3O33A

Crystal structure of trim24 phd-bromo in the free state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o33A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o33A01
1CHCA 3O36A 1ZBDB 3LQJA 3LJWA 4CUQA 5TDWA 4UIWA 1U6GB 4QSQA 4IC3A 1MM3A 4QEWA 2ECWA 3T6RA 4AYCA 5EU1A 5AIUA 1N72A 4LADB 5EI4A 2YT5A 5HCLA 4UI9B 4Y03A 1X0JA 1FP0A 4UYEA 4QB3A 5EPSA 5ETDA 3KNVA 5HENA 4KV4A 2JMIA 4QF3A 4CURA 4XI1A 4YYKA 4O74A 5K29A 5L98A 5C85A 1WEQA 1Z2QA 4S3OC 4L7XA 5DKCA 5HRWA 5D3HA 2G43A 2K1JA 4HBXA 1E4UA 5FDZA 2N9GA 4V3LC 2EGPA 4J0RA 4YATA 5ACYA 5EVAA 1WEMA 2VPGA 1RMDA 4NYWA 4QZSA 2L0BA 4IR4A 4CFKA 1JSPB 3O37A 2L85A 3QZVA 1V87A 5LKTA 3LRQA 4BW1A 4QSRA 4QSUA 5H9MA 3UV2A 4A9LA 5C7NA 5CUDA 5CQ6A 4TU4A 4AVXA 4O7BA 4WA6A 4TT2A 4C66A 5IBNA 4O7FA 5LKUA 2M3HA 4MEPA 4CUUA 4WZ0A 3P1CA 4A9MA 4LDFA 4A9KA 3U5PA 4YYDA 2CSYA 2RNYA 5HFRA 3O7AA 3JVJA 4O72A 4QUUA 4LYSA 3UVXA 3ONIA 5DYXA 1JM4B 4A4BA 2LQ6A 4UIUA 5ENBA 5A5NA 4GNEA 5AD2A 4QYDA 2QJ0A 2KFTA 5CQ5A 4YY6A 5FFVA 5D7XA 4Z6IA 5BT4A 5I80A 3QZSA 5A81A 4O7AA 3GL6A 3N9QA 4UYHA 5B76A 5EPBA 2CKLB 2KR4A 2L5UA 4O77A 2LXHC 5CP5A 4I7DA 3U5KA 4B86C 4GB0A 5E9LA 5CQ8A 5A5RA 2CSZA 5CPEA 3UV4A 2YELA 1HYJA 5L96A 3SHBA 2LRIC 5I1QA 4J3IA 3U5NA 2DVQA 4FLPA 1Z6UA 5FB0A 4YBTA 2NXBA 4WIVA 4QR3A 2LXPC 3I3JA 5DX4A 3DQVR 5I7YA 4YYIA 5G04B 3SVHA 5CU8A 4LZSA 5IGMA 4Q0NA 2KTBB 3GV4A 4AKNA 3TLPA 1WUMA 1WEUA 3N9NA 5AITA 5E9IA 2I50A 2E7OA 2ECNA 4O76A 5HFQA 4WHUA 4TS8A 3RPGC 2VJEA 5AMFA 4MEOA 3AQAA 2D82A 2DVRA 5I89A 1WEEA 4A0CD 4HBVA 5J0DA 3AADA 4A9JA 2RSDA 5DW1A 3SOUA 3N9MA 1WEOA 5C11A 4AUQB 4LYIA 4NYXA 5TCMA 5HRXA 1WEWA 4AYCB 3JVKA 3RTRB 5FE9A 3RCWA 2G45A 4O75A 2KWOA 3ZYUA 5CUGA 4PTBA 4NS5A 4QBMA 4W4UA 5A7CA 5FE3A 3KQIA 1X4JA 4NXJA 4C67A 2Y1NA 4TKPB 4YBMA 1VFYA 2YURA 5CZGA 5HRVA 5HQ6A 3EB5A 2Y1MA 4WZ2A 5A5SA 2YSMA 2MJVB 4PY6A 3N9OA 5G4SA 5IIDA 4N3WA 5FE4A 5DFDA 4QNSA 4WZ3B 5KH3A 5HELA 1JM7A 4LYWA 3DAIA 4J1PA 3HMHA 2JMJA 5I88A 4LZRA 3LXJA 4TT4A 3JVMA 5FBXA 5A82A 2R10A 3S92A 4YYHA 5KTWA 2VJFB 5I3LA 2DATA 4QC1A 5F1LA 4IR6A 5CQTA 5FH7A 4N4FA 2LGLA 5A5PA 5I29A 4NN2A 5KO4A 2ECGA 5DLZA 2LDRA 5HJCA 5DKDA 4OUFA 5C8GA 4OGIA 2YQLA 4KV1A 3MUKA 4TZ8A 5D1LB 5C89A 1WUGA 3T7LA 4GNGA 5IGNA 4LC2A 3KV6A 2UZGA 4TT6A 2I8NA 4A9EA 4P5OB 2DWWA 1BORA 1T1HA 5CGPA 2DVVA 5CQ4A 3UV5A 2E7NA 3MQMA 4CA1A 5FB1A 2WP2A 5F63A 5ENGA 3SVFA 2KWJA 2MD8C 4XY8A 4A9NA 2VNFA 5CTLA 5L99A 4TTEA 3QZTA 3C5KA 4AP4A 5DKAA 5DLXA 3HTKC 5L97A 2CT2A 2OO1A 1FBVA 5BT5A 4HXSA 2EA6A 2H0DA 5DYCA 5TBNA 5CRZA 4UYFA 5C87A 2KGIA 2LGVA 5LCWB 5CFWA 3L1ZB 4I7BA 1N87A 4A9OA 3MXFA 4A9FA 2VPEA 5IGKA 4NUCA 2YREA 4UIXA 5EWCA 4UP5A 4Q0OA 3LQHA 4HXLA 5LJ0A 4PCIA 3HMFA 2FUIA 2KIZA 2YHNA 3IU5A 3P1DA 4LZ2A 3PHDA 5A83A 4MVTA 4FJCA 3UVYA 1G25A 4QUTA 1VD4A 2MIQA 4UIZA 2RFJA 2G6QA 5DKHA 4B7YC 5F3AA 5TB6A 3MB4A 3O34A 4YY4A 5LKZA 4LRGA 2FUUA 4HXRA 4DONA 4IOOA 4QY4A 3ZVYA 2LN0A 4NRAA 2ECVA 5FG5A 4I7CA 4GNFA 5EWWA 5AD3A 5CY9A 2WP1A 4XUBA 5FE6A 4LLBA 5A5OA 4NRCA 2L84A 2QIZA 4YYJA 5L8UA 3HCUA 4UIVA 4BBQA 4IOQA 5I7XA 3U5LA 2RS9B 4N4HA 2JRJA 2RNXA 3D7CA 2DX8A 2L80A 3G0JA 1F62A 2MT5A 5E9MA 5DY7A 5FE0A 5FE5A 4QEVA 2K4DA 2YYNA 4NYVA 3NG2A 5E3GA 4UITA 2HYED 2IDAA 2YYRA 4MR5A 4NR8A 1WFKA 4Z1SA 2M85A 5CUEA 4A9IA 4QF2A 4MR3A 1JM7B 2MD7B 5E7DA 3SVGA 2C2VS 4QSPA 2YDWA 5F1HA 4F3IA 3ZPV1 4IORA 5F36A 2DVSA 4YADA 4MR4A 5CS8A 2MNYA 5HLSA 1VYXA 5KTUA 3HMEA 4NR9A 4CUTA 5F25A 4CLBA 4O7CA 5II1A 2M1RA 2KGGA 4R2YA 4IR3A 2NAAA 3ZNIA 4QR4A 2KU3A 3M63A 4ZQLA 2D8SA 2ECJA 5A85A 4FO9A 5DYAA 2OUOA 3UVDA 5E9VA 3V43A 2JMDA 1XWHA 2RNWA 4OGJA 1WEPA 4O64A 5HM0A 2E6SA 5LJ2A 4UP0A 4MENA 2XB1A 2H60A 1X4UA 4V3KC 3O35A 5HEMA 4O78A 4TQNA 4J0SA 2YEMA 5EPRA 5I83A 4ZC9A 3U5MA 1HYIA 5EGUA 2YUCA 3MULA 5D3PA 5D24A 5II2A 2K16A 3O70A 5EK9A 4CL9A 2F6NA 3GG3A 1Z60A 5F60A 4FIPA 4S3OB 2H0DB 4QSVA 5G0FA 3ZYQA 4UYFB 2PUYA 2M6MA 3NXBA 3IHPA 5KTXA 4HBWA 3ZTGA 4ALHA 5C4QA 5IG6A 5EA1A 2QICA 5LVQA 5EISA 5FE2A 2YQMA 5D3JA 3HCTA 4ZW1A 5CQAA 4GPJA 3UVWA 3U5JA 4CUSA 5CRMA 5I86A 1DVPA 3FL2A 4A4CA 1ZS5A 2YSJA 2DKWA 5LKXA 2OXQC 4CUPA 4QR5A 3ASLA 5DFBA 4XY9A 4C9ZA 5F62A 4BW2A 2R0VA 4XYAA 2D9EA 5E9YA 3FKMX 5ENHA 4O70A 5ENFA 4RVRA 5JI8A 5G05B 4F52B 2F6JA 2FSAA 5EWDA 5FEYA 5FE1A 4QSWA 2HDPA 5D0CA 4LR6A 2RO1A 5B77A 3IU6A 3ZVZB 5D3TA 5CQ7A 5ETBA 5LJ1A 5DYUA 1WGMA 4FK5A 2KYUA 2XEUA 4LJNA 4IR5A 1WEVA 4YYGA 2MA5A 4X3GA 4Z6HA 4A49A 4HXMA 1LDKC 5AMEA 4PPEA 5B78A 5D3NA 5ENEA 5FH6A 4YH3A 1F68A 3P1EA 2R0YA 5D1KB 4L58A 5KH9A 5F5ZA 5CUBA 4R8PK 4UYDA 5FG6A 5KU3A 4MR6A 5FG4A 5EQ1A 3M99A 4NQMA 5D1MB 2R0SA 1K2FA 4BHWA 3SOXA 5DBMA 3VK6A 5ENIA 4YK0A 4IC2A 5E0RA 5EM3A 5G4RA 2VJEB 4XUAA 2ECTA 3N9PA 3PUQA 5I40A 4NUDA 2KE1A 5KH7A 5DFCA 4CCGX 5CUAA 2VJFA 4PKLA 3L11A 4A9HA 1WE9A 4HXOA 4HXKA 4Z1QA 5FFYA 2G4AA 2ZETC 3JVLA 