3O33A

Crystal structure of trim24 phd-bromo in the free state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
172
Chain Sequence
b'NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 47
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o33A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o33A01
5HEMA 5LKTA 3MXFA 4IOQA 4YYGA 2YREA 2ZETC 3O34A 4MR3A 5EYAF 4ZUXU 2LGKA 2Y1NA 5TDWA 4ZQLA 4QR5A 2VPGA 5F2PA 3ZVYA 5G05B 2VPDA 5D24A 3EB5A 4TS8A 4R2YA 4IORA 3DAIA 3LQHA 4TT2A 4YY6A 5HCLA 2VP7A 3S91A 2C2VS 3JVLA 5C11A 1N72A 4DONA 4QUTA 1K2FA 2FUIA 4J0SA 4MR6A 4C9ZA 5F63A 3M63A 2KR4A 5F60A 5D3JA 3IU5A 4XUAA 5CS8A 5FE1A 5HFRA 5DKAA 5TDRA 4KV1A 3P5OA 4NRCA 4F52B 4A9KA 3FL2A 2KE1A 4QSUA 4CCGX 2ECJA 4V3LC 4J0RA 3HTKC 4TKPB 3PURA 4IR5A 3ZPVE 2D8SA 1WEUA 3SOXA 4NUDA 2OSSA 4LZRA 4A4BA 5DYUA 4WZ0A 4NR6A 5E74A 3DWYA 2MNZA 5DKHA 2PNXA 4QY4A 5KTUA 4TU4A 4ALHA 2EA6A 3MB3A 4A9FA 2VPBA 2FUUA 4NXJA 4BBQA 2YEKA 5IIDA 4FO9A 5I86A 2HYED 4MSXA 4F3IA 3D7CA 1WEVA 4HXRA 4TT6A 5JWMA 2ECVA 1X4UA 1VFYA 2L80A 4IOOA 3U5NA 2XB1A 4UI9B 1WFKA 4CFLA 1WEPA 4IC3A 3UVYA 4A9JA 4O7FA 5HRXA 4UIYA 4Y03A 2WP1A 4NR5A 4PCIA 5A5OA 5A7CA 5D3TA 1JM4B 3U5OA 5C4QA 2JMJA 2DVRA 4Q6FA 2K1JA 5AMEA 5I29A 1F68A 4A4CA 3MQMA 3HMHA 2K16A 1JSPB 4O71A 2LN0A 5DBMA 5HQ5A 2YEMA 4QSQA 1FBVA 4LYIA 2MA6A 4O7BA 5ENCA 5KH7A 5EICA 5A5RA 5D3RA 5HLSA 4A9IA 4N4FA 5D3SA 5EP7A 5CQ8A 5F1HA 4NS5A 3LQIA 1VYXA 1WEOA 5DYAA 5DYCA 4NYVA 1WENA 3Q2EA 4A9EA 3QZSA 4NYWA 5L8TA 3G0JA 5DKDA 4MENA 3N9QA 5ENJA 4FK5A 5B78A 5E3DA 2RNXA 5I7YA 4CUQA 4MEOA 3KNVA 3L11A 4X2IA 5C7NA 3LXJA 2VPEA 4UITA 3LRQA 1ZS5A 3GV4A 5CQ5A 5KTWA 3MUKA 5EISA 4Q0NA 4QR4A 2PUYA 5KO4A 2YW8A 2RI7A 3O36A 4QEWA 2CKLA 5I40A 2OUOA 5TB6A 3KV5A 3L1ZB 5E9IA 5JI8A 3Q2FA 5AD2A 1WUMA 5FBXA 2YT5A 3KV6A 4Z1SA 4UYDA 2K4DA 4UYEA 4Z1QA 5E0RA 1Z2QA 3N9PA 4QYDA 3JVJA 5L98A 5F36A 4AYCB 2LSPB 3G0LA 4NUEA 5J3XA 4XYAA 2L84A 4NRAA 5LKUA 5LJ1A 5JG6A 1MM3A 3UV5A 3P1EA 4TZ8A 5G4RA 3HCSA 5FFWA 4O7CA 5LJ2A 2AN6A 4WZ2A 5BT3A 3MHHA 3N9LA 3UVWA 4ZC9A 5D3HA 3GG3A 4YAXA 2D9EA 2H0DA 5DY7A 2DVVA 4A9OA 5IGLA 3UVXA 5F1LA 4UYFA 5KHMA 5CUGA 4QB3A 4LDFA 4P5OB 3TLPA 3P1DA 3I3JA 3HMFA 5FE6A 2KIZA 4N4HA 5EI4A 4TQNA 4QEVA 3SVHA 5DYXA 4Q0OA 3U5PA 2CT2A 4KCXA 3VK6A 4FJCA 4UIVA 3N9NA 5I3LA 4PS5A 4QF2A 3ZTGA 1T1HA 4RVRA 4YH4A 3DPLR 1JM7A 2VJEA 4HBYA 4WHWA 5K29A 5F61A 1LDKC 1X4JA 4YYMA 3K2JA 2LV9A 5FE4A 1N87A 2DATA 5EPBA 5ENEA 4LADB 4CUSA 3QZTA 2HDPA 3NXBA 4C66A 2UZGA 5D7XA 5FDZA 3RCWA 2YQDA 5IG6A 2E3KA 1ZBDB 4J1PA 4KV4A 4CLBA 4YC9A 1WIMA 4Z6IA 5AIUA 4NQNA 4WIVA 4A9NA 5EVAA 5DFBA 5EWWA 4Z93A 4QZSA 5FE8A 5D26A 1IYMA 1WUGA 4GB0A 5FG5A 2BAYA 2EODA 2LXPC 2VNFA 4IC2A 4PTBA 5EWHA 5B76A 3T6RA 4LKAA 3O70A 3C6WA 2KWNA 4Z6HA 3N9OA 5EPSA 2KWJA 5ENFA 4YBMA 4NN2A 2G6QA 5I83A 2LQ6A 3SHBA 5CFWA 4N3WA 3M99A 4UP5A 3RPGB 4MEQA 2VJFA 2IDAA 5FFVA 4A9MA 4CUUA 5A82A 2L0BA 1MM2A 4A0CD 3SVGA 2LGVA 2QICA 1CHCA 2CSZA 2YSJA 5EWDA 5IGKA 1Z60A 5I88A 4QSTA 4LR6A 5II1A 2ECNA 5DFDA 2RSDA 1WEMA 2E7NA 2H60A 3UW9A 4HXMA 1RMDA 4XY9A 4X3GA 2YDWA 5HQ6A 4QEUA 5DINA 4LLBA 2KTBB 1FP0A 3S92A 5A5QA 5I89A 5I7XA 4HXOA 2ECIA 5L97A 5LCWB 2MNYA 5CPEA 2G43A 4YYDA 3IHPA 4L58A 2R0YA 4O74A 4PPEA 2OO1A 4MR4A 3ZYUA 4YABA 3AQAA 5H1TA 5CU8A 4WHUA 4AUQB 4I7BA 4TTEA 1BORA 2JMIA 2YYNA 3KQIA 5C8GA 2DVSA 5KH9A 5ETDA 4NYXA 5LJ0A 2DX8A 4HXSA 5FE5A 5D0CA 4OGJA 4TZ2A 4OUFA 2EGPA 2I7KA 1X4IA 5HFQA 4CUPA 2RS9B 2YYRA 5B75A 5EA1A 5CQ7A 5F5ZA 1WGMA 2MD8C 3MULA 4YYIA 5D3PA 3AADA 4QNSA 2LXHC 3HCUA 4LJNA 4I7CA 4GNFA 3O35A 5FG6A 2QIZA 2R0SA 5CQAA 4BJXA 2KWOA 4QYLA 5CUCA 2RNWA 4XY8A 5BT4A 5LVRA 5KU3A 4L7XA 4UIZA 5HRVA 5EPRA 5II2A 4NR4A 4PY6A 2YQMA 3U5MA 2MT5A 4WA6A 3P1CA 5E9YA 5E9MA 5C87A 2F42A 5B77A 4IR4A 5CUBA 4O76A 4O64A 5H85A 4AKNA 2WP2A 2GRCA 5E3GA 4UIWA 2E6RA 5D25A 5L99A 4LZSA 3C5KA 2RNYA 5CUDA 4CA1A 4GNDA 5HELA 4R7EA 5A5NA 2LDRA 4LZ2A 5EU1A 5LKXA 1WEEA 1HYIA 3ONIA 5CGPA 4BW2A 2MUMA 2MJVB 4LC2A 1WESA 2KWKA 1U6GB 4YH3A 4O72A 4HXKA 4HBVA 5CUEA 5E9VA 5H1UA 2D82A 3PHDA 3U5KA 1WEWA 2JRJA 4NR7A 3RPGC 5KTXA 1WE9A 4O7EA 1HYJA 3NG2A 2VJFB 4HBXA 3O7AA 4QSWA 5FH8A 5H1VA 5J0DA 5LUUA 4UIXA 3L1XA 2OXQC 4S3OC 5G04B 3O33A 3P1FA 5D3LA 2L5UA 4XUBA 5EK9A 2F6NA 4GPJA 4QSVA 4QF3A 4AVXA 4YYHA 4YYJA 2M3HA 4GNGA 5C89A 2ECGA 2E7OA 5F3AA 3U5JA 4PCEA 5EQ1A 4QSSA 5I1QA 3T7LA 4O77A 2NAAA 2YQLA 3HCTA 4QUUA 2NXBA 1E4UA 4HXNA 4YADA 5DLZA 4ZW1A 5I80A 3EB6A 4GNEA 5E9LA 4QR3A 4E96A 1XWHA 4ALGA 5IBNA 5DLXA 4AYCA 4YATA 5TCMA 5CTLA 2I50A 5FE0A 2LGGA 2MD7B 2XEUA 3QZVA 5EGUA 3LJWA 5FERA 4O78A 4O70A 3JVKA 5FE7A 5B79A 1F62A 4LK9A 4CURA 4LRGA 2DVQA 5F25A 2RFJA 2KYUA 4UYHA 5CRMA 5KH3A 5ENHA 3FKMX 5E73A 4NRBA 5A83A 2CKLB 2N9GA 2MIQA 4YBSA 5L96A 5EWCA 5FE9A 4J3IA 5D1LB 5FB1A 4YYNA 4OGIA 4YBTA 5CQ4A 5CZGA 5E7DA 3ZNIA 4HXLA 5HJCA 2I8NA 5H9MA 1DVPA 4S3OB 4YYKA 4TT4A 5FFYA 4NQMA 5DX4A 3SOWA 4XI1A 4QSXA 4CFKA 1VD4A 3UVDA 5L8UA 2ECWA 2M6MA 4IR3A 4NR9A 4NR8A 5BT5A 2YELA 5CY9A 2L75A 3M62A 4BW1A 1JOCA 2FSAA 5IGNA 2YSMA 2MA5A 2YURA 5AMFA 5ETBA 2Y43A 5EM3A 4HXPA 5CQTA 5D1MB 2KREA 5CP5A 2H0DB 4UIUA 2DKWA 3U5LA 2KU3A 4I7DA 3I2DA 3ZVZB 4QSRA 4A9LA 4UYFB 2G45A 2JMDA 4A49A 4B86C 1WILA 4V3KC 1G25A 3MB4A 2L5EA 5ENIA 5IGMA 4LYWA 1Z6UA 5DW1A 3ASLA 4O75A 5HENA 1WEQA 2YHNA 4ZDTA 4QSPA 2YUCA 3ZYQA 4PKLA 4QBMA 4QC3A 5FH6A 4A9HA 1LDJB 3PUQA 5TRBA 5HM0A 4YY4A 5FG4A 5DKCA 5A81A 1JM7B 3ZPV1 2R10A 5FE2A 2VJEB 4TYLA 5AD3A 3V43A 5HQ7A 4CUTA 4BW3A 2M85A 2M1RA 5ENGA 4NUCA 4W4UA 3DQVR 2L85A 5FE3A 3MHSA 4B7YC 5G0FA 5CQ6A 4FLPA 5HRWA 2KGIA 5A5SA 2YHOA 4N4GA 2F6JA 2L43A 4TU6A 2LRIC 4BW4A 5CUAA 5FH7A 4CL9A 5A5PA 5LKZA 2Y1MA 5D1KB 2R0VA 5TABA 3RTRB 3JVMA 5COIA 1X0JA 2G4AA 3LQJA 5CRZA 5G4SA 5C85A 5DFCA 5TBNA 5A85A 4UP0A 3HMEA 2YW5A 3GL6A 5DW2A 2LGLA 5D3NA 5B8DA 3UV4A 4HBWA 2RO1A 2C2LA 3IU6A 2QJ0A 5LVQA 3O37A 5AITA 3UV2A 4UYGA 1V87A 1EQFA 3SOUA 4IR6A 2E6SA 4YK0A 5ACYA 4MVTA 2DWWA 4BHWA 2ECTA 1E6IA 4O7AA 5CQ3A 5EWVA 4MEPA 5FEYA 5EV9A 4WZ3B 4MR5A 4N4IA 2KGGA 2K17A 2KFTA 4AP4A 4C67A 3SVFA 5FB0A 4LYSA 4R8PK 5F62A 5C13A 4QC1A 2CSYA 5E9KA 4FIPA 5ENBA 2YU4A 3N9MA
