALG A;  4O7C A;  1X0J A;  5HEL A;  5D1M B;  4YBT A;  5DKH A;  5HQ6 A;  5F60 A;  5ENJ A;  4BW3 A;  4QEW A;  5LKX A;  2AN6 A;  2YUC A;  5CGP A;  4NYW A;  5C89 A;  4LK9 A;  2L5U A;  5F1L A;  2LQ6 A;  4FLP A;  5I89 A;  3UVX A;  3ZPV E;  4BBQ A;  5F62 A;  5CTL A;  2DWW A;  2YQL A;  3U5J A;  2R10 A;  4MR5 A;  2YW8 A;  2VJF B;  5FFW A;  5B8D A;  5C11 A;  2G6Q A;  2L75 A;  5EU1 A;  2L85 A;  2CSY A;  5CFW A;  3SHB A;  2YEL A;  5FB1 A;  3L1Z B;  5FFY A;  1WES A;  3SOX A;  2YQD A;  2JMI A;  3S92 A;  4BHW A;  5AMF A;  2K4D A;  5DLZ A;  4ZQL A;  4QSW A;  5FE6 A;  5CRM A;  4HBV A;  5JI8 A;  4QSS A;  3FKM X;  5KO4 A;  5C4Q A;  4AVX A;  4UIX A;  5EIC A;  4NS5 A;  1ZBD B;  4WZ0 A;  5DW2 A;  4KV4 A;  2D9E A;  4A9H A;  4HBX A;  3U5K A;  2YQM A;  5EK9 A;  4O77 A;  3KNV A;  4NR6 A;  4BW2 A;  2IDA A;  4UIY A;  4NUD A;  5D26 A; 
#chains in the Genus database with same CATH topology
 3P1E A;  1CHC A;  2KKX A;  4LRG A;  5IID A;  4UIZ A;  4QUT A;  5SVX A;  1FP0 A;  1LDJ B;  4FIP A;  5K3Q A;  2VPG A;  5FH6 A;  2M6M A;  4CLB A;  4QC1 A;  5EVA A;  5A85 A;  3UVD A;  4LZ2 A;  3O7A A;  3ZTG A;  5LVQ A;  5FDZ A;  2CRR A;  4HXO A;  5EWD A;  5AD2 A;  5CZG A;  5G4R A;  5A5N A;  5ACY A;  3N9M A;  4LKA A;  4QSP A;  5LVR A;  2KWJ A;  4TS8 A;  5CPE A;  1MBM A;  4WIV A;  4XUA A;  5HFR A;  2L43 A;  3DWY A;  5I80 A;  5EWW A;  2ECG A;  5G05 B;  2LGG A;  2JRJ A;  5IG6 A;  3FEH A;  5AD3 A;  5LKU A;  3DWD A;  4PY6 A;  5E9L A;  5KTX A;  4QST A;  3P1D A;  3I2D A;  4QC3 A;  4N4I A;  2RS9 B;  2VPE A;  2EGM A;  3M63 A;  4O70 A;  4L58 A;  4RVR A;  4HXP A;  2KU3 A;  2QJ0 A;  2QIZ A;  4UYG A;  1JM4 B;  3KQI A;  5E73 A;  4YY4 A;  5SVI A;  2KWO A;  2KWK A;  5C8G A;  1F68 A;  4N4F A;  3ZYU A;  4NN2 A;  2KR4 A;  2MA5 A;  1X4I A;  3O36 A;  5JWM A;  5D3R A;  4KV1 A;  4A9M A;  1N72 A;  2VJF A;  3UVY A;  5D24 A;  1EQF A;  5BT5 A;  5FE9 A;  3ASL A;  4MEP A;  4NYX A;  5D3H A;  5FBX A;  3P1F A;  5EWC A;  2JUN A;  4V3L C;  4W4U A;  3T9K A;  4OGC A;  2D8S A;  1JM7 A;  4UYD A;  2RNY A;  5D25 A;  2KFT A;  2MIQ A;  3GV4 A;  2VJE A;  2MNZ A;  4MSX A;  2E3K A;  4GNE A;  5HM0 A;  3ZVY A;  5CQ6 A;  2FD4 A;  4FO9 A;  1K2F A;  2RO1 A;  5ETB A;  3SOW A;  5ETD A;  4BW4 A;  2D8U A;  5FE5 A;  2ZET C;  5D3J A;  4HXM A;  4IR5 A;  4YAB A;  1WEU A;  4O76 A;  1V87 A;  3FJU B;  3DAI A;  3MXF A;  