5FFWA 4Q6FA 2YEKA 2VPBA 2KREA 4NUEA 3K2JA 4HBYA 4UIYA 5E73A 5BT3A 4ALGA 3MB3A 3RPGB 5JG6A 5E74A 5HQ7A 4BW4A 2E6RA 5DINA 2YW5A 4BW3A 5H1UA 4N4IA 5LUUA 3DPLR 5E3DA 1WILA 4QC3A 2YHOA 2YQDA 5EV9A 3N9LA 4LKAA 3ZPVE 2PNXA 4TYLA 3EB6A 5D3SA 2BAYA 5FERA 4PCEA 2I7KA 5KHMA 2Y43A 3KV5A 1EQFA 2OSSA 2LSPB 1WIMA 5IGLA 5HQ5A 3O33A 3DWYA 4HXNA 1JOCA 4E96A 4R7EA 4PS5A 5D26A 3U5OA 2LV9A 4QSSA 5D3RA 2MA6A 3PURA 5EYAF 4NQNA 4YAXA 2KWNA 2LGGA 3M62A 5EWHA 2K17A 4X2IA 4YH4A 4UYGA 5H85A 4NR5A 3MHHA 2L43A 2YW8A 4NRBA 5EICA 5A5QA 1LDJB 2L5EA 5COIA 2GRCA 5CQ3A 5ENJA 2KWKA 5C13A 4YYNA 5B8DA 5FH8A 4Z93A 2AN6A 2ECIA 5D25A 2C2LA 2EODA 4LK9A 5J3XA 4CFLA 4KCXA 5TRBA 5CUCA 3UW9A 3HCSA 4MSXA 4GNDA 4YC9A 2CKLA 3P1FA 4WHWA 1X4IA 3P5OA 5FE7A 4YYMA 4YBSA 4ZDTA 4YABA 4BJXA 5F2PA 3SOWA 5LVRA 4NR6A 4QSTA 4NR4A 3C6WA 2YU4A 2VPDA 5B79A 2MNZA 5FE8A 5F61A 2RI7A 5E9KA 5H1VA 4QSXA 3MHSA 4ZUXU 2MUMA 5D3LA 4TU6A 4QEUA 3G0LA 5B75A 4HXPA 5EP7A 5ENCA 3S91A 1IYMA 3Q2FA 1WESA 3I2DA 4NR7A 3L1XA 5EWVA 5TDRA 1E6IA 4O71A 2VP7A 5DW2A 5JWMA 4N4GA 2LGKA 2E3KA 3LQIA 4O7EA 4TZ2A 5H1TA 2F42A 3Q2EA 4MEQA 5L8TA 1MM2A 5TABA 4QYLA 1WENA 2L75A
chains in the Genus database with same CATH superfamily
2L7PA 1CHCA 3O36A 1ZBDB 3LQJA 3LJWA 4CUQA 3H7HA 5TDWA 4UIWA 1U6GB 4QSQA 2DJAA 4IC3A 1MM3A 3VKGA 4QEWA 2ECWA 3T6RA 4AYCA 5EU1A 2EXUA 5AIUA 1N72A 4LADB 5EI4A 2YT5A 5HCLA 4UI9B 4Y03A 1X0JA 1FP0A 4UYEA 4QB3A 5EPSA 5ETDA 3KNVA 5HENA 2YVRA 2KKYA 4KV4A 2JMIA 4QF3A 4CURA 4XI1A 4YYKA 4O74A 5K29A 5L98A 5C85A 1MBMA 1WEQA 1Z2QA 4S3OC 4L7XA 5DKCA 5HRWA 5D3HA 2G43A 2K1JA 4HBXA 1E4UA 5FDZA 2N9GA 4V3LC 2EGPA 4J0RA 4YATA 5ACYA 5EVAA 1WEMA 2VPGA 1RMDA 4NYWA 4QZSA 2L0BA 4IR4A 4CFKA 2EJNA 3FANA 1JSPB 3O37A 2L85A 3QZVA 1V87A 5LKTA 3LRQA 4BW1A 4QSRA 4QSUA 5H9MA 3UV2A 4A9LA 5C7NA 5CUDA 2FFWA 5CQ6A 4TU4A 4AVXA 4O7BA 4WA6A 4TT2A 2CSVA 4C66A 5IBNA 4O7FA 5LKUA 2M3HA 4MEPA 4CUUA 4WZ0A 3P1CA 4A9MA 4LDFA 4A9KA 3U5PA 4YYDA 2CSYA 2RNYA 5HFRA 3O7AA 3JVJA 4O72A 4QUUA 4LYSA 3UVXA 3ONIA 5DYXA 1JM4B 4A4BA 2LQ6A 4UIUA 5ENBA 5A5NA 4GNEA 5AD2A 4QYDA 2QJ0A 2KFTA 5CQ5A 4YY6A 5FFVA 5D7XA 4Z6IA 5BT4A 5I80A 3QZSA 5A81A 4O7AA 3GL6A 3N9QA 4UYHA 5B76A 5EPBA 2CKLB 2KR4A 2L5UA 4O77A 2LXHC 5CP5A 3LJUX 3U5KA 4I7DA 4B86C 4Z0OA 4GB0A 5E9LA 5CQ8A 5A5RA 2CSZA 5CPEA 3UV4A 2YELA 1HYJA 5L96A 3SHBA 2LRIC 5I1QA 4J3IA 3U5NA 2DVQA 4FLPA 1Z6UA 2EGMA 5FB0A 4YBTA 2NXBA 4WIVA 4QR3A 2LXPC 3I3JA 5DX4A 3DQVR 5I7YA 4YYIA 5G04B 3SVHA 5CU8A 3PLWA 4LZSA 5IGMA 3ERRA 4Q0NA 2KTBB 3GV4A 3M7KA 4AKNA 3TLPA 1WUMA 1WEUA 3N9NA 5AITA 5E9IA 2I50A 2E7OA 2ECNA 4O76A 5HFQA 4WHUA 4TS8A 4O62A 3RPGC 2VJEA 5AMFA 4MEOA 2IQJA 3AQAA 2D82A 2DVRA 5I89A 1WEEA 4A0CD 4HBVA 5J0DA 3AADA 4A9JA 2RSDA 5DW1A 3SOUA 3N9MA 1WEOA 3LVRE 5C11A 4AUQB 4LYIA 4NYXA 2XOYA 5TCMA 5HRXA 1WEWA 4AYCB 3JVKA 3RTRB 5FE9A 3RCWA 2G45A 4O75A 2KWOA 3ZYUA 5CUGA 4PTBA 4NS5A 4QBMA 4W4UA 5A7CA 4AKIA 5FE3A 3KQIA 1X4JA 4NXJA 4C67A 2XOCA 2Y1NA 4TKPB 4YBMA 1VFYA 2YURA 5CZGA 5HRVA 5HQ6A 3EB5A 2Y1MA 4WZ2A 5A5SA 2YSMA 2MJVB 3DWDA 4PY6A 3N9OA 5G4SA 5IIDA 4N3WA 5FE4A 5DFDA 4QNSA 4WZ3B 5KH3A 1PUOA 5HELA 1JM7A 4LYWA 3DAIA 4J1PA 3HMHA 2JMJA 5I88A 4LZRA 3LXJA 4TT4A 3JVMA 5FBXA 5A82A 2R10A 3S92A 4YYHA 5KTWA 2VJFB 5I3LA 2DATA 4QC1A 5F1LA 4IR6A 5CQTA 5FH7A 4N4FA 2LGLA 5A5PA 5I29A 4NN2A 5KO4A 2ECGA 5DLZA 2LDRA 5HJCA 4QQ4A 5DKDA 4OUFA 5C8GA 4OGIA 2YQLA 4KV1A 3MUKA 4TZ8A 5D1LB 5C89A 1WUGA 3T7LA 4GNGA 5IGNA 4LC2A 3KV6A 2UZGA 4TT6A 2I8NA 4A9EA 5SVIA 4P5OB 2DWWA 1BORA 1T1HA 5CGPA 5SVXA 2DVVA 5CQ4A 3UV5A 2E7NA 3MQMA 4CA1A 5FB1A 2WP2A 5F63A 5ENGA 3SVFA 2KWJA 2MD8C 4XY8A 4A9NA 2VNFA 5CTLA 5L99A 4TTEA 3QZTA 3C5KA 4AP4A 5DKAA 5DLXA 3HTKC 5L97A 2CT2A 2OO1A 1FBVA 5BT5A 4HXSA 2EA6A 2H0DA 5DYCA 5TBNA 5CRZA 4UYFA 5C87A 2KGIA 2LGVA 5LCWB 2CONA 5CFWA 3L1ZB 4I7BA 1N87A 4A9OA 3MXFA 4A9FA 2VPEA 5IGKA 4NUCA 2YREA 4UIXA 5EWCA 4UP5A 4Q0OA 3LQHA 4HXLA 5LJ0A 4PCIA 3HMFA 2FUIA 2KIZA 2YHNA 3IU5A 3P1DA 4LZ2A 3PHDA 5A83A 4MVTA 4FJCA 3UVYA 3Q1DA 4QUTA 1VD4A 3LVQE 2MIQA 1G25A 4UIZA 2RFJA 2G6QA 5DKHA 2OWAA 4B7YC 5F3AA 5TB6A 2XOZA 3MB4A 3O34A 4YY4A 5LKZA 4LRGA 2FUUA 4HXRA 4DONA 4IOOA 4QY4A 3ZVYA 2LN0A 4NRAA 2ECVA 5FG5A 4I7CA 4GNFA 5EWWA 5AD3A 5CY9A 2WP1A 4XUBA 5FE6A 4LLBA 5A5OA 4NRCA 2L84A 2QIZA 4YYJA 5L8UA 3HCUA 4UIVA 4BBQA 4IOQA 5I7XA 3U5LA 2JM3A 2RS9B 3DDTA 4N4HA 2JRJA 2RNXA 3D7CA 2DX8A 2L80A 3G0JA 1F62A 2MT5A 5E9MA 5DY7A 5FE0A 5FE5A 4QEVA 2K4DA 2YYNA 4NYVA 3NG2A 5E3GA 4F1PA 4UITA 2HYED 2IDAA 2YYRA 4MR5A 4NR8A 1WFKA 4Z1SA 2M85A 5CUEA 4A9IA 4QF2A 4MR3A 3T9KA 1JM7B 2MD7B 5E7DA 3SVGA 2C2VS 4QSPA 2YDWA 5F1HA 4F3IA 3ZPV1 4IORA 5F36A 2DVSA 4YADA 4MR4A 5CS8A 2MNYA 5HLSA 1VYXA 5KTUA 3HMEA 4NR9A 4CUTA 3D1DA 5F25A 4CLBA 4O7CA 5II1A 2M1RA 3FAOA 2KGGA 4R2YA 4IR3A 2NAAA 3ZNIA 4QR4A 2KU3A 3M63A 4ZQLA 2D8SA 