chains in the Genus database with same CATH superfamily
5HEMA 5LKTA 3MXFA 4IOQA 4YYGA 2YREA 2ZETC 3O34A 4MR3A 2D8UA 5EYAF 2LGKA 4ZUXU 2Y1NA 5TDWA 4ZQLA 4QR5A 2VPGA 5F2PA 3ZVYA 5G05B 4OGCA 2VPDA 5D24A 3EB5A 3H7HA 4AKHA 4TS8A 4R2YA 4IORA 3DAIA 4AKIA 3LQHA 4TT2A 4YY6A 5HCLA 3M7KA 2VP7A 3S91A 2C2VS 3JVLA 2KKYA 5C11A 1N72A 4DONA 4QUTA 1K2FA 2FUIA 4J0SA 4MR6A 4C9ZA 5F63A 3M63A 2KR4A 5F60A 5D3JA 3IU5A 4XUAA 5CS8A 5FE1A 5HFRA 5DKAA 5TDRA 4KV1A 3P5OA 4NRCA 4F52B 4A9KA 3FL2A 2KE1A 4QSUA 4CCGX 2ECJA 4V3LC 4J0RA 4O62A 3HTKC 4TKPB 3PURA 4IR5A 3ZPVE 2D8SA 1WEUA 3SOXA 4NUDA 2OSSA 4LZRA 4A4BA 5DYUA 4WZ0A 4NR6A 5E74A 3T9KA 3DWYA 2MNZA 5DKHA 2PNXA 4QY4A 5KTUA 4TU4A 4ALHA 2EA6A 3MB3A 4A9FA 2VPBA 2FUUA 4NXJA 4BBQA 2YEKA 5IIDA 4FO9A 5I86A 2HYED 4MSXA 4F3IA 3D7CA 1WEVA 3VKGA 4HXRA 4TT6A 5JWMA 2ECVA 1X4UA 1VFYA 2L80A 4IOOA 3U5NA 2XB1A 4UI9B 1WFKA 4CFLA 1WEPA 4IC3A 3UVYA 4A9JA 4O7FA 5HRXA 4UIYA 4Y03A 2WP1A 4NR5A 4PCIA 5A5OA 5A7CA 5D3TA 1JM4B 3U5OA 5C4QA 2JMJA 2DVRA 4Q6FA 2K1JA 5AMEA 5I29A 1F68A 4A4CA 3MQMA 2L7PA 3HMHA 2K16A 1JSPB 4O71A 2LN0A 3LDYA 5DBMA 5HQ5A 2YEMA 4QSQA 1FBVA 4LYIA 2MA6A 4O7BA 5ENCA 5KH7A 1ZKRA 5EICA 5A5RA 5D3RA 5HLSA 4A9IA 4N4FA 5D3SA 5EP7A 5CQ8A 5F1HA 4NS5A 3LQIA 1VYXA 1WEOA 5DYAA 5DYCA 4NYVA 1WENA 3Q2EA 4A9EA 3QZSA 4NYWA 5L8TA 3G0JA 5DKDA 4MENA 3N9QA 5ENJA 4FK5A 2XOZA 5B78A 5E3DA 2RNXA 2EXUA 2P57A 5I7YA 4CUQA 4MEOA 3KNVA 3L11A 4X2IA 5C7NA 3LXJA 2VPEA 4UITA 3LRQA 1ZS5A 3GV4A 5CQ5A 5KTWA 3MUKA 3E2DA 5EISA 4Q0NA 4QR4A 2PUYA 5KO4A 2YW8A 2RI7A 3O36A 4QEWA 2CKLA 5I40A 2OUOA 5TB6A 3KV5A 3L1ZB 5E9IA 5JI8A 3Q2FA 5AD2A 1WUMA 5FBXA 2YT5A 3KV6A 4Z1SA 4UYDA 2K4DA 4UYEA 4Z1QA 5E0RA 1Z2QA 2DJAA 3N9PA 4QYDA 3JVJA 2CRWA 5L98A 5F36A 4AYCB 2LSPB 3G0LA 4NUEA 3SUBA 5J3XA 4XYAA 2L84A 4NRAA 5LKUA 5LJ1A 5JG6A 1MM3A 2EJNA 3UV5A 3P1EA 4TZ8A 5G4RA 3HCSA 5FFWA 4O7CA 5LJ2A 2AN6A 4WZ2A 5BT3A 3LVRE 3MHHA 3N9LA 3UVWA 4ZC9A 5D3HA 3GG3A 4YAXA 5SVYA 2D9EA 2H0DA 5DY7A 2DVVA 4A9OA 5IGLA 3UVXA 5F1LA 4UYFA 5KHMA 5CUGA 4QB3A 4LDFA 3D1BA 4P5OB 3TLPA 3P1DA 3I3JA 3HMFA 5FE6A 2KIZA 4N4HA 5EI4A 4TQNA 4QEVA 3SVHA 5DYXA 4Q0OA 3U5PA 2CT2A 4KCXA 3VK6A 4FJCA 4UIVA 3N9NA 5I3LA 4PS5A 4QF2A 3ZTGA 1T1HA 4RVRA 4YH4A 3DPLR 1JM7A 2OWAA 4HBYA 4WHWA 5K29A 2VJEA 5F61A 1LDKC 3FM8C 1X4JA 4YYMA 3K2JA 2LV9A 5FE4A 1N87A 2DATA 5EPBA 5ENEA 4LADB 4CUSA 3QZTA 2HDPA 3NXBA 4C66A 2UZGA 5D7XA 5FDZA 3RCWA 2YQDA 5IG6A 2MKEA 2E3KA 1ZBDB 4J1PA 4KV4A 4CLBA 4YC9A 1WIMA 4Z6IA 3LVQE 5AIUA 4NQNA 4WIVA 4A9NA 5EVAA 5DFBA 5EWWA 4Z93A 4QZSA 5FE8A 5D26A 1IYMA 1WUGA 4GB0A 5FG5A 2BAYA 2EODA 2LXPC 2VNFA 4IC2A 4PTBA 5EWHA 5B76A 3T6RA 4LKAA 3O70A 3C6WA 2KWNA 4Z6HA 3N9OA 5EPSA 2KWJA 5ENFA 4YBMA 4NN2A 2G6QA 5I83A 2LQ6A 3SHBA 5CFWA 4N3WA 3M99A 4UP5A 3RPGB 4MEQA 2VJFA 3VKHA 2CSVA 2IDAA 5FFVA 4A9MA 4CUUA 5A82A 2L0BA 1MM2A 4A0CD 3SVGA 2LGVA 2QICA 1CHCA 2CSZA 2YSJA 2XP0A 5EWDA 5IGKA 1Z60A 5I88A 4QSTA 4LR6A 5II1A 2ECNA 5DFDA 2RSDA 1WEMA 2E7NA 2H60A 3UW9A 4HXMA 1RMDA 4XY9A 4X3GA 2YDWA 5HQ6A 4QEUA 5DINA 4LLBA 2KTBB 4F1PA 1FP0A 3S92A 5A5QA 5I89A 5I7XA 4HXOA 2ECIA 5L97A 5LCWB 2MNYA 5CPEA 2G43A 4YYDA 3IHPA 4L58A 2R0YA 4O74A 3LJUX 4PPEA 2OO1A 5SVIA 4MR4A 3ZYUA 4YABA 3AQAA 5H1TA 3JUEA 5CU8A 4WHUA 2B0OE 4AUQB 4I7BA 4TTEA 1BORA 2JMIA 2YYNA 3KQIA 5C8GA 2DVSA 4AKGA 5KH9A 5ETDA 4NYXA 5LJ0A 2DX8A 4HXSA 5FE5A 3O47A 5D0CA 4OGJA 4TZ2A 4OUFA 2EGPA 2I7KA 1X4IA 5HFQA 4CUPA 2RS9B 2YYRA 5B75A 5EA1A 5CQ7A 5F5ZA 1WGMA 2MD8C 3MULA 4YYIA 5D3PA 3AADA 4QNSA 2LXHC 3HCUA 4LJNA 4I7CA 3PLWA 4GNFA 3O35A 5FG6A 2QIZA 2R0SA 5CQAA 4BJXA 2KWOA 4QYLA 5CUCA 2RNWA 4XY8A 5BT4A 5LVRA 5KU3A 4AI6A 4L7XA 4UIZA 5HRVA 5EPRA 5II2A 4NR4A 4PY6A 2YQMA 2XOYA 3U5MA 2MT5A 4WA6A 3P1CA 5E9YA 5E9MA 5C87A 2F42A 5B77A 4IR4A 5CUBA 4H9DA 4O76A 4O64A 5H85A 4AKNA 2WP2A 2JUNA 2GRCA 5E3GA 4UIWA 2E6RA 5D25A 5L99A 4LZSA 3C5KA 2RNYA 5CUDA 4OGEA 4CA1A 4GNDA 5HELA 4R7EA 4Z0OA 5A5NA 2LDRA 4LZ2A 5EU1A 5LKXA 1WEEA 5K3QA 1HYIA 3ONIA 5CGPA 4BW2A 2MUMA 2MJVB 4LC2A 1WESA 2KWKA 1U6GB 4YH3A 4O72A 4HXKA 4HBVA 5CUEA 5E9VA 5H1UA 2D82A 3PHDA 3U5KA 1WEWA 2JRJA 4NR7A 3RPGC 5KTXA 1WE9A 4O7EA 3DDTA 3NG2A 2VJFB 2YVRA 1HYJA 4HBXA 3O7AA 4QSWA 5FH8A 5H1VA 5J0DA 5LUUA 4UIXA 2XOCA 3L1XA 2OXQC 4S3OC 5G04B 3O33A 3P1FA 5D3LA 1PUOA 4XUBA 2L5UA 3FJUB 5EK9A 2F6NA 4GPJA 4QSVA 2CRRA 4QF3A 4AVXA 4YYHA 4YYJA 2M3HA 4GNGA 5C89A 2ECGA 2E7OA 5F3AA 3U5JA 4PCEA 5EQ1A 4QSSA 5I1QA 3T7LA 4O77A 2NAAA 2CONA 2YQLA 3HCTA 4QUUA 3KDEC 2NXBA 1E4UA 4HXNA 4YADA 5DLZA 4ZW1A 5I80A 3EB6A 4GNEA 3D1DA 5E9LA 4QR3A 4E96A 1XWHA 4ALGA 5IBNA 5DLXA 5SVIB 4AYCA 4YATA 5TCMA 5CTLA 2I50A 5FE0A 2LGGA 2MD7B 2XEUA 3QZVA 5EGUA 3LJWA 5FERA 4O78A 4O70A 3JVKA 5FE7A 5B79A 1F62A 4LK9A 4CURA 4LRGA 2DVQA 5F25A 2RFJA 2KYUA 4UYHA 5CRMA 3FANA 5KH3A 5ENHA 3FKMX 4W4UA 5E73A 4NRBA 5A83A 2CKLB 2N9GA 1DCQA 2MIQA 4YBSA 5L96A 5EWCA 5FE9A 4J3IA 5D1LB 5FB1A 4YYNA 4OGIA 4YBTA 5CQ4A 5CZGA 5E7DA 3ZNIA 4HXLA 5HJCA 2I8NA 5H9MA 1DVPA 4S3OB 4YYKA 4TT4A 5FFYA 4NQMA 5DX4A 3SOWA 4XI1A 4QSXA 4CFKA 1VD4A 3UVDA 5L8UA 2ECWA 2M6MA 3ERRA 4IR3A 4NR9A 4NR8A 5BT5A 2YELA 5CY9A 2L75A 3M62A 4BW1A 1JOCA 1MBMA 2FSAA 5IGNA 2DSMA 2KKXA 2YSMA 2MA5A 2YURA 5SVXA 5AMFA 5ETBA 2Y43A 5EM3A 4HXPA 5CQTA 