4UIV A;  4A9L A;  2QIC A;  3RTR B;  2M3H A;  4GNG A;  5A83 A;  5I7X A;  4QEV A;  5FE4 A;  2RNX A;  4QR4 A;  2CT2 A;  5CQ5 A;  4ZUX U;  5F5Z A;  5CUD A;  4O78 A;  2MA6 A;  4TU6 A;  4HXR A;  1LDK C;  1WEQ A;  3MQM A;  4AKN A;  4CUT A;  1DVP A;  3PLW A;  4IC2 A;  4CFK A;  4LYS A;  4R2Y A;  2DVS A;  3LVQ E;  5FE0 A;  2VPB A;  2Y1M A;  4AYC A;  4A4C A;  4TT6 A;  4NRA A;  4Z1S A;  2KTB B;  3C5K A;  3U5O A;  4NUE A;  4O64 A;  3O37 A;  2K17 A;  5C13 A;  5E3D A;  2KYU A;  3FL2 A;  4FJC A;  2EJN A;  5ENH A;  1WFK A;  2C2V S;  4UYF B;  5L8T A;  4HXS A;  2RNW A;  5FE3 A;  3Q1D A;  4AKI A;  5DKA A;  4IC3 A;  2L84 A;  4XY9 A;  3RPG B;  5DKC A;  2FUU A;  2H0D B;  4N3W A;  1BOR A;  2NAA A;  2VPD A;  4NR9 A;  3MB4 A;  4AUQ B;  5FE1 A;  2FSA A;  3E2D A;  5D3S A;  4LZS A;  2NXB A;  3V43 A;  3LQH A;  4YYJ A;  4NR4 A;  4MR4 A;  5EI4 A;  5FB0 A;  4V3K C;  4IOQ A;  3PUQ A;  4HXK A;  5CQ3 A;  5E9M A;  3ZYQ A;  2E61 A;  5HCL A;  4F52 B;  4YK0 A;  2YU4 A;  5ENB A;  2YYN A;  3LXJ A;  2DJA A;  2I8N A;  4E96 A;  3M62 A;  1HYI A;  1IYM A;  2K16 A;  2F42 A;  2YDW A;  4YBM A;  4UYE A;  5D1K B;  2KGI A;  4CUU A;  2YVR A;  4NR7 A;  2EOD A;  5H9M A;  3IHP A;  4WZ2 A;  4A9N A;  5G04 B;  4Z6H A;  4N4G A;  2LDR A;  2PNX A;  4PKL A;  2FUI A;  5EM3 A;  5ENE A;  5CU8 A;  2WP1 A;  3C6W A;  5B78 A;  5H85 A;  4X2I A;  5J0D A;  2CKL A;  5HJC A;  2VP7 A;  5CRZ A;  5H1U A;  3MB3 A;  4GNF A;  4QSV A;  5DW1 A;  3HME A;  5DX4 A;  4YYG A;  5TCM A;  5F36 A;  2CON A;  4YAT A;  2EA6 A;  3AAD A;  2F6N A;  1X4J A;  5I7Y A;  3JVK A;  5EP7 A;  4YYK A;  3HCS A;  5B76 A;  1DCQ A;  2LGL A;  3MHH A;  4A0C D;  5FH8 A;  3LDY A;  4YYM A;  5EPB A;  5E9K A;  5BT4 A;  4I7D A;  4Z1Q A;  3RCW A;  2IQJ A;  5C87 A;  4J1P A;  5DYC A;  1Z60 A;  5I1Q A;  4XYA A;  4A4B A;  5CS8 A;  5DYA A;  2DVV A;  3L11 A;  5IBN A;  4MEN A;  5EQ1 A;  2MNY A;  4QF2 A;  4UYF A;  5E9Y A;  2P57 A;  2MT5 A;  2XEU A;  5TRB A;  2EXU A;  3T7L A;  4Q0O A;  2MKE A;  5KH3 A;  4HXN A;  4NUC A;  4ZC9 A;  3U5L A;  2MD7 B;  2MD8 C;  3ZPV 1;  5I3L A;  4LR6 A;  1HYJ A;  1G25 A;  2PUY A;  4QB3 A;  1WEE A;  1WIM A;  5EGU A;  1XWH A;  2XP0 A;  3LQJ A;  5ENG A;  5FFV A;  4YC9 A;  4AI6 A;  2M13 A;  4R7E A;  5F2P A;  5H1V A;  2DAT A;  5TB6 A;  5CUC A;  3N9N A;  4O7F A;  2YEM A;  2LAU A;  3QZT A;  5HEM A;  5II2 A;  4CFL A;  5I86 