4OGCA 2ECJA 5A85A 4FO9A 5DYAA 2OUOA 3D1BA 5E9VA 3UVDA 3V43A 2JMDA 1XWHA 2RNWA 4OGJA 1WEPA 4O64A 5HM0A 2E6SA 5LJ2A 2CRWA 4MENA 4UP0A 5SVIB 2XB1A 2H60A 1X4UA 4V3KC 3O35A 5HEMA 4O78A 4TQNA 4J0SA 2YEMA 5EPRA 5I83A 4ZC9A 3U5MA 1HYIA 5EGUA 4H9DA 2YUCA 3MULA 5D3PA 5D24A 5II2A 2M13A 2K16A 3O70A 5EK9A 4CL9A 4AI6A 2F6NA 3GG3A 1Z60A 5F60A 4FIPA 4S3OB 2H0DB 4QSVA 3VKHA 5G0FA 3ZYQA 4UYFB 2PUYA 2M6MA 3NXBA 3IHPA 5KTXA 4HBWA 3ZTGA 4ALHA 5C4QA 5IG6A 5EA1A 2QICA 5LVQA 5EISA 5FE2A 2YQMA 5D3JA 3HCTA 4ZW1A 5CQAA 4GPJA 4Z0RA 3UVWA 3U5JA 4CUSA 5CRMA 5I86A 1DVPA 3FL2A 4A4CA 1ZS5A 2YSJA 2DKWA 5LKXA 2DSMA 2OXQC 4CUPA 4QR5A 3ASLA 5DFBA 4XY9A 4C9ZA 5F62A 4BW2A 2R0VA 4XYAA 2D9EA 5E9YA 3FKMX 5ENHA 4O70A 5ENFA 4RVRA 5JI8A 5G05B 4F52B 2F6JA 2FSAA 5EWDA 5FEYA 5FE1A 4QSWA 2HDPA 5D0CA 4LR6A 2RO1A 5B77A 3IU6A 3ZVZB 5D3TA 5CQ7A 5ETBA 5LJ1A 5DYUA 1WGMA 4FK5A 4OGEA 2KYUA 2XEUA 2D8UA 4LJNA 4IR5A 5SVYA 1WEVA 4YYGA 2MA5A 4X3GA 4Z6HA 4A49A 4HXMA 1LDKC 5AMEA 4PPEA 5B78A 5D3NA 5ENEA 5FH6A 4YH3A 1F68A 3P1EA 2R0YA 5D1KB 4L58A 5KH9A 5F5ZA 5CUBA 4R8PK 4UYDA 5FG6A 5KU3A 4MR6A 5FG4A 5EQ1A 3M99A 4NQMA 5D1MB 2R0SA 3FEHA 1K2FA 4BHWA 3SOXA 5DBMA 3VK6A 5ENIA 4YK0A 4IC2A 5E0RA 5EM3A 5G4RA 2VJEB 4XUAA 2ECTA 3N9PA 4AKHA 3PUQA 5I40A 4NUDA 2KE1A 5KH7A 3LDYA 5DFCA 4CCGX 5CUAA 2VJFA 4PKLA 3L11A 2LAUA 4A9HA 1WE9A 4HXOA 4HXKA 3SUBA 4Z1QA 5FFYA 2G4AA 2ZETC 3JVLA 5FFWA 4Q6FA 2YEKA 2VPBA 3KDEC 2KREA 4NUEA 3K2JA 4HBYA 4UIYA 5E73A 5BT3A 4ALGA 3MB3A 3RPGB 5JG6A 5E74A 5HQ7A 4BW4A 2E6RA 5DINA 2YW5A 4BW3A 5H1UA 4N4IA 5LUUA 3DPLR 5E3DA 1WILA 4QC3A 2YHOA 2YQDA 5EV9A 3N9LA 4LKAA 3ZPVE 2PNXA 4TYLA 3EB6A 5D3SA 2BAYA 2JUNA 5FERA 4PCEA 2I7KA 5KHMA 2Y43A 3KV5A 1EQFA 2OSSA 2LSPB 3JUEA 1WIMA 5IGLA 5HQ5A 2XP0A 3E2DA 4AKGA 3O33A 3DWYA 4HXNA 1JOCA 4E96A 4R7EA 4PS5A 5D26A 3U5OA 2LV9A 4QSSA 5D3RA 2E61A 2MA6A 3PURA 5EYAF 4NQNA 4YAXA 2KWNA 2LGGA 3MDBC 3M62A 5EWHA 2K17A 4X2IA 4YH4A 4UYGA 5H85A 4NR5A 3MHHA 2L43A 2YW8A 1ZKRA 4NRBA 5EICA 5A5QA 3FJUB 2P57A 1LDJB 2L5EA 5COIA 2GRCA 5CQ3A 5ENJA 2KWKA 5K3QA 4YYNA 5C13A 5B8DA 5FH8A 4Z93A 2AN6A 2ECIA 5D25A 2C2LA 2EODA 4LK9A 5J3XA 4CFLA 4KCXA 5TRBA 5CUCA 3UW9A 3HCSA 1DCQA 4MSXA 4GNDA 4YC9A 2CKLA 3P1FA 4WHWA 1X4IA 3FM8C 3P5OA 5FE7A 4YYMA 3O47A 4YBSA 2CRRA 4ZDTA 4YABA 4BJXA 5F2PA 3SOWA 5LVRA 4NR6A 4QSTA 4NR4A 3C6WA 2YU4A 2VPDA 5B79A 2FD4A 2MNZA 5FE8A 5F61A 2RR4A 2RI7A 5E9KA 5H1VA 4QSXA 3MHSA 4ZUXU 2MUMA 5D3LA 4TU6A 4QEUA 3G0LA 5B75A 4HXPA 5EP7A 5ENCA 2KKXA 3S91A 1IYMA 3Q2FA 1WESA 3I2DA 4NR7A 2MKEA 5EWVA 3L1XA 5TDRA 1E6IA 4O71A 2VP7A 5DW2A 5JWMA 4N4GA 2LGKA 2E3KA 3LQIA 4O7EA 4TZ2A 5H1TA 2B0OE 2F42A 3Q2EA 4MEQA 5L8TA 1MM2A 5TABA 4QYLA 1WENA 2L75A
chains in the Genus database with same CATH topology
1CHCA 3O36A 1ZBDB 3LQJA 3LJWA 4CUQA 5TDWA 4UIWA 1U6GB 4QSQA 4IC3A 1MM3A 4QEWA 2ECWA 3T6RA 4AYCA 5EU1A 5AIUA 1N72A 4LADB 5EI4A 2YT5A 5HCLA 4UI9B 4Y03A 1X0JA 1FP0A 4UYEA 4QB3A 5EPSA 5ETDA 3KNVA 5HENA 4KV4A 2JMIA 4QF3A 4CURA 4XI1A 4YYKA 4O74A 5K29A 5L98A 5C85A 1WEQA 1Z2QA 4S3OC 4L7XA 5DKCA 5HRWA 5D3HA 2G43A 2K1JA 4HBXA 1E4UA 5FDZA 2N9GA 4V3LC 2EGPA 4J0RA 4YATA 5ACYA 5EVAA 1WEMA 2VPGA 1RMDA 4NYWA 4QZSA 2L0BA 4IR4A 4CFKA 1JSPB 3O37A 2L85A 3QZVA 1V87A 5LKTA 3LRQA 4BW1A 4QSRA 4QSUA 5H9MA 3UV2A 4A9LA 5C7NA 5CUDA 5CQ6A 4TU4A 4AVXA 4O7BA 4WA6A 4TT2A 4C66A 5IBNA 4O7FA 5LKUA 2M3HA 4MEPA 4CUUA 4WZ0A 3P1CA 4A9MA 4LDFA 4A9KA 3U5PA 4YYDA 2CSYA 2RNYA 5HFRA 3O7AA 3JVJA 4O72A 4QUUA 4LYSA 3UVXA 3ONIA 5DYXA 1JM4B 4A4BA 2LQ6A 4UIUA 5ENBA 5A5NA 4GNEA 5AD2A 4QYDA 2QJ0A 2KFTA 5CQ5A 4YY6A 5FFVA 5D7XA 4Z6IA 5BT4A 5I80A 3QZSA 5A81A 4O7AA 3GL6A 3N9QA 4UYHA 5B76A 5EPBA 2CKLB 2KR4A 2L5UA 4O77A 2LXHC 5CP5A 4I7DA 3U5KA 4B86C 4GB0A 5E9LA 5CQ8A 5A5RA 2CSZA 5CPEA 3UV4A 2YELA 1HYJA 5L96A 3SHBA 2LRIC 5I1QA 4J3IA 3U5NA 2DVQA 4FLPA 1Z6UA 5FB0A 4YBTA 2NXBA 4WIVA 4QR3A 2LXPC 3I3JA 5DX4A 3DQVR 5I7YA 4YYIA 5G04B 3SVHA 5CU8A 4LZSA 5IGMA 4Q0NA 2KTBB 3GV4A 4AKNA 3TLPA 1WUMA 1WEUA 3N9NA 5AITA 5E9IA 2I50A 2E7OA 2ECNA 4O76A 5HFQA 4WHUA 4TS8A 3RPGC 2VJEA 5AMFA 4MEOA 3AQAA 2D82A 2DVRA 5I89A 1WEEA 4A0CD 4HBVA 5J0DA 3AADA 4A9JA 2RSDA 5DW1A 3SOUA 3N9MA 1WEOA 5C11A 4AUQB 4LYIA 4NYXA 5TCMA 5HRXA 1WEWA 4AYCB 3JVKA 3RTRB 5FE9A 3RCWA 2G45A 4O75A 2KWOA 3ZYUA 5CUGA 4PTBA 4NS5A 4QBMA 4W4UA 5A7CA 5FE3A 3KQIA 1X4JA 4NXJA 4C67A 2Y1NA 4TKPB 4YBMA 1VFYA 2YURA 5CZGA 5HRVA 5HQ6A 3EB5A 2Y1MA 4WZ2A 5A5SA 2YSMA 2MJVB 4PY6A 3N9OA 5G4SA 5IIDA 4N3WA 5FE4A 5DFDA 4QNSA 4WZ3B 5KH3A 5HELA 1JM7A 4LYWA 3DAIA 4J1PA 3HMHA 2JMJA 5I88A 4LZRA 3LXJA 4TT4A 3JVMA 5FBXA 5A82A 2R10A 3S92A 4YYHA 5KTWA 2VJFB 5I3LA 2DATA 4QC1A 5F1LA 4IR6A 5CQTA 5FH7A 4N4FA 2LGLA 5A5PA 5I29A 4NN2A 5KO4A 2ECGA 5DLZA 2LDRA 5HJCA 5DKDA 4OUFA 5C8GA 4OGIA 2YQLA 4KV1A 3MUKA 4TZ8A 5D1LB 5C89A 1WUGA 3T7LA 4GNGA 5IGNA 