5D1MB 2KREA 5CP5A 2H0DB 4UIUA 2DKWA 3U5LA 2IQJA 2KU3A 3I2DA 4I7DA 4QSRA 4A9LA 4UYFB 2G45A 2JMDA 4Z0RA 3ZVZB 1WILA 4V3KC 4A49A 4B86C 3MB4A 1G25A 2L5EA 5ENIA 5IGMA 4LYWA 1Z6UA 3DWDA 5DW1A 3ASLA 4O75A 5HENA 1WEQA 2YHNA 4ZDTA 4QSPA 2YUCA 3ZYQA 4PKLA 4QBMA 4QC3A 5FH6A 4A9HA 1LDJB 3PUQA 5TRBA 5HM0A 4YY4A 3FAOA 5FG4A 5DKCA 5A81A 1JM7B 3ZPV1 2FD4A 2R10A 5FE2A 2VJEB 4TYLA 5AD3A 3V43A 5HQ7A 4CUTA 4BW3A 2M13A 2M1RA 5ENGA 4NUCA 2E61A 2M85A 2L85A 5FE3A 3DQVR 3MHSA 4B7YC 5G0FA 5CQ6A 4FLPA 5HRWA 2KGIA 5A5SA 2YHOA 2RR4A 4N4GA 2F6JA 2L43A 4TU6A 2LRIC 4BW4A 5CUAA 5FH7A 4CL9A 5A5PA 5LKZA 2FFWA 2Y1MA 5D1KB 2R0VA 5TABA 3RTRB 3JVMA 5COIA 1X0JA 2G4AA 3LQJA 5CRZA 5G4SA 5C85A 5DFCA 5TBNA 5A85A 4UP0A 3HMEA 2YW5A 3GL6A 5DW2A 2LGLA 5D3NA 5B8DA 3UV4A 3FEHA 4HBWA 2LAUA 2RO1A 2C2LA 3IU6A 2QJ0A 5LVQA 3O37A 5AITA 3UV2A 4UYGA 1V87A 3Q1DA 1EQFA 3SOUA 4IR6A 2E6SA 4YK0A 5ACYA 4MVTA 2DWWA 4BHWA 2ECTA 2EGMA 1E6IA 4O7AA 5CQ3A 5EWVA 4QQ4A 4MEPA 2JM3A 5FEYA 5EV9A 4WZ3B 4MR5A 4N4IA 3MDBC 2KGGA 2K17A 2KFTA 4AP4A 4C67A 3SVFA 5FB0A 4LYSA 4R8PK 5F62A 5C13A 4QC1A 2CSYA 5E9KA 4FIPA 5ENBA 2YU4A 3N9MA
chains in the Genus database with same CATH topology
5HEMA 5LKTA 3MXFA 4IOQA 4YYGA 2YREA 2ZETC 3O34A 4MR3A 5EYAF 4ZUXU 2LGKA 2Y1NA 5TDWA 4ZQLA 4QR5A 2VPGA 5F2PA 3ZVYA 5G05B 2VPDA 5D24A 3EB5A 4TS8A 4R2YA 4IORA 3DAIA 3LQHA 4TT2A 4YY6A 5HCLA 2VP7A 3S91A 2C2VS 3JVLA 5C11A 1N72A 4DONA 4QUTA 1K2FA 2FUIA 4J0SA 4MR6A 4C9ZA 5F63A 3M63A 2KR4A 5F60A 5D3JA 3IU5A 4XUAA 5CS8A 5FE1A 5HFRA 5DKAA 5TDRA 4KV1A 3P5OA 4NRCA 4F52B 4A9KA 3FL2A 2KE1A 4QSUA 4CCGX 2ECJA 4V3LC 4J0RA 3HTKC 4TKPB 3PURA 4IR5A 3ZPVE 2D8SA 1WEUA 3SOXA 4NUDA 2OSSA 4LZRA 4A4BA 5DYUA 4WZ0A 4NR6A 5E74A 3DWYA 2MNZA 5DKHA 2PNXA 4QY4A 5KTUA 4TU4A 4ALHA 2EA6A 3MB3A 4A9FA 2VPBA 2FUUA 4NXJA 4BBQA 2YEKA 5IIDA 4FO9A 5I86A 2HYED 4MSXA 4F3IA 3D7CA 1WEVA 4HXRA 4TT6A 5JWMA 2ECVA 1X4UA 1VFYA 2L80A 4IOOA 3U5NA 2XB1A 4UI9B 1WFKA 4CFLA 1WEPA 4IC3A 3UVYA 4A9JA 4O7FA 5HRXA 4UIYA 4Y03A 2WP1A 4NR5A 4PCIA 5A5OA 5A7CA 5D3TA 1JM4B 3U5OA 5C4QA 2JMJA 2DVRA 4Q6FA 2K1JA 5AMEA 5I29A 1F68A 4A4CA 3MQMA 3HMHA 2K16A 1JSPB 4O71A 2LN0A 5DBMA 5HQ5A 2YEMA 4QSQA 1FBVA 4LYIA 2MA6A 4O7BA 5ENCA 5KH7A 5EICA 5A5RA 5D3RA 5HLSA 4A9IA 4N4FA 5D3SA 5EP7A 5CQ8A 5F1HA 4NS5A 3LQIA 1VYXA 1WEOA 5DYAA 5DYCA 4NYVA 1WENA 3Q2EA 4A9EA 3QZSA 4NYWA 5L8TA 3G0JA 5DKDA 4MENA 3N9QA 5ENJA 4FK5A 5B78A 5E3DA 2RNXA 5I7YA 4CUQA 4MEOA 3KNVA 3L11A 4X2IA 5C7NA 3LXJA 2VPEA 4UITA 3LRQA 1ZS5A 3GV4A 5CQ5A 5KTWA 3MUKA 5EISA 4Q0NA 4QR4A 2PUYA 5KO4A 2YW8A 2RI7A 3O36A 4QEWA 2CKLA 5I40A 2OUOA 5TB6A 3KV5A 3L1ZB 5E9IA 5JI8A 3Q2FA 5AD2A 1WUMA 5FBXA 2YT5A 3KV6A 4Z1SA 4UYDA 2K4DA 4UYEA 4Z1QA 5E0RA 1Z2QA 3N9PA 4QYDA 3JVJA 5L98A 5F36A 4AYCB 2LSPB 3G0LA 4NUEA 5J3XA 4XYAA 2L84A 4NRAA 5LKUA 5LJ1A 5JG6A 1MM3A 3UV5A 3P1EA 4TZ8A 5G4RA 3HCSA 5FFWA 4O7CA 5LJ2A 2AN6A 4WZ2A 5BT3A 3MHHA 3N9LA 3UVWA 4ZC9A 5D3HA 3GG3A 4YAXA 2D9EA 2H0DA 5DY7A 2DVVA 4A9OA 5IGLA 3UVXA 5F1LA 4UYFA 5KHMA 5CUGA 4QB3A 4LDFA 4P5OB 3TLPA 3P1DA 3I3JA 3HMFA 5FE6A 2KIZA 4N4HA 5EI4A 4TQNA 4QEVA 3SVHA 5DYXA 4Q0OA 3U5PA 2CT2A 4KCXA 3VK6A 4FJCA 4UIVA 3N9NA 5I3LA 4PS5A 4QF2A 3ZTGA 1T1HA 4RVRA 4YH4A 3DPLR 1JM7A 2VJEA 4HBYA 4WHWA 5K29A 5F61A 1LDKC 1X4JA 4YYMA 3K2JA 2LV9A 5FE4A 1N87A 2DATA 5EPBA 5ENEA 4LADB 4CUSA 3QZTA 2HDPA 3NXBA 4C66A 2UZGA 5D7XA 5FDZA 3RCWA 2YQDA 5IG6A 2E3KA 1ZBDB 4J1PA 4KV4A 4CLBA 4YC9A 1WIMA 4Z6IA 5AIUA 4NQNA 4WIVA 4A9NA 5EVAA 5DFBA 5EWWA 4Z93A 4QZSA 5FE8A 5D26A 1IYMA 1WUGA 4GB0A 5FG5A 2BAYA 2EODA 2LXPC 2VNFA 4IC2A 4PTBA 5EWHA 5B76A 3T6RA 4LKAA 3O70A 3C6WA 2KWNA 4Z6HA 3N9OA 5EPSA 2KWJA 5ENFA 4YBMA 4NN2A 2G6QA 5I83A 2LQ6A 3SHBA 5CFWA 4N3WA 3M99A 4UP5A 3RPGB 4MEQA 2VJFA 2IDAA 5FFVA 4A9MA 4CUUA 5A82A 2L0BA 1MM2A 4A0CD 3SVGA 2LGVA 2QICA 1CHCA 2CSZA 2YSJA 5EWDA 5IGKA 1Z60A 5I88A 4QSTA 4LR6A 5II1A 2ECNA 5DFDA 2RSDA 1WEMA 2E7NA 2H60A 3UW9A 4HXMA 1RMDA 4XY9A 4X3GA 2YDWA 5HQ6A 4QEUA 5DINA 4LLBA 2KTBB 1FP0A 3S92A 5A5QA 5I89A 5I7XA 4HXOA 2ECIA 5L97A 5LCWB 2MNYA 5CPEA 2G43A 4YYDA 3IHPA 4L58A 2R0YA 4O74A 4PPEA 2OO1A 4MR4A 3ZYUA 4YABA 3AQAA 5H1TA 5CU8A 4WHUA 4AUQB 4I7BA 4TTEA 1BORA 2JMIA 2YYNA 3KQIA 5C8GA 2DVSA 5KH9A 5ETDA 4NYXA 5LJ0A 2DX8A 4HXSA 5FE5A 5D0CA 4OGJA 4TZ2A 4OUFA 2EGPA 2I7KA 1X4IA 5HFQA 4CUPA 2RS9B 2YYRA 5B75A 5EA1A 5CQ7A 5F5ZA 1WGMA 2MD8C 3MULA 4YYIA 5D3PA 3AADA 4QNSA 2LXHC 3HCUA 4LJNA 4I7CA 4GNFA 3O35A 5FG6A 2QIZA 2R0SA 5CQAA 4BJXA 2KWOA 4QYLA 5CUCA 2RNWA 4XY8A 5BT4A 5LVRA 5KU3A 4L7XA 4UIZA 5HRVA 5EPRA 5II2A 4NR4A 4PY6A 2YQMA 3U5MA 2MT5A 4WA6A 3P1CA 5E9YA 5E9MA 5C87A 2F42A 5B77A 4IR4A 5CUBA 4O76A 4O64A 5H85A 4AKNA 2WP2A 2GRCA 5E3GA 4UIWA 2E6RA 5D25A 5L99A 4LZSA 3C5KA 2RNYA 5CUDA 4CA1A 4GNDA 5HELA 4R7EA 5A5NA 2LDRA 4LZ2A 5EU1A 5LKXA 1WEEA 1HYIA 3ONIA 5CGPA 4BW2A 2MUMA 2MJVB 4LC2A 1WESA 2KWKA 1U6GB 4YH3A 4O72A 4HXKA 4HBVA 5CUEA 5E9VA 5H1UA 2D82A 3PHDA 3U5KA 1WEWA 2JRJA 4NR7A 3RPGC 5KTXA 1WE9A 4O7EA 1HYJA 3NG2A 2VJFB 4HBXA 3O7AA 4QSWA 5FH8A 5H1VA 5J0DA 5LUUA 4UIXA 3L1XA 2OXQC 4S3OC 5G04B 3O33A 3P1FA 5D3LA 2L5UA 4XUBA 5EK9A 2F6NA 4GPJA 4QSVA 4QF3A 4AVXA 4YYHA 4YYJA 2M3HA 4GNGA 5C89A 2ECGA 2E7OA 5F3AA 3U5JA 4PCEA 5EQ1A 4QSSA 5I1QA 3T7LA 4O77A 2NAAA 2YQLA 3HCTA 4QUUA 2NXBA 1E4UA 4HXNA 4YADA 5DLZA 4ZW1A 5I80A 3EB6A 4GNEA 5E9LA 4QR3A 4E96A 1XWHA 4ALGA 5IBNA 5DLXA 4AYCA 4YATA 5TCMA 5CTLA 2I50A 5FE0A 2LGGA 2MD7B 2XEUA 3QZVA 5EGUA 3LJWA 5FERA 4O78A 4O70A 3JVKA 5FE7A 5B79A 1F62A 4LK9A 4CURA 4LRGA 2DVQA 5F25A 2RFJA 2KYUA 4UYHA 5CRMA 5KH3A 5ENHA 3FKMX 5E73A 4NRBA 5A83A 2CKLB 2N9GA 2MIQA 4YBSA 5L96A 5EWCA 5FE9A 4J3IA 5D1LB 5FB1A 4YYNA 4OGIA 4YBTA 5CQ4A 5CZGA 