A;  5LJ1 A;  4Z0O A;  2WP2 A;  5D1L B;  4O74 A;  2Y1N A;  3N9Q A;  2ECT A;  4TZ8 A;  4UP5 A;  4CUP A;  4TTE A;  2Y43 A;  2YHN A;  4CUS A;  5G4S A;  2YT5 A;  2VNF A;  3O35 A;  3LJU X;  2L80 A;  2E6S A;  5EPR A;  2KRE A;  4ZDT A;  3RPG C;  4NQN A;  5ENC A;  4Q0N A;  3PHD A;  4C9Z A;  4NXJ A;  5D0C A;  5CQA A;  5D3N A;  1N87 A;  4TKP B;  3JUE A;  3TLP A;  5EIS A;  3NG2 A;  5HFQ A;  5KU3 A;  4QF3 A;  1FBV A;  4QEU A;  4ALH A;  4QSU A;  5B75 A;  1WEO A;  4UYH A;  3G0L A;  2L5E A;  4YY6 A;  2R0S A;  4NRC A;  5DY7 A;  4UIU A;  3SVF A;  5I29 A;  4NQM A;  5EWV A;  2HDP A;  5COI A;  2YUR A;  5A5S A;  2L0B A;  4YYI A;  2LGV A;  5IGL A;  4YH4 A;  5FH7 A;  5A7C A;  5F63 A;  5C7N A;  2F6J A;  4MEO A;  4P5O B;  2E7N A;  4UIT A;  4Z93 A;  2N9G A;  4WA6 A;  5AIU A;  4X3G A;  2OSS A;  5C85 A;  5IGN A;  4GPJ A;  4CUR A;  3VKG A;  1MM3 A;  1X4U A;  4ZW1 A;  2KKY A;  3GG3 A;  2OO1 A;  1WIL A;  1E4U A;  5KHM A;  3L1X A;  4IOR A;  4TZ2 A;  2R0Y A;  5CUG A;  4XY8 A;  1JOC A;  1WEP A;  4QQ4 A;  2KWN A;  2G45 A;  3VK6 A;  5F25 A;  5HLS A;  1WEV A;  3FM8 C;  3H7H A;  5FEY A;  2ECV A;  2YSM A;  3S91 A;  4CL9 A;  4QSX A;  4YH3 A;  5E9V A;  2YRE A;  5I83 A;  4TQN A;  2YEK A;  4CUQ A;  4BJX A;  5A5P A;  5K29 A;  3DPL R;  5E0R A;  4FK5 A;  3UVW A;  5CQT A;  4TU4 A;  1WEN A;  4S3O B;  4J3I A;  4YAD A;  5DBM A;  4NRB A;  5A5Q A;  2XOC A;  5HRV A;  5LUU A;  2CSV A;  2LGK A;  4QSR A;  5DFB A;  4TYL A;  5CY9 A;  2I50 A;  2MJV B;  4HXL A;  4B7Y C;  2DSM A;  2JM3 A;  3U5P A;  5A5R A;  3MUL A;  3SVH A;  2LV9 A;  1Z6U A;  4IR6 A;  3MHS A;  5IGK A;  4XI1 A;  4Z0R A;  1WE9 A;  4IR4 A;  4LJN A;  2E7O A;  3QZS A;  2XOY A;  4F1P A;  4NR5 A;  4O7B A;  3QZV A;  5CP5 A;  5FG5 A;  3MUK A;  5FE2 A;  5SVI B;  3LRQ A;  5KH7 A;  3UV4 A;  5E3G A;  2K1J A;  3JVM A;  3G0J A;  3GL6 A;  5AIT A;  3SVG A;  5I88 A;  5DYU A;  2ECJ A;  4LAD B;  5EV9 A;  4QY4 A;  2LRI C;  3D1B A;  3N9P A;  5D3L A;  4NYV A;  1JM7 B;  2YYR A;  2DKW A;  4MVT A;  5L96 A;  4PS5 A;  2VJE B;  4O7A A;  4IR3 A;  3P5O A;  3KV5 A;  5HQ7 A;  5G0F A;  4WHU A;  2KGG A;  4MEQ A;  2RI7 A;  1VFY A;  4A49 A;  4YYD A;  2LXH C;  1WUM A;  3O70 A;  5DFC A;  5CQ8 A;  4YBS A;  4WHW A;  2G43 A;  3HMH A;  5KH9 A;  4A9I A;  3HTK C;  2MUM A;  5L99 A;  3SOU A;  1F62 A;  5LJ2 A;  2ECN A;  4AP4 A;  3LVR E;  4MR3 A;  5F61 