4LC2A 3KV6A 2UZGA 4TT6A 2I8NA 4A9EA 4P5OB 2DWWA 1BORA 1T1HA 5CGPA 2DVVA 5CQ4A 3UV5A 2E7NA 3MQMA 4CA1A 5FB1A 2WP2A 5F63A 5ENGA 3SVFA 2KWJA 2MD8C 4XY8A 4A9NA 2VNFA 5CTLA 5L99A 4TTEA 3QZTA 3C5KA 4AP4A 5DKAA 5DLXA 3HTKC 5L97A 2CT2A 2OO1A 1FBVA 5BT5A 4HXSA 2EA6A 2H0DA 5DYCA 5TBNA 5CRZA 4UYFA 5C87A 2KGIA 2LGVA 5LCWB 5CFWA 3L1ZB 4I7BA 1N87A 4A9OA 3MXFA 4A9FA 2VPEA 5IGKA 4NUCA 2YREA 4UIXA 5EWCA 4UP5A 4Q0OA 3LQHA 4HXLA 5LJ0A 4PCIA 3HMFA 2FUIA 2KIZA 2YHNA 3IU5A 3P1DA 4LZ2A 3PHDA 5A83A 4MVTA 4FJCA 3UVYA 1G25A 4QUTA 1VD4A 2MIQA 4UIZA 2RFJA 2G6QA 5DKHA 4B7YC 5F3AA 5TB6A 3MB4A 3O34A 4YY4A 5LKZA 4LRGA 2FUUA 4HXRA 4DONA 4IOOA 4QY4A 3ZVYA 2LN0A 4NRAA 2ECVA 5FG5A 4I7CA 4GNFA 5EWWA 5AD3A 5CY9A 2WP1A 4XUBA 5FE6A 4LLBA 5A5OA 4NRCA 2L84A 2QIZA 4YYJA 5L8UA 3HCUA 4UIVA 4BBQA 4IOQA 5I7XA 3U5LA 2RS9B 4N4HA 2JRJA 2RNXA 3D7CA 2DX8A 2L80A 3G0JA 1F62A 2MT5A 5E9MA 5DY7A 5FE0A 5FE5A 4QEVA 2K4DA 2YYNA 4NYVA 3NG2A 5E3GA 4UITA 2HYED 2IDAA 2YYRA 4MR5A 4NR8A 1WFKA 4Z1SA 2M85A 5CUEA 4A9IA 4QF2A 4MR3A 1JM7B 2MD7B 5E7DA 3SVGA 2C2VS 4QSPA 2YDWA 5F1HA 4F3IA 3ZPV1 4IORA 5F36A 2DVSA 4YADA 4MR4A 5CS8A 2MNYA 5HLSA 1VYXA 5KTUA 3HMEA 4NR9A 4CUTA 5F25A 4CLBA 4O7CA 5II1A 2M1RA 2KGGA 4R2YA 4IR3A 2NAAA 3ZNIA 4QR4A 2KU3A 3M63A 4ZQLA 2D8SA 2ECJA 5A85A 4FO9A 5DYAA 2OUOA 3UVDA 5E9VA 3V43A 2JMDA 1XWHA 2RNWA 4OGJA 1WEPA 4O64A 5HM0A 2E6SA 5LJ2A 4UP0A 4MENA 2XB1A 2H60A 1X4UA 4V3KC 3O35A 5HEMA 4O78A 4TQNA 4J0SA 2YEMA 5EPRA 5I83A 4ZC9A 3U5MA 1HYIA 5EGUA 2YUCA 3MULA 5D3PA 5D24A 5II2A 2K16A 3O70A 5EK9A 4CL9A 2F6NA 3GG3A 1Z60A 5F60A 4FIPA 4S3OB 2H0DB 4QSVA 5G0FA 3ZYQA 4UYFB 2PUYA 2M6MA 3NXBA 3IHPA 5KTXA 4HBWA 3ZTGA 4ALHA 5C4QA 5IG6A 5EA1A 2QICA 5LVQA 5EISA 5FE2A 2YQMA 5D3JA 3HCTA 4ZW1A 5CQAA 4GPJA 3UVWA 3U5JA 4CUSA 5CRMA 5I86A 1DVPA 3FL2A 4A4CA 1ZS5A 2YSJA 2DKWA 5LKXA 2OXQC 4CUPA 4QR5A 3ASLA 5DFBA 4XY9A 4C9ZA 5F62A 4BW2A 2R0VA 4XYAA 2D9EA 5E9YA 3FKMX 5ENHA 4O70A 5ENFA 4RVRA 5JI8A 5G05B 4F52B 2F6JA 2FSAA 5EWDA 5FEYA 5FE1A 4QSWA 2HDPA 5D0CA 4LR6A 2RO1A 5B77A 3IU6A 3ZVZB 5D3TA 5CQ7A 5ETBA 5LJ1A 5DYUA 1WGMA 4FK5A 2KYUA 2XEUA 4LJNA 4IR5A 1WEVA 4YYGA 2MA5A 4X3GA 4Z6HA 4A49A 4HXMA 1LDKC 5AMEA 4PPEA 5B78A 5D3NA 5ENEA 5FH6A 4YH3A 1F68A 3P1EA 2R0YA 5D1KB 4L58A 5KH9A 5F5ZA 5CUBA 4R8PK 4UYDA 5FG6A 5KU3A 4MR6A 5FG4A 5EQ1A 3M99A 4NQMA 5D1MB 2R0SA 1K2FA 4BHWA 3SOXA 5DBMA 3VK6A 5ENIA 4YK0A 4IC2A 5E0RA 5EM3A 5G4RA 2VJEB 4XUAA 2ECTA 3N9PA 3PUQA 5I40A 4NUDA 2KE1A 5KH7A 5DFCA 4CCGX 5CUAA 2VJFA 4PKLA 3L11A 4A9HA 1WE9A 4HXOA 4HXKA 4Z1QA 5FFYA 2G4AA 2ZETC 3JVLA 5FFWA 4Q6FA 2YEKA 2VPBA 2KREA 4NUEA 3K2JA 4HBYA 4UIYA 5E73A 5BT3A 4ALGA 3MB3A 3RPGB 5JG6A 5E74A 5HQ7A 4BW4A 2E6RA 5DINA 2YW5A 4BW3A 5H1UA 4N4IA 5LUUA 3DPLR 5E3DA 1WILA 4QC3A 2YHOA 2YQDA 5EV9A 3N9LA 4LKAA 3ZPVE 2PNXA 4TYLA 3EB6A 5D3SA 2BAYA 5FERA 4PCEA 2I7KA 5KHMA 2Y43A 3KV5A 1EQFA 2OSSA 2LSPB 1WIMA 5IGLA 5HQ5A 3O33A 3DWYA 4HXNA 1JOCA 4E96A 4R7EA 4PS5A 5D26A 3U5OA 2LV9A 4QSSA 5D3RA 2MA6A 3PURA 5EYAF 4NQNA 4YAXA 2KWNA 2LGGA 3M62A 5EWHA 2K17A 4X2IA 4YH4A 4UYGA 5H85A 4NR5A 3MHHA 2L43A 2YW8A 4NRBA 5EICA 5A5QA 1LDJB 2L5EA 5COIA 2GRCA 5CQ3A 5ENJA 2KWKA 5C13A 4YYNA 5B8DA 5FH8A 4Z93A 2AN6A 2ECIA 5D25A 2C2LA 2EODA 4LK9A 5J3XA 4CFLA 4KCXA 5TRBA 5CUCA 3UW9A 3HCSA 4MSXA 4GNDA 4YC9A 2CKLA 3P1FA 4WHWA 1X4IA 3P5OA 5FE7A 4YYMA 4YBSA 4ZDTA 4YABA 4BJXA 5F2PA 3SOWA 5LVRA 4NR6A 4QSTA 4NR4A 3C6WA 2YU4A 2VPDA 5B79A 2MNZA 5FE8A 5F61A 2RI7A 5E9KA 5H1VA 4QSXA 3MHSA 4ZUXU 2MUMA 5D3LA 4TU6A 4QEUA 3G0LA 5B75A 4HXPA 5EP7A 5ENCA 3S91A 1IYMA 3Q2FA 1WESA 3I2DA 4NR7A 3L1XA 5EWVA 5TDRA 1E6IA 4O71A 2VP7A 5DW2A 5JWMA 4N4GA 2LGKA 2E3KA 3LQIA 4O7EA 4TZ2A 5H1TA 2F42A 3Q2EA 4MEQA 5L8TA 1MM2A 5TABA 4QYLA 1WENA 2L75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHC A;  3O36 A;  1ZBD B;  3LQJ A;  3LJW A;  4CUQ A;  5TDW A;  4UIW A;  1U6G B;  4QSQ A;  4IC3 A;  1MM3 A;  4QEW A;  2ECW A;  3T6R A;  4AYC A;  5EU1 A;  5AIU A;  1N72 A;  4LAD B;  5EI4 A;  2YT5 A;  5HCL A;  4UI9 B;  4Y03 A;  1X0J A;  1FP0 A;  4UYE A;  4QB3 A;  5EPS A;  5ETD A;  3KNV A;  5HEN A;  4KV4 A;  2JMI A;  4QF3 A;  4CUR A;  4XI1 A;  4YYK A;  4O74 A;  5K29 A;  5L98 A;  5C85 A;  1WEQ A;  1Z2Q A;  4S3O C;  4L7X A;  5DKC A;  5HRW A;  5D3H A;  2G43 A;  2K1J A;  4HBX A;  1E4U A;  5FDZ A;  2N9G A;  4V3L C;  2EGP A;  4J0R A;  4YAT A;  5ACY A;  5EVA A;  1WEM A;  2VPG A;  1RMD A;  4NYW A;  4QZS A;  2L0B A;  4IR4 A;  4CFK A;  1JSP B;  3O37 A;  2L85 A;  3QZV A;  1V87 A;  5LKT A;  3LRQ A;  4BW1 A;  4QSR A;  4QSU A;  5H9M A;  3UV2 A;  4A9L A;  5C7N A;  5CUD A;  5CQ6 A;  4TU4 A;  4AVX A;  4O7B A;  4WA6 A;  4TT2 A;  4C66 A;  5IBN A;  4O7F A;  5LKU A;  2M3H A;  4MEP A;  4CUU A;  4WZ0 A;  3P1C A;  4A9M A;  4LDF A;  4A9K A;  3U5P A;  4YYD A;  2CSY A;  2RNY A;  5HFR