5E7DA 3ZNIA 4HXLA 5HJCA 2I8NA 5H9MA 1DVPA 4S3OB 4YYKA 4TT4A 5FFYA 4NQMA 5DX4A 3SOWA 4XI1A 4QSXA 4CFKA 1VD4A 3UVDA 5L8UA 2ECWA 2M6MA 4IR3A 4NR9A 4NR8A 5BT5A 2YELA 5CY9A 2L75A 3M62A 4BW1A 1JOCA 2FSAA 5IGNA 2YSMA 2MA5A 2YURA 5AMFA 5ETBA 2Y43A 5EM3A 4HXPA 5CQTA 5D1MB 2KREA 5CP5A 2H0DB 4UIUA 2DKWA 3U5LA 2KU3A 4I7DA 3I2DA 3ZVZB 4QSRA 4A9LA 4UYFB 2G45A 2JMDA 4A49A 4B86C 1WILA 4V3KC 1G25A 3MB4A 2L5EA 5ENIA 5IGMA 4LYWA 1Z6UA 5DW1A 3ASLA 4O75A 5HENA 1WEQA 2YHNA 4ZDTA 4QSPA 2YUCA 3ZYQA 4PKLA 4QBMA 4QC3A 5FH6A 4A9HA 1LDJB 3PUQA 5TRBA 5HM0A 4YY4A 5FG4A 5DKCA 5A81A 1JM7B 3ZPV1 2R10A 5FE2A 2VJEB 4TYLA 5AD3A 3V43A 5HQ7A 4CUTA 4BW3A 2M85A 2M1RA 5ENGA 4NUCA 4W4UA 3DQVR 2L85A 5FE3A 3MHSA 4B7YC 5G0FA 5CQ6A 4FLPA 5HRWA 2KGIA 5A5SA 2YHOA 4N4GA 2F6JA 2L43A 4TU6A 2LRIC 4BW4A 5CUAA 5FH7A 4CL9A 5A5PA 5LKZA 2Y1MA 5D1KB 2R0VA 5TABA 3RTRB 3JVMA 5COIA 1X0JA 2G4AA 3LQJA 5CRZA 5G4SA 5C85A 5DFCA 5TBNA 5A85A 4UP0A 3HMEA 2YW5A 3GL6A 5DW2A 2LGLA 5D3NA 5B8DA 3UV4A 4HBWA 2RO1A 2C2LA 3IU6A 2QJ0A 5LVQA 3O37A 5AITA 3UV2A 4UYGA 1V87A 1EQFA 3SOUA 4IR6A 2E6SA 4YK0A 5ACYA 4MVTA 2DWWA 4BHWA 2ECTA 1E6IA 4O7AA 5CQ3A 5EWVA 4MEPA 5FEYA 5EV9A 4WZ3B 4MR5A 4N4IA 2KGGA 2K17A 2KFTA 4AP4A 4C67A 3SVFA 5FB0A 4LYSA 4R8PK 5F62A 5C13A 4QC1A 2CSYA 5E9KA 4FIPA 5ENBA 2YU4A 3N9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEM A;  5LKT A;  3MXF A;  4IOQ A;  4YYG A;  2YRE A;  2ZET C;  3O34 A;  4MR3 A;  5EYA F;  4ZUX U;  2LGK A;  2Y1N A;  5TDW A;  4ZQL A;  4QR5 A;  2VPG A;  5F2P A;  3ZVY A;  5G05 B;  2VPD A;  5D24 A;  3EB5 A;  4TS8 A;  4R2Y A;  4IOR A;  3DAI A;  3LQH A;  4TT2 A;  4YY6 A;  5HCL A;  2VP7 A;  3S91 A;  2C2V S;  3JVL A;  5C11 A;  1N72 A;  4DON A;  4QUT A;  1K2F A;  2FUI A;  4J0S A;  4MR6 A;  4C9Z A;  5F63 A;  3M63 A;  2KR4 A;  5F60 A;  5D3J A;  3IU5 A;  4XUA A;  5CS8 A;  5FE1 A;  5HFR A;  5DKA A;  5TDR A;  4KV1 A;  3P5O A;  4NRC A;  4F52 B;  4A9K A;  3FL2 A;  2KE1 A;  4QSU A;  4CCG X;  2ECJ A;  4V3L C;  4J0R A;  3HTK C;  4TKP B;  3PUR A;  4IR5 A;  3ZPV E;  2D8S A;  1WEU A;  3SOX A;  4NUD A;  2OSS A;  4LZR A;  4A4B A;  5DYU A;  4WZ0 A;  4NR6 A;  5E74 A;  3DWY A;  2MNZ A;  5DKH A;  2PNX A;  4QY4 A;  5KTU A;  4TU4 A;  4ALH A;  2EA6 A;  3MB3 A;  4A9F A;  2VPB A;  2FUU A;  4NXJ A;  4BBQ A;  2YEK A;  5IID A;  4FO9 A;  5I86 A;  2HYE D;  4MSX A;  4F3I A;  3D7C A;  1WEV A;  4HXR A;  4TT6 A;  5JWM A;  2ECV A;  1X4U A;  1VFY A;  2L80 A;  4IOO A;  3U5N A;  2XB1 A;  4UI9 B;  1WFK A;  4CFL A;  1WEP A;  4IC3 A;  3UVY A;  4A9J A;  4O7F A;  5HRX A;  4UIY A;  4Y03 A;  2WP1 A;  4NR5 A;  4PCI A;  5A5O A;  5A7C A;  5D3T A;  1JM4 B;  3U5O A;  5C4Q A;  2JMJ A;  2DVR A;  4Q6F A;  2K1J A;  5AME A;  5I29 A;  1F68 A;  4A4C A;  3MQM A;  3HMH A;  2K16 A;  1JSP B;  4O71 A;  2LN0 A;  5DBM A;  5HQ5 A;  2YEM A;  4QSQ A;  1FBV A;  4LYI A;  2MA6 A;  4O7B A;  5ENC A;  5KH7 A;  5EIC A;  5A5R A;  5D3R A;  5HLS A;  4A9I A;  4N4F A;  5D3S A;  5EP7 A;  5CQ8 A;  5F1H A;  4NS5 A;  3LQI A;  1VYX A;  1WEO A;  5DYA A;  5DYC A;  4NYV A;  1WEN A;  3Q2E A;  4A9E A;  3QZS A;  4NYW A;  5L8T A;  3G0J A;  5DKD A;  4MEN A;  3N9Q A;  5ENJ A;  4FK5 A;  5B78 A;  5E3D A;  2RNX A;  5I7Y A;  4CUQ A;  4MEO A;  3KNV A;  3L11 A;  4X2I A;  5C7N A;  3LXJ A;  2VPE A;  4UIT A;  3LRQ A;  1ZS5 A;  3GV4 A;  5CQ5 A;  5KTW A;  3MUK A;  5EIS A;  4Q0N A;  4QR4 A;  2PUY A;  5KO4 A;  2YW8 A;  2RI7 A;  3O36 A;  4QEW A;  2CKL A;  5I40 A;  2OUO A;  5TB6 A;  3KV5 A;  3L1Z B;  5E9I A;  5JI8 A;  3Q2F A;  5AD2 A;  1WUM A;  5FBX A;  2YT5 A;  3KV6 A;  4Z1S A;  4UYD A;  2K4D A;  4UYE A;  4Z1Q A;  5E0R A;  1Z2Q A;  3N9P A;  4QYD A;  3JVJ A;  5L98 A;  5F36 A;  4AYC B;  2LSP B;  3G0L A;  4NUE A;  5J3X A;  4XYA A;  2L84 A;  4NRA A;  5LKU A;  5LJ1 A;  5JG6 A;  1MM3 A;  3UV5 A;  3P1E A;  4TZ8 A;  5G4R A;  3HCS A;  5FFW A;  4O7C A;  5LJ2 A;  2AN6 A;  4WZ2 A;  5BT3 A;  3MHH A;  3N9L A;  3UVW A;  4ZC9 A;  5D3H A;  3GG3 A;  4YAX A;  2D9E A;  2H0D A;  5DY7 A;  2DVV A;  4A9O A;  5IGL A;  3UVX A;  5F1L A;  4UYF A;  5KHM A;  5CUG A;  4QB3 A;  4LDF A;  4P5O B;  3TLP A;  3P1D A;  3I3J A;  3HMF A;  5FE6 A;  2KIZ A;  4N4H A;  5EI4 A;  4TQN A;  4QEV A;  3SVH A;  5DYX A;  4Q0O A;  3U5P A;  2CT2 A;  4KCX A;  3VK6 A;  4FJC A;  4UIV A;  3N9N A;  5I3L A;  4PS5 A;  4QF2 A;  3ZTG A;  1T1H A;  4RVR A;  4YH4 A;  3DPL R;  1JM7 A;  2VJE A;  4HBY A;  4WHW A;  5K29 A;  5F61 A;  1LDK C;  1X4J A;  4YYM A;  3K2J A;  2LV9 A;  5FE4 A;  1N87 A;  2DAT A;  5EPB A;  5ENE A;  4LAD B;  4CUS A;  3QZT A;  2HDP A;  3NXB A;  4C66 A;  2UZG A;  5D7X A;  5FDZ A;  3RCW A;  2YQD A;  5IG6 A;  2E3K A;  1ZBD B;  4J1P A;  4KV4 A;  4CLB A;  4YC9 A;  1WIM A;  4Z6I A;  5AIU A;  4NQN A;  4WIV A;  4A9N A;  5EVA A;  5DFB A;  5EWW A;  4Z93 A;  4QZS A;  5FE8 A;  5D26 A;  1IYM A;  1WUG A;  4GB0 A;  5FG5 A;  2BAY A;  2EOD A;  2LXP C;  2VNF A;  4IC2 A;  4PTB A;  5EWH A;  5B76 A;  3T6R A;  4LKA A;  3O70 A;  3C6W A;  2KWN A;  4Z6H A;  3N9O A;  5EPS A;  2KWJ A;  5ENF A;  4YBM A;  4NN2 A;  2G6Q A;  5I83 A;  2LQ6 A;  3SHB A;  5CFW A;  4N3W A;  3M99 A;  4UP5 A;  3RPG B;  4MEQ A;  2VJF A;  2IDA A;  5FFV A;  4A9M A;  4CUU A;  5A82 A;  2L0B A;  1MM2 A;  4A0C D;  3SVG A;  2LGV A;  2QIC A;  1CHC A;  2CSZ A;  2YSJ A;  5EWD A;  5IGK A;  1Z60 A;  5I88 A;  4QST A;  4LR6 A;  5II1 A;  2ECN A;  5DFD A;  2RSD A;  1WEM A;  2E7N A;  2H60 A;  3UW9 A;  4HXM A;  1RMD A;  4XY9 A;  4X3G A;  2YDW A;  5HQ6 A;  4QEU A;  5DIN A;  4LLB A;  2KTB B;  1FP0 A;  3S92 A;  5A5Q A;  5I89 A;  5I7X A;  4HXO A;  2ECI A;  5L97 A;  5LCW B;  2MNY A;  5CPE A;  2G43 A;  4YYD