A;  3HCT A;  2D82 A;  4UIW A;  5EYA F;  2R0V A;  1E6I A;  5HRW A;  5TDW A;  3ZVZ B;  4AKH A;  5D3T A;  4QR3 A;  1WUG A;  4HBY A;  1ZKR A;  3ZNI A;  4O72 A;  2CSZ A;  2GRC A;  5CUB A;  5IGM A;  2JMJ A;  2G4A A;  3N9O A;  5HQ5 A;  4DON A;  5D7X A;  5CQ7 A;  4Q6F A;  3M99 A;  3D7C A;  1WGM A;  2M85 A;  2XB1 A;  2ECI A;  2H0D A;  1PUO A;  4A9K A;  5LJ0 A;  4CCG X;  2M1R A;  5FER A;  4AYC B;  3EB6 A;  4LDF A;  2YHO A;  5DIN A;  4OGI A;  3JVL A;  2EGP A;  4YYH A;  3VKH A;  2XOZ A;  3O33 A;  2UZG A;  3ONI A;  5KTU A;  3IU6 A;  5B77 A;  3DQV R;  3AQA A;  1MM2 A;  5A82 A;  4QBM A;  1VD4 A;  2HYE D;  4PCI A;  3IU5 A;  4QZS A;  1ZS5 A;  3EB5 A;  4LYI A;  4A9J A;  3UV2 A;  4PCE A;  5B79 A;  2OWA A;  4GB0 A;  4QYL A;  2KIZ A;  4QYD A;  5CQ4 A;  4L7X A;  5JG6 A;  5AME A;  4IOO A;  2E6R A;  1WEW A;  3ERR A;  5TBN A;  5BT3 A;  4LYW A;  4S3O C;  5F1H A;  5A81 A;  5ENI A;  5DYX A;  2I7K A;  4TT4 A;  4QUU A;  4PPE A;  4OUF A;  4LC2 A;  4MR6 A;  5DFD A;  4LLB A;  5LKZ A;  4J0S A;  3NXB A;  5HRX A;  1T1H A;  4I7B A;  4AKG A;  2BAY A;  2RR4 A;  4LZR A;  5E74 A;  3KV6 A;  5F3A A;  5A5O A;  2L7P A;  3LJW A;  2RFJ A;  5E7D A;  3HMF A;  4O7E A;  4A9E A;  5EPS A;  5FE7 A;  3JVJ A;  3O34 A;  3UW9 A;  4A9F A;  2OXQ C;  2LXP C;  1WEM A;  5I40 A;  4I7C A;  2FFW A;  2ECW A;  5FE8 A;  2H60 A;  3UV5 A;  4HBW A;  2LN0 A;  5D3P A;  5FG6 A;  4C66 A;  3DDT A;  4YYN A;  2DX8 A;  2DVQ A;  3MDB C;  4KCX A;  2RSD A;  4UP0 A;  5TDR A;  4CA1 A;  4WZ3 B;  4NR8 A;  5LKT A;  2CKL B;  3Q2E A;  1Z2Q A;  5L98 A;  4OGJ A;  4O75 A;  5EA1 A;  5ENF A;  4XUB A;  2YSJ A;  2B0O E;  4O62 A;  4N4H A;  1U6G B;  4O71 A;  3U5M A;  3U5N A;  4F3I A;  5EWH A;  4QR5 A;  2C2L A;  5L97 A;  4A9O A;  5CUA A;  5DKD A;  4BW1 A;  2KE1 A;  5II1 A;  5J3X A;  3PUR A;  4UI9 B;  4PTB A;  4Y03 A;  3O47 A;  2LSP B;  3P1C A;  5TAB A;  1JSP B;  5HEN A;  3T6R A;  3I3J A;  5FG4 A;  3LQI A;  4J0R A;  4YAX A;  4C67 A;  5L8U A;  1VYX A;  5E9I A;  5LCW B;  4B86 C;  3FAO A;  4TT2 A;  3M7K A;  4R8P K;  4GND A;  5DLX A;  1RMD A;  3Q2F A;  5H1T A;  4QNS A;  3K2J A;  5KTW A;  2DVR A;  4QSQ A;  2OUO A;  2YW5 A;  4Z6I A;  3N9L A;  2JMD A;  3HCU A;  5CUE A;  4ALG A;  4O7C A;  1X0J A;  5HEL A;  5D1M B;  4YBT A;  3KDE C;  5DKH A;  5HQ6 A;  5F60 A;  5ENJ A;  4BW3 A;  4QEW A;  5LKX A;  2AN6 A;  2YUC A;  3SUB A;  