A;  3O7A A;  3JVJ A;  4O72 A;  4QUU A;  4LYS A;  3UVX A;  3ONI A;  5DYX A;  1JM4 B;  4A4B A;  2LQ6 A;  4UIU A;  5ENB A;  5A5N A;  4GNE A;  5AD2 A;  4QYD A;  2QJ0 A;  2KFT A;  5CQ5 A;  4YY6 A;  5FFV A;  5D7X A;  4Z6I A;  5BT4 A;  5I80 A;  3QZS A;  5A81 A;  4O7A A;  3GL6 A;  3N9Q A;  4UYH A;  5B76 A;  5EPB A;  2CKL B;  2KR4 A;  2L5U A;  4O77 A;  2LXH C;  5CP5 A;  4I7D A;  3U5K A;  4B86 C;  4GB0 A;  5E9L A;  5CQ8 A;  5A5R A;  2CSZ A;  5CPE A;  3UV4 A;  2YEL A;  1HYJ A;  5L96 A;  3SHB A;  2LRI C;  5I1Q A;  4J3I A;  3U5N A;  2DVQ A;  4FLP A;  1Z6U A;  5FB0 A;  4YBT A;  2NXB A;  4WIV A;  4QR3 A;  2LXP C;  3I3J A;  5DX4 A;  3DQV R;  5I7Y A;  4YYI A;  5G04 B;  3SVH A;  5CU8 A;  4LZS A;  5IGM A;  4Q0N A;  2KTB B;  3GV4 A;  4AKN A;  3TLP A;  1WUM A;  1WEU A;  3N9N A;  5AIT A;  5E9I A;  2I50 A;  2E7O A;  2ECN A;  4O76 A;  5HFQ A;  4WHU A;  4TS8 A;  3RPG C;  2VJE A;  5AMF A;  4MEO A;  3AQA A;  2D82 A;  2DVR A;  5I89 A;  1WEE A;  4A0C D;  4HBV A;  5J0D A;  3AAD A;  4A9J A;  2RSD A;  5DW1 A;  3SOU A;  3N9M A;  1WEO A;  5C11 A;  4AUQ B;  4LYI A;  4NYX A;  5TCM A;  5HRX A;  1WEW A;  4AYC B;  3JVK A;  3RTR B;  5FE9 A;  3RCW A;  2G45 A;  4O75 A;  2KWO A;  3ZYU A;  5CUG A;  4PTB A;  4NS5 A;  4QBM A;  4W4U A;  5A7C A;  5FE3 A;  3KQI A;  1X4J A;  4NXJ A;  4C67 A;  2Y1N A;  4TKP B;  4YBM A;  1VFY A;  2YUR A;  5CZG A;  5HRV A;  5HQ6 A;  3EB5 A;  2Y1M A;  4WZ2 A;  5A5S A;  2YSM A;  2MJV B;  4PY6 A;  3N9O A;  5G4S A;  5IID A;  4N3W A;  5FE4 A;  5DFD A;  4QNS A;  4WZ3 B;  5KH3 A;  5HEL A;  1JM7 A;  4LYW A;  3DAI A;  4J1P A;  3HMH A;  2JMJ A;  5I88 A;  4LZR A;  3LXJ A;  4TT4 A;  3JVM A;  5FBX A;  5A82 A;  2R10 A;  3S92 A;  4YYH A;  5KTW A;  2VJF B;  5I3L A;  2DAT A;  4QC1 A;  5F1L A;  4IR6 A;  5CQT A;  5FH7 A;  4N4F A;  2LGL A;  5A5P A;  5I29 A;  4NN2 A;  5KO4 A;  2ECG A;  5DLZ A;  2LDR A;  5HJC A;  5DKD A;  4OUF A;  5C8G A;  4OGI A;  2YQL A;  4KV1 A;  3MUK A;  4TZ8 A;  5D1L B;  5C89 A;  1WUG A;  3T7L A;  4GNG A;  5IGN A;  4LC2 A;  3KV6 A;  2UZG A;  4TT6 A;  2I8N A;  4A9E A;  4P5O B;  2DWW A;  1BOR A;  1T1H A;  5CGP A;  2DVV A;  5CQ4 A;  3UV5 A;  2E7N A;  3MQM A;  4CA1 A;  5FB1 A;  2WP2 A;  5F63 A;  5ENG A;  3SVF A;  2KWJ A;  2MD8 C;  4XY8 A;  4A9N A;  2VNF A;  5CTL A;  5L99 A;  4TTE A;  3QZT A;  3C5K A;  4AP4 A;  5DKA A;  5DLX A;  3HTK C;  5L97 A;  2CT2 A;  2OO1 A;  1FBV A;  5BT5 A;  4HXS A;  2EA6 A;  2H0D A;  5DYC A;  5TBN A;  5CRZ A;  4UYF A;  5C87 A;  2KGI A;  2LGV A;  5LCW B;  5CFW A;  3L1Z B;  4I7B A;  1N87 A;  4A9O A;  3MXF A;  4A9F A;  2VPE A;  5IGK A;  4NUC A;  2YRE A;  4UIX A;  5EWC A;  4UP5 A;  4Q0O A;  3LQH A;  4HXL A;  5LJ0 A;  4PCI A;  3HMF A;  2FUI A;  2KIZ A;  2YHN A;  3IU5 A;  3P1D A;  4LZ2 A;  3PHD A;  5A83 A;  4MVT A;  4FJC A;  3UVY A;  1G25 A;  4QUT A;  1VD4 A;  2MIQ A;  4UIZ A;  2RFJ A;  2G6Q A;  5DKH A;  4B7Y C;  5F3A A;  5TB6 A;  3MB4 A;  3O34 A;  4YY4 A;  5LKZ A;  4LRG A;  2FUU A;  4HXR A;  4DON A;  4IOO A;  4QY4 A;  3ZVY A;  2LN0 A;  4NRA A;  2ECV A;  5FG5 A;  4I7C A;  4GNF A;  5EWW A;  5AD3 A;  5CY9 A;  2WP1 A;  4XUB A;  5FE6 A;  4LLB A;  5A5O A;  4NRC A;  2L84 A;  2QIZ A;  4YYJ A;  5L8U A;  3HCU A;  4UIV A;  4BBQ A;  4IOQ A;  5I7X A;  3U5L A;  2RS9 B;  4N4H A;  2JRJ A;  2RNX A;  3D7C A;  2DX8 A;  2L80 A;  3G0J A;  1F62 A;  2MT5 A;  5E9M A;  5DY7 A;  5FE0 A;  5FE5 A;  4QEV A;  2K4D A;  2YYN A;  4NYV A;  3NG2 A;  5E3G A;  4UIT A;  2HYE D;  2IDA A;  2YYR A;  4MR5 A;  4NR8 A;  1WFK A;  4Z1S A;  2M85 A;  5CUE A;  4A9I A;  4QF2 A;  4MR3 A;  1JM7 B;  2MD7 B;  5E7D A;  3SVG A;  2C2V S;  4QSP A;  2YDW A;  5F1H A;  4F3I A;  3ZPV 1;  4IOR A;  5F36 A;  2DVS A;  4YAD A;  4MR4 A;  5CS8 A;  2MNY A;  5HLS A;  1VYX A;  5KTU A;  3HME A;  4NR9 A;  4CUT A;  5F25 A;  4CLB A;  4O7C A;  5II1 A;  2M1R A;  2KGG A;  4R2Y A;  4IR3 A;  2NAA A;  3ZNI A;  4QR4 A;  2KU3 A;  3M63 A;  4ZQL A;  2D8S A;  2ECJ A;  5A85 A;  4FO9 A;  5DYA A;  2OUO A;  3UVD A;  5E9V A;  3V43 A;  2JMD A;  1XWH A;  2RNW A;  4OGJ A;  1WEP A;  4O64 A;  5HM0 A;  2E6S A;  5LJ2 A;  4UP0 A;  4MEN A;  2XB1 A;  2H60 A;  1X4U A;  4V3K C;  3O35 A;  5HEM A;  4O78 A;  4TQN A;  4J0S A;  2YEM A;  5EPR A;  5I83 A;  4ZC9 A;  3U5M A;  1HYI A;  5EGU A;  2YUC A;  3MUL A;  5D3P A;  5D24 A;  5II2 A;  2K16 A;  3O70 A;  5EK9 A;  4CL9 A;  2F6N A;  3GG3 A;  1Z60 A;  5F60 A;  4FIP A;  4S3O B;  2H0D B;  4QSV A;  5G0F A;  3ZYQ A;  4UYF B;  2PUY A;  2M6M A;  3NXB A;  3IHP A;  5KTX A;  4HBW A;  3ZTG A;  4ALH A;  5C4Q A;  5IG6 A;  5EA1 A;  2QIC A;  5LVQ A;  5EIS A;  5FE2 A;  2YQM A;  5D3J A;  3HCT A;  4ZW1 A;  5CQA A;  4GPJ A;  3UVW A;  3U5J A;  4CUS A;  5CRM A;  5I86 A;  1DVP A;  3FL2 A;  4A4C A;  1ZS5 A;  2YSJ A;  2DKW A;  5LKX