A;  3IHP A;  4L58 A;  2R0Y A;  4O74 A;  4PPE A;  2OO1 A;  4MR4 A;  3ZYU A;  4YAB A;  3AQA A;  5H1T A;  5CU8 A;  4WHU A;  4AUQ B;  4I7B A;  4TTE A;  1BOR A;  2JMI A;  2YYN A;  3KQI A;  5C8G A;  2DVS A;  5KH9 A;  5ETD A;  4NYX A;  5LJ0 A;  2DX8 A;  4HXS A;  5FE5 A;  5D0C A;  4OGJ A;  4TZ2 A;  4OUF A;  2EGP A;  2I7K A;  1X4I A;  5HFQ A;  4CUP A;  2RS9 B;  2YYR A;  5B75 A;  5EA1 A;  5CQ7 A;  5F5Z A;  1WGM A;  2MD8 C;  3MUL A;  4YYI A;  5D3P A;  3AAD A;  4QNS A;  2LXH C;  3HCU A;  4LJN A;  4I7C A;  4GNF A;  3O35 A;  5FG6 A;  2QIZ A;  2R0S A;  5CQA A;  4BJX A;  2KWO A;  4QYL A;  5CUC A;  2RNW A;  4XY8 A;  5BT4 A;  5LVR A;  5KU3 A;  4L7X A;  4UIZ A;  5HRV A;  5EPR A;  5II2 A;  4NR4 A;  4PY6 A;  2YQM A;  3U5M A;  2MT5 A;  4WA6 A;  3P1C A;  5E9Y A;  5E9M A;  5C87 A;  2F42 A;  5B77 A;  4IR4 A;  5CUB A;  4O76 A;  4O64 A;  5H85 A;  4AKN A;  2WP2 A;  2GRC A;  5E3G A;  4UIW A;  2E6R A;  5D25 A;  5L99 A;  4LZS A;  3C5K A;  2RNY A;  5CUD A;  4CA1 A;  4GND A;  5HEL A;  4R7E A;  5A5N A;  2LDR A;  4LZ2 A;  5EU1 A;  5LKX A;  1WEE A;  1HYI A;  3ONI A;  5CGP A;  4BW2 A;  2MUM A;  2MJV B;  4LC2 A;  1WES A;  2KWK A;  1U6G B;  4YH3 A;  4O72 A;  4HXK A;  4HBV A;  5CUE A;  5E9V A;  5H1U A;  2D82 A;  3PHD A;  3U5K A;  1WEW A;  2JRJ A;  4NR7 A;  3RPG C;  5KTX A;  1WE9 A;  4O7E A;  1HYJ A;  3NG2 A;  2VJF B;  4HBX A;  3O7A A;  4QSW A;  5FH8 A;  5H1V A;  5J0D A;  5LUU A;  4UIX A;  3L1X A;  2OXQ C;  4S3O C;  5G04 B;  3O33 A;  3P1F A;  5D3L A;  2L5U A;  4XUB A;  5EK9 A;  2F6N A;  4GPJ A;  4QSV A;  4QF3 A;  4AVX A;  4YYH A;  4YYJ A;  2M3H A;  4GNG A;  5C89 A;  2ECG A;  2E7O A;  5F3A A;  3U5J A;  4PCE A;  5EQ1 A;  4QSS A;  5I1Q A;  3T7L A;  4O77 A;  2NAA A;  2YQL A;  3HCT A;  4QUU A;  2NXB A;  1E4U A;  4HXN A;  4YAD A;  5DLZ A;  4ZW1 A;  5I80 A;  3EB6 A;  4GNE A;  5E9L A;  4QR3 A;  4E96 A;  1XWH A;  4ALG A;  5IBN A;  5DLX A;  4AYC A;  4YAT A;  5TCM A;  5CTL A;  2I50 A;  5FE0 A;  2LGG A;  2MD7 B;  2XEU A;  3QZV A;  5EGU A;  3LJW A;  5FER A;  4O78 A;  4O70 A;  3JVK A;  5FE7 A;  5B79 A;  1F62 A;  4LK9 A;  4CUR A;  4LRG A;  2DVQ A;  5F25 A;  2RFJ A;  2KYU A;  4UYH A;  5CRM A;  5KH3 A;  5ENH A;  3FKM X;  5E73 A;  4NRB A;  5A83 A;  2CKL B;  2N9G A;  2MIQ A;  4YBS A;  5L96 A;  5EWC A;  5FE9 A;  4J3I A;  5D1L B;  5FB1 A;  4YYN A;  4OGI A;  4YBT A;  5CQ4 A;  5CZG A;  5E7D A;  3ZNI A;  4HXL A;  5HJC A;  2I8N A;  5H9M A;  1DVP A;  4S3O B;  4YYK A;  4TT4 A;  5FFY A;  4NQM A;  5DX4 A;  3SOW A;  4XI1 A;  4QSX A;  4CFK A;  1VD4 A;  3UVD A;  5L8U A;  2ECW A;  2M6M A;  4IR3 A;  4NR9 A;  4NR8 A;  5BT5 A;  2YEL A;  5CY9 A;  2L75 A;  3M62 A;  4BW1 A;  1JOC A;  2FSA A;  5IGN A;  2YSM A;  2MA5 A;  2YUR A;  5AMF A;  5ETB A;  2Y43 A;  5EM3 A;  4HXP A;  5CQT A;  5D1M B;  2KRE A;  5CP5 A;  2H0D B;  4UIU A;  2DKW A;  3U5L A;  2KU3 A;  4I7D A;  3I2D A;  3ZVZ B;  4QSR A;  4A9L A;  4UYF B;  2G45 A;  2JMD A;  4A49 A;  4B86 C;  1WIL A;  4V3K C;  1G25 A;  3MB4 A;  2L5E A;  5ENI A;  5IGM A;  4LYW A;  1Z6U A;  5DW1 A;  3ASL A;  4O75 A;  5HEN A;  1WEQ A;  2YHN A;  4ZDT A;  4QSP A;  2YUC A;  3ZYQ A;  4PKL A;  4QBM A;  4QC3 A;  5FH6 A;  4A9H A;  1LDJ B;  3PUQ A;  5TRB A;  5HM0 A;  4YY4 A;  5FG4 A;  5DKC A;  5A81 A;  1JM7 B;  3ZPV 1;  2R10 A;  5FE2 A;  2VJE B;  4TYL A;  5AD3 A;  3V43 A;  5HQ7 A;  4CUT A;  4BW3 A;  2M85 A;  2M1R A;  5ENG A;  4NUC A;  4W4U A;  3DQV R;  2L85 A;  5FE3 A;  3MHS A;  4B7Y C;  5G0F A;  5CQ6 A;  4FLP A;  5HRW A;  2KGI A;  5A5S A;  2YHO A;  4N4G A;  2F6J A;  2L43 A;  4TU6 A;  2LRI C;  4BW4 A;  5CUA A;  5FH7 A;  4CL9 A;  5A5P A;  5LKZ A;  2Y1M A;  5D1K B;  2R0V A;  5TAB A;  3RTR B;  3JVM A;  5COI A;  1X0J A;  2G4A A;  3LQJ A;  5CRZ A;  5G4S A;  5C85 A;  5DFC A;  5TBN A;  5A85 A;  4UP0 A;  3HME A;  2YW5 A;  3GL6 A;  5DW2 A;  2LGL A;  5D3N A;  5B8D A;  3UV4 A;  4HBW A;  2RO1 A;  2C2L A;  3IU6 A;  2QJ0 A;  5LVQ A;  3O37 A;  5AIT A;  3UV2 A;  4UYG A;  1V87 A;  1EQF A;  3SOU A;  4IR6 A;  2E6S A;  4YK0 A;  5ACY A;  4MVT A;  2DWW A;  4BHW A;  2ECT A;  1E6I A;  4O7A A;  5CQ3 A;  5EWV A;  4MEP A;  5FEY A;  5EV9 A;  4WZ3 B;  4MR5 A;  4N4I A;  2KGG A;  2K17 A;  2KFT A;  4AP4 A;  4C67 A;  3SVF A;  5FB0 A;  4LYS A;  4R8P K;  5F62 A;  5C13 A;  4QC1 A;  2CSY A;  5E9K A;  4FIP A;  5ENB A;  2YU4 A;  3N9M A; 
#chains in the Genus database with same CATH topology
 5HEM A;  5LKT A;  3MXF A;  4IOQ A;  4YYG A;  2YRE A;  2ZET C;  3O34 A;  4MR3 A;  2D8U A;  5EYA F;  2LGK A;  4ZUX U;  2Y1N A;  5TDW A;  4ZQL A;  4QR5 A;  2VPG A;  5F2P A;  3ZVY A;  5G05 B;  4OGC A;  2VPD A;  5D24 A;  3EB5 A;  3H7H A;  4AKH A;  4TS8 A;  4R2Y A;  4IOR A;  3DAI A;  4AKI A;  3LQH A;  4TT2 A;  4YY6 A;  5HCL A;  3M7K A;  2VP7 A;  3S91 A;  2C2V S;  3JVL A;  2KKY A;  5C11 A;  1N72 A;  4DON A;  4QUT A;  1K2F A;  2FUI A;  4J0S A;  4MR6 A;  4C9Z A;  5F63 A;  3M63 A;  2KR4 A;  5F60 A;  5D3J A;  3IU5 A;  4XUA A;  5CS8 A;  5FE1 A;  5HFR A;  5DKA A;  5TDR A;  4KV1 A;  3P5O A;  4NRC A;  4F52 B;  4A9K A;  3FL2 A;  2KE1 A;  4QSU A;  4CCG X;  2ECJ A;  4V3L C;  4J0R A;  4O62 A;  3HTK C;  4TKP B;  3PUR A;  4IR5 A;  3ZPV E;  2D8S A;  1WEU A;  3SOX A;  4NUD A;  2OSS A;  4LZR A;  4A4B A;  5DYU A;  4WZ0 A;  4NR6 A;  5E74 A;  3T9K A;  3DWY A;  2MNZ A;  5DKH A;  2PNX A;  4QY4 A;  5KTU A;  4TU4 A;  4ALH A;  2EA6 A;  3MB3 A;  4A9F A;  2VPB A;  2FUU A;  4NXJ A;  4BBQ A;  2YEK A;  5IID A;  4FO9 A;  5I86 A;  2HYE D;  4MSX A;  4F3I A;  3D7C A;  1WEV A;  3VKG A;  4HXR A;  4TT6 A;  5JWM A;  2ECV A;  1X4U A;  1VFY A;  2L80 A;  4IOO A;  3U5N A;  2XB1 A;  4UI9 