5CGP A;  4NYW A;  5C89 A;  4LK9 A;  2L5U A;  5F1L A;  4H9D A;  2LQ6 A;  4FLP A;  5I89 A;  3UVX A;  3ZPV E;  4BBQ A;  5F62 A;  5CTL A;  2DWW A;  3FAN A;  2YQL A;  3U5J A;  2R10 A;  4MR5 A;  2YW8 A;  2VJF B;  5FFW A;  5B8D A;  5SVY A;  2G6Q A;  2L75 A;  5C11 A;  5EU1 A;  2L85 A;  2CSY A;  5CFW A;  3SHB A;  4OGE A;  2YEL A;  3D1D A;  5FB1 A;  3L1Z B;  5FFY A;  1WES A;  3SOX A;  2YQD A;  2JMI A;  3S92 A;  4BHW A;  5AMF A;  2K4D A;  5DLZ A;  4ZQL A;  4QSW A;  5FE6 A;  5CRM A;  4HBV A;  5JI8 A;  4QSS A;  3FKM X;  2CRW A;  5KO4 A;  5C4Q A;  4AVX A;  4UIX A;  5EIC A;  4NS5 A;  1ZBD B;  4WZ0 A;  5DW2 A;  4KV4 A;  2D9E A;  4A9H A;  4HBX A;  3U5K A;  2YQM A;  5EK9 A;  4O77 A;  3KNV A;  4NR6 A;  4BW2 A;  2IDA A;  4UIY A;  4NUD A;  5D26 A; 
#chains in the Genus database with same CATH homology
 3P1E A;  1CHC A;  4LRG A;  5IID A;  4UIZ A;  4QUT A;  1FP0 A;  1LDJ B;  4FIP A;  2VPG A;  5FH6 A;  2M6M A;  4CLB A;  4QC1 A;  5EVA A;  5A85 A;  3UVD A;  4LZ2 A;  3O7A A;  3ZTG A;  5LVQ A;  5FDZ A;  4HXO A;  5EWD A;  5AD2 A;  5CZG A;  5G4R A;  5A5N A;  5ACY A;  3N9M A;  4LKA A;  4QSP A;  5LVR A;  2KWJ A;  4TS8 A;  5CPE A;  4WIV A;  4XUA A;  5HFR A;  2L43 A;  3DWY A;  5I80 A;  5EWW A;  2ECG A;  5G05 B;  2LGG A;  2JRJ A;  5IG6 A;  5AD3 A;  5LKU A;  4PY6 A;  5E9L A;  5KTX A;  4QST A;  3P1D A;  3I2D A;  4QC3 A;  4N4I A;  2RS9 B;  2VPE A;  3M63 A;  4O70 A;  4L58 A;  4RVR A;  4HXP A;  2KU3 A;  2QJ0 A;  2QIZ A;  4UYG A;  1JM4 B;  3KQI A;  5E73 A;  4YY4 A;  2KWO A;  2KWK A;  5C8G A;  1F68 A;  4N4F A;  3ZYU A;  4NN2 A;  2KR4 A;  2MA5 A;  1X4I A;  3O36 A;  5JWM A;  5D3R A;  4KV1 A;  4A9M A;  1N72 A;  2VJF A;  3UVY A;  5D24 A;  1EQF A;  5BT5 A;  5FE9 A;  3ASL A;  4MEP A;  4NYX A;  5D3H A;  5FBX A;  3P1F A;  5EWC A;  4V3L C;  4W4U A;  2D8S A;  1JM7 A;  4UYD A;  2RNY A;  5D25 A;  2KFT A;  2MIQ A;  3GV4 A;  2VJE A;  2MNZ A;  4MSX A;  2E3K A;  4GNE A;  5HM0 A;  3ZVY A;  5CQ6 A;  4FO9 A;  1K2F A;  2RO1 A;  5ETB A;  3SOW A;  5ETD A;  4BW4 A;  5FE5 A;  2ZET C;  5D3J A;  4HXM A;  4IR5 A;  4YAB A;  1WEU A;  4O76 A;  1V87 A;  3DAI A;  3MXF A;  4UIV A;  4A9L A;  2QIC A;  3RTR B;  2M3H A;  4GNG A;  5A83 A;  5I7X A;  4QEV A;  5FE4 A;  2RNX A;  4QR4 A;  2CT2 A;  5CQ5 A;  4ZUX U;  5F5Z A;  5CUD A;  4O78 A;  2MA6 A;  4TU6 A;  4HXR A;  1LDK C;  1WEQ A;  3MQM A;  