A;  2OXQ C;  4CUP A;  4QR5 A;  3ASL A;  5DFB A;  4XY9 A;  4C9Z A;  5F62 A;  4BW2 A;  2R0V A;  4XYA A;  2D9E A;  5E9Y A;  3FKM X;  5ENH A;  4O70 A;  5ENF A;  4RVR A;  5JI8 A;  5G05 B;  4F52 B;  2F6J A;  2FSA A;  5EWD A;  5FEY A;  5FE1 A;  4QSW A;  2HDP A;  5D0C A;  4LR6 A;  2RO1 A;  5B77 A;  3IU6 A;  3ZVZ B;  5D3T A;  5CQ7 A;  5ETB A;  5LJ1 A;  5DYU A;  1WGM A;  4FK5 A;  2KYU A;  2XEU A;  4LJN A;  4IR5 A;  1WEV A;  4YYG A;  2MA5 A;  4X3G A;  4Z6H A;  4A49 A;  4HXM A;  1LDK C;  5AME A;  4PPE A;  5B78 A;  5D3N A;  5ENE A;  5FH6 A;  4YH3 A;  1F68 A;  3P1E A;  2R0Y A;  5D1K B;  4L58 A;  5KH9 A;  5F5Z A;  5CUB A;  4R8P K;  4UYD A;  5FG6 A;  5KU3 A;  4MR6 A;  5FG4 A;  5EQ1 A;  3M99 A;  4NQM A;  5D1M B;  2R0S A;  1K2F A;  4BHW A;  3SOX A;  5DBM A;  3VK6 A;  5ENI A;  4YK0 A;  4IC2 A;  5E0R A;  5EM3 A;  5G4R A;  2VJE B;  4XUA A;  2ECT A;  3N9P A;  3PUQ A;  5I40 A;  4NUD A;  2KE1 A;  5KH7 A;  5DFC A;  4CCG X;  5CUA A;  2VJF A;  4PKL A;  3L11 A;  4A9H A;  1WE9 A;  4HXO A;  4HXK A;  4Z1Q A;  5FFY A;  2G4A A;  2ZET C;  3JVL A;  5FFW A;  4Q6F A;  2YEK A;  2VPB A;  2KRE A;  4NUE A;  3K2J A;  4HBY A;  4UIY A;  5E73 A;  5BT3 A;  4ALG A;  3MB3 A;  3RPG B;  5JG6 A;  5E74 A;  5HQ7 A;  4BW4 A;  2E6R A;  5DIN A;  2YW5 A;  4BW3 A;  5H1U A;  4N4I A;  5LUU A;  3DPL R;  5E3D A;  1WIL A;  4QC3 A;  2YHO A;  2YQD A;  5EV9 A;  3N9L A;  4LKA A;  3ZPV E;  2PNX A;  4TYL A;  3EB6 A;  5D3S A;  2BAY A;  5FER A;  4PCE A;  2I7K A;  5KHM A;  2Y43 A;  3KV5 A;  1EQF A;  2OSS A;  2LSP B;  1WIM A;  5IGL A;  5HQ5 A;  3O33 A;  3DWY A;  4HXN A;  1JOC A;  4E96 A;  4R7E A;  4PS5 A;  5D26 A;  3U5O A;  2LV9 A;  4QSS A;  5D3R A;  2MA6 A;  3PUR A;  5EYA F;  4NQN A;  4YAX A;  2KWN A;  2LGG A;  3M62 A;  5EWH A;  2K17 A;  4X2I A;  4YH4 A;  4UYG A;  5H85 A;  4NR5 A;  3MHH A;  2L43 A;  2YW8 A;  4NRB A;  5EIC A;  5A5Q A;  1LDJ B;  2L5E A;  5COI A;  2GRC A;  5CQ3 A;  5ENJ A;  2KWK A;  5C13 A;  4YYN A;  5B8D A;  5FH8 A;  4Z93 A;  2AN6 A;  2ECI A;  5D25 A;  2C2L A;  2EOD A;  4LK9 A;  5J3X A;  4CFL A;  4KCX A;  5TRB A;  5CUC A;  3UW9 A;  3HCS A;  4MSX A;  4GND A;  4YC9 A;  2CKL A;  3P1F A;  4WHW A;  1X4I A;  3P5O A;  5FE7 A;  4YYM A;  4YBS A;  4ZDT A;  4YAB A;  4BJX A;  5F2P A;  3SOW A;  5LVR A;  4NR6 A;  4QST A;  4NR4 A;  3C6W A;  2YU4 A;  2VPD A;  5B79 A;  2MNZ A;  5FE8 A;  5F61 A;  2RI7 A;  5E9K A;  5H1V A;  4QSX A;  3MHS A;  4ZUX U;  2MUM A;  5D3L A;  4TU6 A;  4QEU A;  3G0L A;  5B75 A;  4HXP A;  5EP7 A;  5ENC A;  3S91 A;  1IYM A;  3Q2F A;  1WES A;  3I2D A;  4NR7 A;  3L1X A;  5EWV A;  5TDR A;  1E6I A;  4O71 A;  2VP7 A;  5DW2 A;  5JWM A;  4N4G A;  2LGK A;  2E3K A;  3LQI A;  4O7E A;  4TZ2 A;  5H1T A;  2F42 A;  3Q2E A;  4MEQ A;  5L8T A;  1MM2 A;  5TAB A;  4QYL A;  1WEN A;  2L75 A; 
#chains in the Genus database with same CATH topology
 2L7P A;  1CHC A;  3O36 A;  1ZBD B;  3LQJ A;  3LJW A;  4CUQ A;  3H7H A;  5TDW A;  4UIW A;  1U6G B;  4QSQ A;  2DJA A;  4IC3 A;  1MM3 A;  3VKG A;  4QEW A;  2ECW A;  3T6R A;  4AYC A;  5EU1 A;  2EXU A;  5AIU A;  1N72 A;  4LAD B;  5EI4 A;  2YT5 A;  5HCL A;  4UI9 B;  4Y03 A;  1X0J A;  1FP0 A;  4UYE A;  4QB3 A;  5EPS A;  5ETD A;  3KNV A;  5HEN A;  2YVR A;  2KKY A;  4KV4 A;  2JMI A;  4QF3 A;  4CUR A;  4XI1 A;  4YYK A;  4O74 A;  5K29 A;  5L98 A;  5C85 A;  1MBM A;  1WEQ A;  1Z2Q A;  4S3O C;  4L7X A;  5DKC A;  5HRW A;  5D3H A;  2G43 A;  2K1J A;  4HBX A;  1E4U A;  5FDZ A;  2N9G A;  4V3L C;  2EGP A;  4J0R A;  4YAT A;  5ACY A;  5EVA A;  1WEM A;  2VPG A;  1RMD A;  4NYW A;  4QZS A;  2L0B A;  4IR4 A;  4CFK A;  2EJN A;  3FAN A;  1JSP B;  3O37 A;  2L85 A;  3QZV A;  1V87 A;  5LKT A;  3LRQ A;  4BW1 A;  4QSR A;  4QSU A;  5H9M A;  3UV2 A;  4A9L A;  5C7N A;  5CUD A;  2FFW A;  5CQ6 A;  4TU4 A;  4AVX A;  4O7B A;  4WA6 A;  4TT2 A;  2CSV A;  4C66 A;  5IBN A;  4O7F A;  5LKU A;  2M3H A;  4MEP A;  4CUU A;  4WZ0 A;  3P1C A;  4A9M A;  4LDF A;  4A9K A;  3U5P A;  4YYD A;  2CSY A;  2RNY A;  5HFR A;  3O7A A;  3JVJ A;  4O72 A;  4QUU A;  4LYS A;  3UVX A;  3ONI A;  5DYX A;  1JM4 B;  4A4B A;  2LQ6 A;  4UIU A;  5ENB A;  5A5N A;  4GNE A;  5AD2 A;  4QYD A;  2QJ0 A;  2KFT A;  5CQ5 A;  4YY6 A;  5FFV A;  5D7X A;  4Z6I A;  5BT4 A;  5I80 A;  3QZS A;  5A81 A;  4O7A A;  3GL6 A;  3N9Q A;  4UYH A;  5B76 A;  5EPB A;  2CKL B;  2KR4 A;  2L5U A;  4O77 A;  2LXH C;  5CP5 A;  3LJU X;  3U5K A;  4I7D A;  4B86 C;  4Z0O A;  4GB0 A;  5E9L A;  5CQ8 A;  5A5R A;  2CSZ A;  5CPE A;  3UV4 A;  2YEL A;  1HYJ A;  5L96 A;  3SHB A;  2LRI C;  5I1Q A;  4J3I A;  3U5N A;  2DVQ A;  4FLP A;  1Z6U A;  2EGM A;  5FB0 A;  4YBT A;  2NXB A;  4WIV A;  4QR3 A;  2LXP C;  3I3J A;  5DX4 A;  3DQV R;  5I7Y A;  4YYI A;  5G04 B;  3SVH A;  5CU8 A;  3PLW A;  4LZS A;  5IGM