B;  1WFK A;  4CFL A;  1WEP A;  4IC3 A;  3UVY A;  4A9J A;  4O7F A;  5HRX A;  4UIY A;  4Y03 A;  2WP1 A;  4NR5 A;  4PCI A;  5A5O A;  5A7C A;  5D3T A;  1JM4 B;  3U5O A;  5C4Q A;  2JMJ A;  2DVR A;  4Q6F A;  2K1J A;  5AME A;  5I29 A;  1F68 A;  4A4C A;  3MQM A;  2L7P A;  3HMH A;  2K16 A;  1JSP B;  4O71 A;  2LN0 A;  3LDY A;  5DBM A;  5HQ5 A;  2YEM A;  4QSQ A;  1FBV A;  4LYI A;  2MA6 A;  4O7B A;  5ENC A;  5KH7 A;  1ZKR A;  5EIC A;  5A5R A;  5D3R A;  5HLS A;  4A9I A;  4N4F A;  5D3S A;  5EP7 A;  5CQ8 A;  5F1H A;  4NS5 A;  3LQI A;  1VYX A;  1WEO A;  5DYA A;  5DYC A;  4NYV A;  1WEN A;  3Q2E A;  4A9E A;  3QZS A;  4NYW A;  5L8T A;  3G0J A;  5DKD A;  4MEN A;  3N9Q A;  5ENJ A;  4FK5 A;  2XOZ A;  5B78 A;  5E3D A;  2RNX A;  2EXU A;  2P57 A;  5I7Y A;  4CUQ A;  4MEO A;  3KNV A;  3L11 A;  4X2I A;  5C7N A;  3LXJ A;  2VPE A;  4UIT A;  3LRQ A;  1ZS5 A;  3GV4 A;  5CQ5 A;  5KTW A;  3MUK A;  3E2D A;  5EIS A;  4Q0N A;  4QR4 A;  2PUY A;  5KO4 A;  2YW8 A;  2RI7 A;  3O36 A;  4QEW A;  2CKL A;  5I40 A;  2OUO A;  5TB6 A;  3KV5 A;  3L1Z B;  5E9I A;  5JI8 A;  3Q2F A;  5AD2 A;  1WUM A;  5FBX A;  2YT5 A;  3KV6 A;  4Z1S A;  4UYD A;  2K4D A;  4UYE A;  4Z1Q A;  5E0R A;  1Z2Q A;  2DJA A;  3N9P A;  4QYD A;  3JVJ A;  2CRW A;  5L98 A;  5F36 A;  4AYC B;  2LSP B;  3G0L A;  4NUE A;  3SUB A;  5J3X A;  4XYA A;  2L84 A;  4NRA A;  5LKU A;  5LJ1 A;  5JG6 A;  1MM3 A;  2EJN A;  3UV5 A;  3P1E A;  4TZ8 A;  5G4R A;  3HCS A;  5FFW A;  4O7C A;  5LJ2 A;  2AN6 A;  4WZ2 A;  5BT3 A;  3LVR E;  3MHH A;  3N9L A;  3UVW A;  4ZC9 A;  5D3H A;  3GG3 A;  4YAX A;  5SVY A;  2D9E A;  2H0D A;  5DY7 A;  2DVV A;  4A9O A;  5IGL A;  3UVX A;  5F1L A;  4UYF A;  5KHM A;  5CUG A;  4QB3 A;  4LDF A;  3D1B A;  4P5O B;  3TLP A;  3P1D A;  3I3J A;  3HMF A;  5FE6 A;  2KIZ A;  4N4H A;  5EI4 A;  4TQN A;  4QEV A;  3SVH A;  5DYX A;  4Q0O A;  3U5P A;  2CT2 A;  4KCX A;  3VK6 A;  4FJC A;  4UIV A;  3N9N A;  5I3L A;  4PS5 A;  4QF2 A;  3ZTG A;  1T1H A;  4RVR A;  4YH4 A;  3DPL R;  1JM7 A;  2OWA A;  4HBY A;  4WHW A;  5K29 A;  2VJE A;  5F61 A;  1LDK C;  3FM8 C;  1X4J A;  4YYM A;  3K2J A;  2LV9 A;  5FE4 A;  1N87 A;  2DAT A;  5EPB A;  5ENE A;  4LAD B;  4CUS A;  3QZT A;  2HDP A;  3NXB A;  4C66 A;  2UZG A;  5D7X A;  5FDZ A;  3RCW A;  2YQD A;  5IG6 A;  2MKE A;  2E3K A;  1ZBD B;  4J1P A;  4KV4 A;  4CLB A;  4YC9 A;  1WIM A;  4Z6I A;  3LVQ E;  5AIU A;  4NQN A;  4WIV A;  4A9N A;  5EVA A;  5DFB A;  5EWW A;  4Z93 A;  4QZS A;  5FE8 A;  5D26 A;  1IYM A;  1WUG A;  4GB0 A;  5FG5 A;  2BAY A;  2EOD A;  2LXP C;  2VNF A;  4IC2 A;  4PTB A;  5EWH A;  5B76 A;  3T6R A;  4LKA A;  3O70 A;  3C6W A;  2KWN A;  4Z6H A;  3N9O A;  5EPS A;  2KWJ A;  5ENF A;  4YBM A;  4NN2 A;  2G6Q A;  5I83 A;  2LQ6 A;  3SHB A;  5CFW A;  4N3W A;  3M99 A;  4UP5 A;  3RPG B;  4MEQ A;  2VJF A;  3VKH A;  2CSV A;  2IDA A;  5FFV A;  4A9M A;  4CUU A;  5A82 A;  2L0B A;  1MM2 A;  4A0C D;  3SVG A;  2LGV A;  2QIC A;  1CHC A;  2CSZ A;  2YSJ A;  2XP0 A;  5EWD A;  5IGK A;  1Z60 A;  5I88 A;  4QST A;  4LR6 A;  5II1 A;  2ECN A;  5DFD A;  2RSD A;  1WEM A;  2E7N A;  2H60 A;  3UW9 A;  4HXM A;  1RMD A;  4XY9 A;  4X3G A;  2YDW A;  5HQ6 A;  4QEU A;  5DIN A;  4LLB A;  2KTB B;  4F1P A;  1FP0 A;  3S92 A;  5A5Q A;  5I89 A;  5I7X A;  4HXO A;  2ECI A;  5L97 A;  5LCW B;  2MNY A;  5CPE A;  2G43 A;  4YYD A;  3IHP A;  4L58 A;  2R0Y A;  4O74 A;  3LJU X;  4PPE A;  2OO1 A;  5SVI A;  4MR4 A;  3ZYU A;  4YAB A;  3AQA A;  5H1T A;  3JUE A;  5CU8 A;  4WHU A;  2B0O E;  4AUQ B;  4I7B A;  4TTE A;  1BOR A;  2JMI A;  2YYN A;  3KQI A;  5C8G A;  2DVS A;  4AKG A;  5KH9 A;  5ETD A;  4NYX A;  5LJ0 A;  2DX8 A;  4HXS A;  5FE5 A;  3O47 A;  5D0C A;  4OGJ A;  4TZ2 A;  4OUF A;  2EGP A;  2I7K A;  1X4I A;  5HFQ A;  4CUP A;  2RS9 B;  2YYR A;  5B75 A;  5EA1 A;  5CQ7 A;  5F5Z A;  1WGM A;  2MD8 C;  3MUL A;  4YYI A;  5D3P A;  3AAD A;  4QNS A;  2LXH C;  3HCU A;  4LJN A;  4I7C A;  3PLW A;  4GNF A;  3O35 A;  5FG6 A;  2QIZ A;  2R0S A;  5CQA A;  4BJX A;  2KWO A;  4QYL A;  5CUC A;  2RNW A;  4XY8 A;  5BT4 A;  5LVR A;  5KU3 A;  4AI6 A;  4L7X A;  4UIZ A;  5HRV A;  5EPR A;  5II2 A;  4NR4 A;  4PY6 A;  2YQM A;  2XOY A;  3U5M A;  2MT5 A;  4WA6 A;  3P1C A;  5E9Y A;  5E9M A;  5C87 A;  2F42 A;  5B77 A;  4IR4 A;  5CUB A;  4H9D A;  4O76 A;  4O64 A;  5H85 A;  4AKN A;  2WP2 A;  2JUN A;  2GRC A;  5E3G A;  4UIW A;  2E6R A;  5D25 A;  5L99 A;  4LZS A;  3C5K A;  2RNY A;  5CUD A;  4OGE A;  4CA1 A;  4GND A;  5HEL A;  4R7E A;  4Z0O A;  5A5N A;  2LDR A;  4LZ2 A;  5EU1 A;  5LKX A;  1WEE A;  5K3Q A;  1HYI A;  3ONI A;  5CGP A;  4BW2 A;  2MUM A;  2MJV B;  4LC2 A;  1WES A;  2KWK A;  1U6G B;  4YH3 A;  4O72 A;  4HXK A;  4HBV A;  5CUE A;  5E9V A;  5H1U A;  2D82 A;  3PHD A;  3U5K A;  1WEW A;  2JRJ A;  4NR7 A;  3RPG C;  5KTX A;  1WE9 A;  4O7E A;  3DDT A;  3NG2 A;  2VJF B;  2YVR A;  1HYJ A;  4HBX A;  3O7A A;  4QSW A;  5FH8 A;  5H1V A;  5J0D A;  5LUU A;  4UIX A;  2XOC A;  3L1X A;  2OXQ C;  4S3O C;  5G04 B;  3O33 A;  3P1F A;  5D3L A;  1PUO A;  4XUB A;  2L5U A;  3FJU B;  5EK9 A;  2F6N A;  4GPJ A;  4QSV A;  2CRR A;  4QF3 A;  4AVX A;  4YYH A;  4YYJ A;  2M3H A;  4GNG A;  5C89 A;  2ECG A;  2E7O A;  5F3A A;  3U5J A;  4PCE A;  5EQ1 A;  4QSS A;  5I1Q A;  3T7L A;  4O77 A;  2NAA A;  2CON A;  2YQL A;  3HCT A;  4QUU A;  3KDE C;  2NXB A;  1E4U A;  4HXN A;  4YAD A;  5DLZ A;  4ZW1 A;  5I80 A;  3EB6 A;  4GNE A;  3D1D A;  5E9L A;  4QR3 A;  4E96 A;  1XWH A;  4ALG A;  5IBN A;  5DLX A;  5SVI B;  4AYC A;  4YAT A;  5TCM A;  5CTL A;  2I50 A;  5FE0 A;  2LGG A;  2MD7 B;  2XEU A;  3QZV A;  5EGU A;  3LJW A;  5FER