4AKN A;  4CUT A;  1DVP A;  4IC2 A;  4CFK A;  4LYS A;  4R2Y A;  2DVS A;  5FE0 A;  2VPB A;  2Y1M A;  4AYC A;  4A4C A;  4TT6 A;  4NRA A;  4Z1S A;  2KTB B;  3C5K A;  3U5O A;  4NUE A;  4O64 A;  3O37 A;  2K17 A;  5C13 A;  5E3D A;  2KYU A;  3FL2 A;  4FJC A;  5ENH A;  1WFK A;  2C2V S;  4UYF B;  5L8T A;  4HXS A;  2RNW A;  5FE3 A;  5DKA A;  4IC3 A;  2L84 A;  4XY9 A;  3RPG B;  5DKC A;  2FUU A;  2H0D B;  4N3W A;  1BOR A;  2NAA A;  2VPD A;  4NR9 A;  3MB4 A;  4AUQ B;  5FE1 A;  2FSA A;  5D3S A;  4LZS A;  2NXB A;  3V43 A;  3LQH A;  4YYJ A;  4NR4 A;  4MR4 A;  5EI4 A;  5FB0 A;  4V3K C;  4IOQ A;  3PUQ A;  4HXK A;  5CQ3 A;  5E9M A;  3ZYQ A;  4F52 B;  5HCL A;  4YK0 A;  2YU4 A;  5ENB A;  2YYN A;  3LXJ A;  3M62 A;  2I8N A;  4E96 A;  1HYI A;  1IYM A;  2K16 A;  2F42 A;  2YDW A;  4YBM A;  4UYE A;  5D1K B;  2KGI A;  4CUU A;  4NR7 A;  2EOD A;  5H9M A;  3IHP A;  4WZ2 A;  4A9N A;  5G04 B;  4Z6H A;  4N4G A;  2LDR A;  2PNX A;  4PKL A;  2FUI A;  5EM3 A;  5ENE A;  5CU8 A;  2WP1 A;  3C6W A;  5B78 A;  5H85 A;  4X2I A;  5J0D A;  2CKL A;  5HJC A;  2VP7 A;  5CRZ A;  5H1U A;  3MB3 A;  4GNF A;  4QSV A;  5DW1 A;  3HME A;  5DX4 A;  4YYG A;  5TCM A;  5F36 A;  4YAT A;  2EA6 A;  3AAD A;  2F6N A;  1X4J A;  5I7Y A;  3JVK A;  5EP7 A;  4YYK A;  3HCS A;  5B76 A;  2LGL A;  3MHH A;  4A0C D;  5FH8 A;  4YYM A;  5EPB A;  5E9K A;  5BT4 A;  4I7D A;  4Z1Q A;  3RCW A;  5C87 A;  4J1P A;  5DYC A;  1Z60 A;  5I1Q A;  4XYA A;  4A4B A;  5CS8 A;  5DYA A;  2DVV A;  3L11 A;  5IBN A;  4MEN A;  5EQ1 A;  2MNY A;  4QF2 A;  4UYF A;  5E9Y A;  2XEU A;  2MT5 A;  5TRB A;  3T7L A;  4Q0O A;  5KH3 A;  4HXN A;  4NUC A;  4ZC9 A;  3U5L A;  2MD7 B;  2MD8 C;  3ZPV 1;  5I3L A;  4LR6 A;  1HYJ A;  1G25 A;  2PUY A;  4QB3 A;  1WEE A;  1WIM A;  5EGU A;  1XWH A;  3LQJ A;  5ENG A;  5FFV A;  4YC9 A;  4R7E A;  5F2P A;  5H1V A;  2DAT A;  5TB6 A;  5CUC A;  3N9N A;  4O7F A;  2YEM A;  3QZT A;  5HEM A;  5II2 A;  4CFL A;  5I86 A;  5LJ1 A;  2WP2 A;  5D1L B;  4O74 A;  2Y1N A;  3N9Q A;  2ECT A;  4TZ8 A;  4UP5 A;  4CUP A;  4TTE A;  2Y43 A;  2YHN A;  4CUS A;  5G4S A;  2YT5 A;  2VNF A;  3O35 A;  2L80 A;  2E6S A;  5EPR A;  2KRE A;  4ZDT A;  3RPG C;  4NQN A;  5ENC A;  4Q0N A;  3PHD A;  4C9Z A;  4NXJ A;  5D0C A;  5CQA A;  5D3N A;  1N87 A;  4TKP B;  3TLP A;  5EIS A;  3NG2 A;  5HFQ A;  5KU3 A;  4QF3 A;  1FBV A;  4QEU A;  