A;  3ERR A;  4Q0N A;  2KTB B;  3GV4 A;  3M7K A;  4AKN A;  3TLP A;  1WUM A;  1WEU A;  3N9N A;  5AIT A;  5E9I A;  2I50 A;  2E7O A;  2ECN A;  4O76 A;  5HFQ A;  4WHU A;  4TS8 A;  4O62 A;  3RPG C;  2VJE A;  5AMF A;  4MEO A;  2IQJ A;  3AQA A;  2D82 A;  2DVR A;  5I89 A;  1WEE A;  4A0C D;  4HBV A;  5J0D A;  3AAD A;  4A9J A;  2RSD A;  5DW1 A;  3SOU A;  3N9M A;  1WEO A;  3LVR E;  5C11 A;  4AUQ B;  4LYI A;  4NYX A;  2XOY A;  5TCM A;  5HRX A;  1WEW A;  4AYC B;  3JVK A;  3RTR B;  5FE9 A;  3RCW A;  2G45 A;  4O75 A;  2KWO A;  3ZYU A;  5CUG A;  4PTB A;  4NS5 A;  4QBM A;  4W4U A;  5A7C A;  4AKI A;  5FE3 A;  3KQI A;  1X4J A;  4NXJ A;  4C67 A;  2XOC A;  2Y1N A;  4TKP B;  4YBM A;  1VFY A;  2YUR A;  5CZG A;  5HRV A;  5HQ6 A;  3EB5 A;  2Y1M A;  4WZ2 A;  5A5S A;  2YSM A;  2MJV B;  3DWD A;  4PY6 A;  3N9O A;  5G4S A;  5IID A;  4N3W A;  5FE4 A;  5DFD A;  4QNS A;  4WZ3 B;  5KH3 A;  1PUO A;  5HEL A;  1JM7 A;  4LYW A;  3DAI A;  4J1P A;  3HMH A;  2JMJ A;  5I88 A;  4LZR A;  3LXJ A;  4TT4 A;  3JVM A;  5FBX A;  5A82 A;  2R10 A;  3S92 A;  4YYH A;  5KTW A;  2VJF B;  5I3L A;  2DAT A;  4QC1 A;  5F1L A;  4IR6 A;  5CQT A;  5FH7 A;  4N4F A;  2LGL A;  5A5P A;  5I29 A;  4NN2 A;  5KO4 A;  2ECG A;  5DLZ A;  2LDR A;  5HJC A;  4QQ4 A;  5DKD A;  4OUF A;  5C8G A;  4OGI A;  2YQL A;  4KV1 A;  3MUK A;  4TZ8 A;  5D1L B;  5C89 A;  1WUG A;  3T7L A;  4GNG A;  5IGN A;  4LC2 A;  3KV6 A;  2UZG A;  4TT6 A;  2I8N A;  4A9E A;  5SVI A;  4P5O B;  2DWW A;  1BOR A;  1T1H A;  5CGP A;  5SVX A;  2DVV A;  5CQ4 A;  3UV5 A;  2E7N A;  3MQM A;  4CA1 A;  5FB1 A;  2WP2 A;  5F63 A;  5ENG A;  3SVF A;  2KWJ A;  2MD8 C;  4XY8 A;  4A9N A;  2VNF A;  5CTL A;  5L99 A;  4TTE A;  3QZT A;  3C5K A;  4AP4 A;  5DKA A;  5DLX A;  3HTK C;  5L97 A;  2CT2 A;  2OO1 A;  1FBV A;  5BT5 A;  4HXS A;  2EA6 A;  2H0D A;  5DYC A;  5TBN A;  5CRZ A;  4UYF A;  5C87 A;  2KGI A;  2LGV A;  5LCW B;  2CON A;  5CFW A;  3L1Z B;  4I7B A;  1N87 A;  4A9O A;  3MXF A;  4A9F A;  2VPE A;  5IGK A;  4NUC A;  2YRE A;  4UIX A;  5EWC A;  4UP5 A;  4Q0O A;  3LQH A;  4HXL A;  5LJ0 A;  4PCI A;  3HMF A;  2FUI A;  2KIZ A;  2YHN A;  3IU5 A;  3P1D A;  4LZ2 A;  3PHD A;  5A83 A;  4MVT A;  4FJC A;  3UVY A;  3Q1D A;  4QUT A;  1VD4 A;  3LVQ E;  2MIQ A;  1G25 A;  4UIZ A;  2RFJ A;  2G6Q A;  5DKH A;  2OWA A;  4B7Y C;  5F3A A;  5TB6 A;  2XOZ A;  3MB4 A;  3O34 A;  4YY4 A;  5LKZ A;  4LRG A;  2FUU A;  4HXR A;  4DON A;  4IOO A;  4QY4 A;  3ZVY A;  2LN0 A;  4NRA A;  2ECV A;  5FG5 A;  4I7C A;  4GNF A;  5EWW A;  5AD3 A;  5CY9 A;  2WP1 A;  4XUB A;  5FE6 A;  4LLB A;  5A5O A;  4NRC A;  2L84 A;  2QIZ A;  4YYJ A;  5L8U A;  3HCU A;  4UIV A;  4BBQ A;  4IOQ A;  5I7X A;  3U5L A;  2JM3 A;  2RS9 B;  3DDT A;  4N4H A;  2JRJ A;  2RNX A;  3D7C A;  2DX8 A;  2L80 A;  3G0J A;  1F62 A;  2MT5 A;  5E9M A;  5DY7 A;  5FE0 A;  5FE5 A;  4QEV A;  2K4D A;  2YYN A;  4NYV A;  3NG2 A;  5E3G A;  4F1P A;  4UIT A;  2HYE D;  2IDA A;  2YYR A;  4MR5 A;  4NR8 A;  1WFK A;  4Z1S A;  2M85 A;  5CUE A;  4A9I A;  4QF2 A;  4MR3 A;  3T9K A;  1JM7 B;  2MD7 B;  5E7D A;  3SVG A;  2C2V S;  4QSP A;  2YDW A;  5F1H A;  4F3I A;  3ZPV 1;  4IOR A;  5F36 A;  2DVS A;  4YAD A;  4MR4 A;  5CS8 A;  2MNY A;  5HLS A;  1VYX A;  5KTU A;  3HME A;  4NR9 A;  4CUT A;  3D1D A;  5F25 A;  4CLB A;  4O7C A;  5II1 A;  2M1R A;  3FAO A;  2KGG A;  4R2Y A;  4IR3 A;  2NAA A;  3ZNI A;  4QR4 A;  2KU3 A;  3M63 A;  4ZQL A;  2D8S A;  4OGC A;  2ECJ A;  5A85 A;  4FO9 A;  5DYA A;  2OUO A;  3D1B A;  5E9V A;  3UVD A;  3V43 A;  2JMD A;  1XWH A;  2RNW A;  4OGJ A;  1WEP A;  4O64 A;  5HM0 A;  2E6S A;  5LJ2 A;  2CRW A;  4MEN A;  4UP0 A;  5SVI B;  2XB1 A;  2H60 A;  1X4U A;  4V3K C;  3O35 A;  5HEM A;  4O78 A;  4TQN A;  4J0S A;  2YEM A;  5EPR A;  5I83 A;  4ZC9 A;  3U5M A;  1HYI A;  5EGU A;  4H9D A;  2YUC A;  3MUL A;  5D3P A;  5D24 A;  5II2 A;  2M13 A;  2K16 A;  3O70 A;  5EK9 A;  4CL9 A;  4AI6 A;  2F6N A;  3GG3 A;  1Z60 A;  5F60 A;  4FIP A;  4S3O B;  2H0D B;  4QSV A;  3VKH A;  5G0F A;  3ZYQ A;  4UYF B;  2PUY A;  2M6M A;  3NXB A;  3IHP A;  5KTX A;  4HBW A;  3ZTG A;  4ALH A;  5C4Q A;  5IG6 A;  5EA1 A;  2QIC A;  5LVQ A;  5EIS A;  5FE2 A;  2YQM A;  5D3J A;  3HCT A;  4ZW1 A;  5CQA A;  4GPJ A;  4Z0R A;  3UVW A;  3U5J A;  4CUS A;  5CRM A;  5I86 A;  1DVP A;  3FL2 A;  4A4C A;  1ZS5 A;  2YSJ A;  2DKW A;  5LKX A;  2DSM A;  2OXQ C;  4CUP A;  4QR5 A;  3ASL A;  5DFB A;  4XY9 A;  4C9Z A;  5F62 A;  4BW2 A;  2R0V A;  4XYA A;  2D9E A;  5E9Y A;  3FKM X;  5ENH A;  4O70 A;  5ENF A;  4RVR A;  5JI8 A;  5G05 B;  4F52 B;  2F6J A;  2FSA A;  5EWD A;  5FEY A;  5FE1 A;  4QSW A;  2HDP A;  5D0C A;  4LR6 A;  2RO1 A;  5B77 A;  3IU6 A;  3ZVZ B;  5D3T A;  5CQ7 A;  5ETB A;  5LJ1 A;  5DYU A;  1WGM A;  4FK5 A;  4OGE A;  2KYU