A;  4O78 A;  4O70 A;  3JVK A;  5FE7 A;  5B79 A;  1F62 A;  4LK9 A;  4CUR A;  4LRG A;  2DVQ A;  5F25 A;  2RFJ A;  2KYU A;  4UYH A;  5CRM A;  3FAN A;  5KH3 A;  5ENH A;  3FKM X;  4W4U A;  5E73 A;  4NRB A;  5A83 A;  2CKL B;  2N9G A;  1DCQ A;  2MIQ A;  4YBS A;  5L96 A;  5EWC A;  5FE9 A;  4J3I A;  5D1L B;  5FB1 A;  4YYN A;  4OGI A;  4YBT A;  5CQ4 A;  5CZG A;  5E7D A;  3ZNI A;  4HXL A;  5HJC A;  2I8N A;  5H9M A;  1DVP A;  4S3O B;  4YYK A;  4TT4 A;  5FFY A;  4NQM A;  5DX4 A;  3SOW A;  4XI1 A;  4QSX A;  4CFK A;  1VD4 A;  3UVD A;  5L8U A;  2ECW A;  2M6M A;  3ERR A;  4IR3 A;  4NR9 A;  4NR8 A;  5BT5 A;  2YEL A;  5CY9 A;  2L75 A;  3M62 A;  4BW1 A;  1JOC A;  1MBM A;  2FSA A;  5IGN A;  2DSM A;  2KKX A;  2YSM A;  2MA5 A;  2YUR A;  5SVX A;  5AMF A;  5ETB A;  2Y43 A;  5EM3 A;  4HXP A;  5CQT A;  5D1M B;  2KRE A;  5CP5 A;  2H0D B;  4UIU A;  2DKW A;  3U5L A;  2IQJ A;  2KU3 A;  3I2D A;  4I7D A;  4QSR A;  4A9L A;  4UYF B;  2G45 A;  2JMD A;  4Z0R A;  3ZVZ B;  1WIL A;  4V3K C;  4A49 A;  4B86 C;  3MB4 A;  1G25 A;  2L5E A;  5ENI A;  5IGM A;  4LYW A;  1Z6U A;  3DWD A;  5DW1 A;  3ASL A;  4O75 A;  5HEN A;  1WEQ A;  2YHN A;  4ZDT A;  4QSP A;  2YUC A;  3ZYQ A;  4PKL A;  4QBM A;  4QC3 A;  5FH6 A;  4A9H A;  1LDJ B;  3PUQ A;  5TRB A;  5HM0 A;  4YY4 A;  3FAO A;  5FG4 A;  5DKC A;  5A81 A;  1JM7 B;  3ZPV 1;  2FD4 A;  2R10 A;  5FE2 A;  2VJE B;  4TYL A;  5AD3 A;  3V43 A;  5HQ7 A;  4CUT A;  4BW3 A;  2M13 A;  2M1R A;  5ENG A;  4NUC A;  2E61 A;  2M85 A;  2L85 A;  5FE3 A;  3DQV R;  3MHS A;  4B7Y C;  5G0F A;  5CQ6 A;  4FLP A;  5HRW A;  2KGI A;  5A5S A;  2YHO A;  2RR4 A;  4N4G A;  2F6J A;  2L43 A;  4TU6 A;  2LRI C;  4BW4 A;  5CUA A;  5FH7 A;  4CL9 A;  5A5P A;  5LKZ A;  2FFW A;  2Y1M A;  5D1K B;  2R0V A;  5TAB A;  3RTR B;  3JVM A;  5COI A;  1X0J A;  2G4A A;  3LQJ A;  5CRZ A;  5G4S A;  5C85 A;  5DFC A;  5TBN A;  5A85 A;  4UP0 A;  3HME A;  2YW5 A;  3GL6 A;  5DW2 A;  2LGL A;  5D3N A;  5B8D A;  3UV4 A;  3FEH A;  4HBW A;  2LAU A;  2RO1 A;  2C2L A;  3IU6 A;  2QJ0 A;  5LVQ A;  3O37 A;  5AIT A;  3UV2 A;  4UYG A;  1V87 A;  3Q1D A;  1EQF A;  3SOU A;  4IR6 A;  2E6S A;  4YK0 A;  5ACY A;  4MVT A;  2DWW A;  4BHW A;  2ECT A;  2EGM A;  1E6I A;  4O7A A;  5CQ3 A;  5EWV A;  4QQ4 A;  4MEP A;  2JM3 A;  5FEY A;  5EV9 A;  4WZ3 B;  4MR5 A;  4N4I A;  3MDB C;  2KGG A;  2K17 A;  2KFT A;  4AP4 A;  4C67 A;  3SVF A;  5FB0 A;  4LYS A;  4R8P K;  5F62 A;  5C13 A;  4QC1 A;  2CSY A;  5E9K A;  4FIP A;  5ENB A;  2YU4 A;  3N9M A; 
#chains in the Genus database with same CATH homology
 5HEM A;  5LKT A;  3MXF A;  4IOQ A;  4YYG A;  2YRE A;  2ZET C;  3O34 A;  4MR3 A;  5EYA F;  4ZUX U;  2LGK A;  2Y1N A;  5TDW A;  4ZQL A;  4QR5 A;  2VPG A;  5F2P A;  3ZVY A;  5G05 B;  2VPD A;  5D24 A;  3EB5 A;  4TS8 A;  4R2Y A;  4IOR A;  3DAI A;  3LQH A;  4TT2 A;  4YY6 A;  5HCL A;  2VP7 A;  3S91 A;  2C2V S;  3JVL A;  5C11 A;  1N72 A;  4DON A;  4QUT A;  1K2F A;  2FUI A;  4J0S A;  4MR6 A;  4C9Z A;  5F63 A;  3M63 A;  2KR4 A;  5F60 A;  5D3J A;  3IU5 A;  4XUA A;  5CS8 A;  5FE1 A;  5HFR A;  5DKA A;  5TDR A;  4KV1 A;  3P5O A;  4NRC A;  4F52 B;  4A9K A;  3FL2 A;  2KE1 A;  4QSU A;  4CCG X;  2ECJ A;  4V3L C;  4J0R A;  3HTK C;  4TKP B;  3PUR A;  4IR5 A;  3ZPV E;  2D8S A;  1WEU A;  3SOX A;  4NUD A;  2OSS A;  4LZR A;  4A4B A;  5DYU A;  4WZ0 A;  4NR6 A;  5E74 A;  3DWY A;  2MNZ A;  5DKH A;  2PNX A;  4QY4 A;  5KTU A;  4TU4 A;  4ALH A;  2EA6 A;  3MB3 A;  4A9F A;  2VPB A;  2FUU A;  4NXJ A;  4BBQ A;  2YEK A;  5IID A;  4FO9 A;  5I86 A;  2HYE D;  4MSX A;  4F3I A;  3D7C A;  1WEV A;  4HXR A;  4TT6 A;  5JWM A;  2ECV A;  1X4U A;  1VFY A;  2L80 A;  4IOO A;  3U5N A;  2XB1 A;  4UI9 B;  1WFK A;  4CFL A;  1WEP A;  4IC3 A;  3UVY A;  4A9J A;  4O7F A;  5HRX A;  4UIY A;  4Y03 A;  2WP1 A;  4NR5 A;  4PCI A;  5A5O A;  5A7C A;  5D3T A;  1JM4 B;  3U5O A;  5C4Q A;  2JMJ A;  2DVR A;  4Q6F A;  2K1J A;  5AME A;  5I29 A;  1F68 A;  4A4C A;  3MQM A;  3HMH A;  2K16 A;  1JSP B;  4O71 A;  2LN0 A;  5DBM A;  5HQ5 A;  2YEM A;  4QSQ A;  1FBV A;  4LYI A;  2MA6 A;  4O7B A;  5ENC A;  5KH7 A;  5EIC A;  5A5R A;  5D3R A;  5HLS A;  4A9I A;  4N4F A;  5D3S A;  5EP7 A;  5CQ8 A;  5F1H A;  4NS5 A;  3LQI A;  1VYX A;  1WEO A;  5DYA A;  5DYC A;  4NYV A;  1WEN A;  3Q2E A;  4A9E A;  3QZS A;  4NYW A;  5L8T A;  3G0J A;  5DKD A;  4MEN A;  3N9Q A;  5ENJ A;  4FK5 A;  5B78 A;  5E3D A;  2RNX A;  5I7Y A;  4CUQ A;  4MEO A;  3KNV A;  3L11 A;  4X2I A;  5C7N A;  3LXJ A;  2VPE A;  4UIT A;  3LRQ A;  1ZS5 A;  3GV4 A;  5CQ5 A;  5KTW A;  3MUK A;  5EIS A;  4Q0N A;  4QR4 A;  2PUY A;  5KO4 A;  2YW8 A;  2RI7 A;  3O36 A;  4QEW A;  2CKL A;  5I40 A;  2OUO A;  5TB6 A;  3KV5 A;  3L1Z B;  5E9I A;  5JI8 A;  3Q2F A;  5AD2 A;  1WUM A;  5FBX A;  2YT5 A;  3KV6 A;  4Z1S A;  4UYD A;  2K4D A;  4UYE A;  4Z1Q A;  5E0R A;  1Z2Q A;  3N9P A;  4QYD A;  3JVJ A;  5L98 A;  5F36 A;  4AYC B;  2LSP B;  3G0L A;  4NUE A;  5J3X A;  4XYA A;  2L84 A;  4NRA A;  5LKU A;  5LJ1 A;  5JG6 A;  1MM3 A;  3UV5 A;  3P1E A;  4TZ8 A;  5G4R A;  3HCS A;  5FFW A;  4O7C A;  5LJ2 A;  2AN6 A;  4WZ2 A;  5BT3 A;  3MHH A;  3N9L A;  3UVW A;  4ZC9 A;  5D3H A;  3GG3 A;  4YAX A;  2D9E A;  2H0D A;  5DY7 A;  2DVV A;  4A9O A;  5IGL A;  3UVX A;  5F1L A;  4UYF A;  5KHM A;  5CUG A;  4QB3 A;  4LDF A;  4P5O B;  3TLP A;  3P1D A;  3I3J A;  3HMF A;  5FE6 A;  2KIZ A;  4N4H A;  5EI4 A;  4TQN A;  4QEV A;  3SVH A;  5DYX A;  4Q0O A;  3U5P A;  2CT2 A;  4KCX A;  3VK6 A;  4FJC A;  4UIV A;  3N9N A;  5I3L A;  4PS5 A;  4QF2 A;  3ZTG A;  1T1H A;  4RVR A;  4YH4 A;  3DPL R;  1JM7 A;  2VJE A;  4HBY A;  4WHW