4ALH A;  4QSU A;  5B75 A;  1WEO A;  4UYH A;  3G0L A;  2L5E A;  4YY6 A;  2R0S A;  4NRC A;  5DY7 A;  4UIU A;  3SVF A;  5I29 A;  4NQM A;  5EWV A;  2HDP A;  5COI A;  2YUR A;  5A5S A;  2L0B A;  4YYI A;  2LGV A;  5IGL A;  4YH4 A;  5FH7 A;  5A7C A;  5F63 A;  5C7N A;  2F6J A;  4MEO A;  4P5O B;  2E7N A;  4UIT A;  4Z93 A;  2N9G A;  4WA6 A;  5AIU A;  4X3G A;  2OSS A;  5C85 A;  5IGN A;  4GPJ A;  4CUR A;  1MM3 A;  1X4U A;  4ZW1 A;  3GG3 A;  2OO1 A;  1WIL A;  1E4U A;  5KHM A;  3L1X A;  4IOR A;  4TZ2 A;  2R0Y A;  5CUG A;  4XY8 A;  1JOC A;  1WEP A;  2KWN A;  2G45 A;  3VK6 A;  5F25 A;  5HLS A;  1WEV A;  5FEY A;  2ECV A;  2YSM A;  3S91 A;  4CL9 A;  4QSX A;  4YH3 A;  5E9V A;  2YRE A;  5I83 A;  4TQN A;  2YEK A;  4CUQ A;  4BJX A;  5A5P A;  5K29 A;  3DPL R;  5E0R A;  4FK5 A;  3UVW A;  5CQT A;  4TU4 A;  1WEN A;  4S3O B;  4J3I A;  4YAD A;  5DBM A;  4NRB A;  5A5Q A;  5HRV A;  5LUU A;  2LGK A;  4QSR A;  5DFB A;  4TYL A;  5CY9 A;  2I50 A;  2MJV B;  4HXL A;  4B7Y C;  3U5P A;  5A5R A;  3MUL A;  3SVH A;  2LV9 A;  1Z6U A;  4IR6 A;  3MHS A;  5IGK A;  4XI1 A;  1WE9 A;  4IR4 A;  4LJN A;  2E7O A;  3QZS A;  4NR5 A;  4O7B A;  3QZV A;  5CP5 A;  5FG5 A;  3MUK A;  5FE2 A;  5KH7 A;  3LRQ A;  3UV4 A;  5E3G A;  2K1J A;  3JVM A;  3G0J A;  3GL6 A;  5AIT A;  3SVG A;  5I88 A;  5DYU A;  2ECJ A;  4LAD B;  5EV9 A;  4QY4 A;  2LRI C;  3N9P A;  5D3L A;  4NYV A;  1JM7 B;  2YYR A;  2DKW A;  4MVT A;  5L96 A;  4PS5 A;  2VJE B;  4O7A A;  4IR3 A;  3P5O A;  3KV5 A;  5HQ7 A;  5G0F A;  4WHU A;  2KGG A;  4MEQ A;  2RI7 A;  1VFY A;  4A49 A;  4YYD A;  2LXH C;  1WUM A;  3O70 A;  5DFC A;  5CQ8 A;  4YBS A;  4WHW A;  2G43 A;  3HMH A;  5KH9 A;  4A9I A;  3HTK C;  2MUM A;  5L99 A;  3SOU A;  1F62 A;  5LJ2 A;  2ECN A;  4AP4 A;  4MR3 A;  5F61 A;  3HCT A;  2D82 A;  4UIW A;  5EYA F;  2R0V A;  1E6I A;  5HRW A;  5TDW A;  3ZVZ B;  5D3T A;  4QR3 A;  1WUG A;  4HBY A;  3ZNI A;  4O72 A;  2CSZ A;  2GRC A;  5CUB A;  5IGM A;  2JMJ A;  2G4A A;  3N9O A;  5HQ5 A;  4DON A;  5D7X A;  5CQ7 A;  4Q6F A;  3M99 A;  3D7C A;  1WGM A;  2M85 A;  2XB1 A;  2ECI A;  2H0D A;  4A9K A;  5LJ0 A;  4CCG X;  2M1R A;  5FER A;  4AYC B;  3EB6 A;  4LDF A;  2YHO A;  5DIN A;  4OGI A;  3JVL A;  2EGP A;  4YYH A;  3O33 A;  2UZG A;  3ONI A;  5KTU A;  3IU6 A;  5B77 A;  3DQV R;  3AQA A;  1MM2 A;  5A82 A;  4QBM A;  1VD4 A;  2HYE D;  4PCI A;  3IU5 A;  4QZS A;  1ZS5 A;  3EB5 A;  4LYI A;  4A9J A;  3UV2 A;  4PCE A;  5B79 A;  4GB0 A;  4QYL A;  2KIZ A;  4QYD A;  5CQ4 A;  4L7X A;  5JG6 A;  5AME A;  4IOO A;  2E6R A;  1WEW A;  5TBN A;  5BT3 A;  4LYW A;  4S3O C;  5F1H A;  5A81 A;  5ENI A;  5DYX A;  2I7K A;  4TT4 A;  4QUU A;  4PPE A;  4OUF A;  4LC2 A;  4MR6 A;  5DFD A;  4LLB A;  5LKZ A;  4J0S A;  3NXB A;  5HRX A;  1T1H A;  4I7B A;  2BAY A;  4LZR A;  5E74 A;  3KV6 A;  5F3A A;  5A5O A;  3LJW A;  2RFJ A;  5E7D A;  3HMF A;  4O7E A;  4A9E A;  5EPS A;  5FE7 A;  3JVJ A;  3O34 A;  3UW9 A;  4A9F A;  2OXQ C;  2LXP C;  1WEM A;  5I40 A;  4I7C A;  2ECW A;  5FE8 A;  2H60 A;  3UV5 A;  4HBW A;  2LN0 A;  5D3P A;  5FG6 A;  4C66 A;  4YYN A;  2DX8 A;  2DVQ A;  5TDR A;  4KCX A;  2RSD A;  4UP0 A;  4CA1 A;  4WZ3 B;  4NR8 A;  5LKT A;  2CKL B;  3Q2E A;  1Z2Q A;  5L98 A;  4OGJ A;  4O75 A;  5EA1 A;  5ENF A;  4XUB A;  2YSJ A;  4N4H A;  1U6G B;  4O71 A;  3U5M A;  3U5N A;  4F3I A;  5EWH A;  4QR5 A;  2C2L A;  5L97 A;  4A9O A;  5CUA A;  5DKD A;  4BW1 A;  2KE1 A;  5II1 A;  5J3X A;  3PUR A;  4UI9 B;  4PTB A;  4Y03 A;  2LSP B;  3P1C A;  5TAB A;  1JSP B;  5HEN A;  3T6R A;  3I3J A;  5FG4 A;  3LQI A;  4J0R A;  4YAX A;  4C67 A;  5L8U A;  1VYX A;  5E9I A;  5LCW B;  4B86 C;  4TT2 A;  4R8P K;  4GND A;  5DLX A;  1RMD A;  3Q2F A;  5H1T A;  4QNS A;  3K2J A;  5KTW A;  2DVR A;  4QSQ A;  2OUO A;  2YW5 A;  4Z6I A;  3N9L A;  2JMD A;  3HCU A;  5CUE A;  4ALG A;  4O7C A;  1X0J A;  5HEL A;  5D1M B;  4YBT A;  5DKH A;  5HQ6 A;  5F60 A;  5ENJ A;  4BW3 A;  4QEW A;  5LKX A;  2AN6 A;  2YUC A;  5CGP A;  4NYW A;  5C89 A;  4LK9 A;  2L5U A;  5F1L A;  2LQ6 A;  4FLP A;  5I89 A;  3UVX A;  3ZPV E;  4BBQ A;  5F62 A;  5CTL A;  2DWW A;  2YQL A;  3U5J A;  2R10 A;  4MR5 A;  2YW8 A;  2VJF B;  5FFW A;  5B8D A;  5C11 A;  2G6Q A;  2L75 A;  5EU1 A;  2L85 A;  2CSY A;  5CFW A;  3SHB A;  2YEL A;  5FB1 A;  3L1Z B;  5FFY A;  1WES A;  3SOX A;  2YQD A;  2JMI A;  3S92 A;  4BHW A;  5AMF A;  2K4D A;  5DLZ A;  4ZQL A;  4QSW A;  5FE6 A;  5CRM A;  4HBV A;  5JI8 A;  4QSS A;  3FKM X;  5KO4 A;  5C4Q A;  4AVX A;  4UIX A;  5EIC A;  4NS5 A;  1ZBD B;  4WZ0 A;  5DW2 A;  4KV4 A;  2D9E A;  4A9H A;  4HBX A;  3U5K A;  2YQM A;  5EK9 A;  4O77 A;  3KNV A;  4NR6 A;  4BW2 A;  2IDA A;  4UIY A;  4NUD A;  5D26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...