A;  5K29 A;  5F61 A;  1LDK C;  1X4J A;  4YYM A;  3K2J A;  2LV9 A;  5FE4 A;  1N87 A;  2DAT A;  5EPB A;  5ENE A;  4LAD B;  4CUS A;  3QZT A;  2HDP A;  3NXB A;  4C66 A;  2UZG A;  5D7X A;  5FDZ A;  3RCW A;  2YQD A;  5IG6 A;  2E3K A;  1ZBD B;  4J1P A;  4KV4 A;  4CLB A;  4YC9 A;  1WIM A;  4Z6I A;  5AIU A;  4NQN A;  4WIV A;  4A9N A;  5EVA A;  5DFB A;  5EWW A;  4Z93 A;  4QZS A;  5FE8 A;  5D26 A;  1IYM A;  1WUG A;  4GB0 A;  5FG5 A;  2BAY A;  2EOD A;  2LXP C;  2VNF A;  4IC2 A;  4PTB A;  5EWH A;  5B76 A;  3T6R A;  4LKA A;  3O70 A;  3C6W A;  2KWN A;  4Z6H A;  3N9O A;  5EPS A;  2KWJ A;  5ENF A;  4YBM A;  4NN2 A;  2G6Q A;  5I83 A;  2LQ6 A;  3SHB A;  5CFW A;  4N3W A;  3M99 A;  4UP5 A;  3RPG B;  4MEQ A;  2VJF A;  2IDA A;  5FFV A;  4A9M A;  4CUU A;  5A82 A;  2L0B A;  1MM2 A;  4A0C D;  3SVG A;  2LGV A;  2QIC A;  1CHC A;  2CSZ A;  2YSJ A;  5EWD A;  5IGK A;  1Z60 A;  5I88 A;  4QST A;  4LR6 A;  5II1 A;  2ECN A;  5DFD A;  2RSD A;  1WEM A;  2E7N A;  2H60 A;  3UW9 A;  4HXM A;  1RMD A;  4XY9 A;  4X3G A;  2YDW A;  5HQ6 A;  4QEU A;  5DIN A;  4LLB A;  2KTB B;  1FP0 A;  3S92 A;  5A5Q A;  5I89 A;  5I7X A;  4HXO A;  2ECI A;  5L97 A;  5LCW B;  2MNY A;  5CPE A;  2G43 A;  4YYD A;  3IHP A;  4L58 A;  2R0Y A;  4O74 A;  4PPE A;  2OO1 A;  4MR4 A;  3ZYU A;  4YAB A;  3AQA A;  5H1T A;  5CU8 A;  4WHU A;  4AUQ B;  4I7B A;  4TTE A;  1BOR A;  2JMI A;  2YYN A;  3KQI A;  5C8G A;  2DVS A;  5KH9 A;  5ETD A;  4NYX A;  5LJ0 A;  2DX8 A;  4HXS A;  5FE5 A;  5D0C A;  4OGJ A;  4TZ2 A;  4OUF A;  2EGP A;  2I7K A;  1X4I A;  5HFQ A;  4CUP A;  2RS9 B;  2YYR A;  5B75 A;  5EA1 A;  5CQ7 A;  5F5Z A;  1WGM A;  2MD8 C;  3MUL A;  4YYI A;  5D3P A;  3AAD A;  4QNS A;  2LXH C;  3HCU A;  4LJN A;  4I7C A;  4GNF A;  3O35 A;  5FG6 A;  2QIZ A;  2R0S A;  5CQA A;  4BJX A;  2KWO A;  4QYL A;  5CUC A;  2RNW A;  4XY8 A;  5BT4 A;  5LVR A;  5KU3 A;  4L7X A;  4UIZ A;  5HRV A;  5EPR A;  5II2 A;  4NR4 A;  4PY6 A;  2YQM A;  3U5M A;  2MT5 A;  4WA6 A;  3P1C A;  5E9Y A;  5E9M A;  5C87 A;  2F42 A;  5B77 A;  4IR4 A;  5CUB A;  4O76 A;  4O64 A;  5H85 A;  4AKN A;  2WP2 A;  2GRC A;  5E3G A;  4UIW A;  2E6R A;  5D25 A;  5L99 A;  4LZS A;  3C5K A;  2RNY A;  5CUD A;  4CA1 A;  4GND A;  5HEL A;  4R7E A;  5A5N A;  2LDR A;  4LZ2 A;  5EU1 A;  5LKX A;  1WEE A;  1HYI A;  3ONI A;  5CGP A;  4BW2 A;  2MUM A;  2MJV B;  4LC2 A;  1WES A;  2KWK A;  1U6G B;  4YH3 A;  4O72 A;  4HXK A;  4HBV A;  5CUE A;  5E9V A;  5H1U A;  2D82 A;  3PHD A;  3U5K A;  1WEW A;  2JRJ A;  4NR7 A;  3RPG C;  5KTX A;  1WE9 A;  4O7E A;  1HYJ A;  3NG2 A;  2VJF B;  4HBX A;  3O7A A;  4QSW A;  5FH8 A;  5H1V A;  5J0D A;  5LUU A;  4UIX A;  3L1X A;  2OXQ C;  4S3O C;  5G04 B;  3O33 A;  3P1F A;  5D3L A;  2L5U A;  4XUB A;  5EK9 A;  2F6N A;  4GPJ A;  4QSV A;  4QF3 A;  4AVX A;  4YYH A;  4YYJ A;  2M3H A;  4GNG A;  5C89 A;  2ECG A;  2E7O A;  5F3A A;  3U5J A;  4PCE A;  5EQ1 A;  4QSS A;  5I1Q A;  3T7L A;  4O77 A;  2NAA A;  2YQL A;  3HCT A;  4QUU A;  2NXB A;  1E4U A;  4HXN A;  4YAD A;  5DLZ A;  4ZW1 A;  5I80 A;  3EB6 A;  4GNE A;  5E9L A;  4QR3 A;  4E96 A;  1XWH A;  4ALG A;  5IBN A;  5DLX A;  4AYC A;  4YAT A;  5TCM A;  5CTL A;  2I50 A;  5FE0 A;  2LGG A;  2MD7 B;  2XEU A;  3QZV A;  5EGU A;  3LJW A;  5FER A;  4O78 A;  4O70 A;  3JVK A;  5FE7 A;  5B79 A;  1F62 A;  4LK9 A;  4CUR A;  4LRG A;  2DVQ A;  5F25 A;  2RFJ A;  2KYU A;  4UYH A;  5CRM A;  5KH3 A;  5ENH A;  3FKM X;  5E73 A;  4NRB A;  5A83 A;  2CKL B;  2N9G A;  2MIQ A;  4YBS A;  5L96 A;  5EWC A;  5FE9 A;  4J3I A;  5D1L B;  5FB1 A;  4YYN A;  4OGI A;  4YBT A;  5CQ4 A;  5CZG A;  5E7D A;  3ZNI A;  4HXL A;  5HJC A;  2I8N A;  5H9M A;  1DVP A;  4S3O B;  4YYK A;  4TT4 A;  5FFY A;  4NQM A;  5DX4 A;  3SOW A;  4XI1 A;  4QSX A;  4CFK A;  1VD4 A;  3UVD A;  5L8U A;  2ECW A;  2M6M A;  4IR3 A;  4NR9 A;  4NR8 A;  5BT5 A;  2YEL A;  5CY9 A;  2L75 A;  3M62 A;  4BW1 A;  1JOC A;  2FSA A;  5IGN A;  2YSM A;  2MA5 A;  2YUR A;  5AMF A;  5ETB A;  2Y43 A;  5EM3 A;  4HXP A;  5CQT A;  5D1M B;  2KRE A;  5CP5 A;  2H0D B;  4UIU A;  2DKW A;  3U5L A;  2KU3 A;  4I7D A;  3I2D A;  3ZVZ B;  4QSR A;  4A9L A;  4UYF B;  2G45 A;  2JMD A;  4A49 A;  4B86 C;  1WIL A;  4V3K C;  1G25 A;  3MB4 A;  2L5E A;  5ENI A;  5IGM A;  4LYW A;  1Z6U A;  5DW1 A;  3ASL A;  4O75 A;  5HEN A;  1WEQ A;  2YHN A;  4ZDT A;  4QSP A;  2YUC A;  3ZYQ A;  4PKL A;  4QBM A;  4QC3 A;  5FH6 A;  4A9H A;  1LDJ B;  3PUQ A;  5TRB A;  5HM0 A;  4YY4 A;  5FG4 A;  5DKC A;  5A81 A;  1JM7 B;  3ZPV 1;  2R10 A;  5FE2 A;  2VJE B;  4TYL A;  5AD3 A;  3V43 A;  5HQ7 A;  4CUT A;  4BW3 A;  2M85 A;  2M1R A;  5ENG A;  4NUC A;  4W4U A;  3DQV R;  2L85 A;  5FE3 A;  3MHS A;  4B7Y C;  5G0F A;  5CQ6 A;  4FLP A;  5HRW A;  2KGI A;  5A5S A;  2YHO A;  4N4G A;  2F6J A;  2L43 A;  4TU6 A;  2LRI C;  4BW4 A;  5CUA A;  5FH7 A;  4CL9 A;  5A5P A;  5LKZ A;  2Y1M A;  5D1K B;  2R0V A;  5TAB A;  3RTR B;  3JVM A;  5COI A;  1X0J A;  2G4A A;  3LQJ A;  5CRZ A;  5G4S A;  5C85 A;  5DFC A;  5TBN A;  5A85 A;  4UP0 A;  3HME A;  2YW5 A;  3GL6 A;  5DW2 A;  2LGL A;  5D3N A;  5B8D A;  3UV4 A;  4HBW A;  2RO1 A;  2C2L A;  3IU6 A;  2QJ0 A;  5LVQ A;  3O37 A;  5AIT A;  3UV2 A;  4UYG A;  1V87 A;  1EQF A;  3SOU A;  4IR6 A;  2E6S A;  4YK0 A;  5ACY A;  4MVT A;  2DWW A;  4BHW A;  2ECT A;  1E6I A;  4O7A A;  5CQ3 A;  5EWV A;  4MEP A;  5FEY A;  5EV9 A;  4WZ3 B;  4MR5 A;  4N4I A;  2KGG A;  2K17 A;  2KFT A;  4AP4 A;  4C67 A;  3SVF A;  5FB0 A;  4LYS A;  4R8P K;  5F62 A;  5C13 A;  4QC1 A;  2CSY A;  5E9K A;  4FIP A;  5ENB A;  2YU4 A;  3N9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...