A;  2XEU A;  2D8U A;  4LJN A;  4IR5 A;  5SVY A;  1WEV A;  4YYG A;  2MA5 A;  4X3G A;  4Z6H A;  4A49 A;  4HXM A;  1LDK C;  5AME A;  4PPE A;  5B78 A;  5D3N A;  5ENE A;  5FH6 A;  4YH3 A;  1F68 A;  3P1E A;  2R0Y A;  5D1K B;  4L58 A;  5KH9 A;  5F5Z A;  5CUB A;  4R8P K;  4UYD A;  5FG6 A;  5KU3 A;  4MR6 A;  5FG4 A;  5EQ1 A;  3M99 A;  4NQM A;  5D1M B;  2R0S A;  3FEH A;  1K2F A;  4BHW A;  3SOX A;  5DBM A;  3VK6 A;  5ENI A;  4YK0 A;  4IC2 A;  5E0R A;  5EM3 A;  5G4R A;  2VJE B;  4XUA A;  2ECT A;  3N9P A;  4AKH A;  3PUQ A;  5I40 A;  4NUD A;  2KE1 A;  5KH7 A;  3LDY A;  5DFC A;  4CCG X;  5CUA A;  2VJF A;  4PKL A;  3L11 A;  2LAU A;  4A9H A;  1WE9 A;  4HXO A;  4HXK A;  3SUB A;  4Z1Q A;  5FFY A;  2G4A A;  2ZET C;  3JVL A;  5FFW A;  4Q6F A;  2YEK A;  2VPB A;  3KDE C;  2KRE A;  4NUE A;  3K2J A;  4HBY A;  4UIY A;  5E73 A;  5BT3 A;  4ALG A;  3MB3 A;  3RPG B;  5JG6 A;  5E74 A;  5HQ7 A;  4BW4 A;  2E6R A;  5DIN A;  2YW5 A;  4BW3 A;  5H1U A;  4N4I A;  5LUU A;  3DPL R;  5E3D A;  1WIL A;  4QC3 A;  2YHO A;  2YQD A;  5EV9 A;  3N9L A;  4LKA A;  3ZPV E;  2PNX A;  4TYL A;  3EB6 A;  5D3S A;  2BAY A;  2JUN A;  5FER A;  4PCE A;  2I7K A;  5KHM A;  2Y43 A;  3KV5 A;  1EQF A;  2OSS A;  2LSP B;  3JUE A;  1WIM A;  5IGL A;  5HQ5 A;  2XP0 A;  3E2D A;  4AKG A;  3O33 A;  3DWY A;  4HXN A;  1JOC A;  4E96 A;  4R7E A;  4PS5 A;  5D26 A;  3U5O A;  2LV9 A;  4QSS A;  5D3R A;  2E61 A;  2MA6 A;  3PUR A;  5EYA F;  4NQN A;  4YAX A;  2KWN A;  2LGG A;  3MDB C;  3M62 A;  5EWH A;  2K17 A;  4X2I A;  4YH4 A;  4UYG A;  5H85 A;  4NR5 A;  3MHH A;  2L43 A;  2YW8 A;  1ZKR A;  4NRB A;  5EIC A;  5A5Q A;  3FJU B;  2P57 A;  1LDJ B;  2L5E A;  5COI A;  2GRC A;  5CQ3 A;  5ENJ A;  2KWK A;  5K3Q A;  4YYN A;  5C13 A;  5B8D A;  5FH8 A;  4Z93 A;  2AN6 A;  2ECI A;  5D25 A;  2C2L A;  2EOD A;  4LK9 A;  5J3X A;  4CFL A;  4KCX A;  5TRB A;  5CUC A;  3UW9 A;  3HCS A;  1DCQ A;  4MSX A;  4GND A;  4YC9 A;  2CKL A;  3P1F A;  4WHW A;  1X4I A;  3FM8 C;  3P5O A;  5FE7 A;  4YYM A;  3O47 A;  4YBS A;  2CRR A;  4ZDT A;  4YAB A;  4BJX A;  5F2P A;  3SOW A;  5LVR A;  4NR6 A;  4QST A;  4NR4 A;  3C6W A;  2YU4 A;  2VPD A;  5B79 A;  2FD4 A;  2MNZ A;  5FE8 A;  5F61 A;  2RR4 A;  2RI7 A;  5E9K A;  5H1V A;  4QSX A;  3MHS A;  4ZUX U;  2MUM A;  5D3L A;  4TU6 A;  4QEU A;  3G0L A;  5B75 A;  4HXP A;  5EP7 A;  5ENC A;  2KKX A;  3S91 A;  1IYM A;  3Q2F A;  1WES A;  3I2D A;  4NR7 A;  2MKE A;  5EWV A;  3L1X A;  5TDR A;  1E6I A;  4O71 A;  2VP7 A;  5DW2 A;  5JWM A;  4N4G A;  2LGK A;  2E3K A;  3LQI A;  4O7E A;  4TZ2 A;  5H1T A;  2B0O E;  2F42 A;  3Q2E A;  4MEQ A;  5L8T A;  1MM2 A;  5TAB A;  4QYL A;  1WEN A;  2L75 A; 
#chains in the Genus database with same CATH homology
 1CHC A;  3O36 A;  1ZBD B;  3LQJ A;  3LJW A;  4CUQ A;  5TDW A;  4UIW A;  1U6G B;  4QSQ A;  4IC3 A;  1MM3 A;  4QEW A;  2ECW A;  3T6R A;  4AYC A;  5EU1 A;  5AIU A;  1N72 A;  4LAD B;  5EI4 A;  2YT5 A;  5HCL A;  4UI9 B;  4Y03 A;  1X0J A;  1FP0 A;  4UYE A;  4QB3 A;  5EPS A;  5ETD A;  3KNV A;  5HEN A;  4KV4 A;  2JMI A;  4QF3 A;  4CUR A;  4XI1 A;  4YYK A;  4O74 A;  5K29 A;  5L98 A;  5C85 A;  1WEQ A;  1Z2Q A;  4S3O C;  4L7X A;  5DKC A;  5HRW A;  5D3H A;  2G43 A;  2K1J A;  4HBX A;  1E4U A;  5FDZ A;  2N9G A;  4V3L C;  2EGP A;  4J0R A;  4YAT A;  5ACY A;  5EVA A;  1WEM A;  2VPG A;  1RMD A;  4NYW A;  4QZS A;  2L0B A;  4IR4 A;  4CFK A;  1JSP B;  3O37 A;  2L85 A;  3QZV A;  1V87 A;  5LKT A;  3LRQ A;  4BW1 A;  4QSR A;  4QSU A;  5H9M A;  3UV2 A;  4A9L A;  5C7N A;  5CUD A;  5CQ6 A;  4TU4 A;  4AVX A;  4O7B A;  4WA6 A;  4TT2 A;  4C66 A;  5IBN A;  4O7F A;  5LKU A;  2M3H A;  4MEP A;  4CUU A;  4WZ0 A;  3P1C A;  4A9M A;  4LDF A;  4A9K A;  3U5P A;  4YYD A;  2CSY A;  2RNY A;  5HFR A;  3O7A A;  3JVJ A;  4O72 A;  4QUU A;  4LYS A;  3UVX A;  3ONI A;  5DYX A;  1JM4 B;  4A4B A;  2LQ6 A;  4UIU A;  5ENB A;  5A5N A;  4GNE A;  5AD2 A;  4QYD A;  2QJ0 A;  2KFT A;  5CQ5 A;  4YY6 A;  5FFV A;  5D7X A;  4Z6I A;  5BT4 A;  5I80 A;  3QZS A;  5A81 A;  4O7A A;  3GL6 A;  3N9Q A;  4UYH A;  5B76 A;  5EPB A;  2CKL B;  2KR4 A;  2L5U A;  4O77 A;  2LXH C;  5CP5 A;  4I7D A;  3U5K A;  4B86 C;  4GB0 A;  5E9L A;  5CQ8 A;  5A5R A;  2CSZ A;  5CPE A;  3UV4 A;  2YEL A;  1HYJ A;  5L96 A;  3SHB A;  2LRI C;  5I1Q A;  4J3I A;  3U5N A;  2DVQ A;  4FLP A;  1Z6U A;  5FB0 A;  4YBT A;  2NXB A;  4WIV A;  4QR3 A;  2LXP C;  3I3J A;  5DX4 A;  3DQV R;  5I7Y A;  4YYI A;  5G04 B;  3SVH A;  5CU8 A;  4LZS A;  5IGM A;  4Q0N A;  2KTB B;  3GV4 A;  4AKN A;  3TLP A;  1WUM A;  1WEU A;  3N9N A;  5AIT A;  5E9I A;  2I50 A;  2E7O A;  2ECN A;  4O76 A;  5HFQ A;  4WHU A;  4TS8 A;  3RPG C;  2VJE A;  5AMF A;  4MEO A;  3AQA A;  2D82 A;  2DVR A;  5I89 A;  1WEE A;  4A0C D;  4HBV A;  5J0D A;  3AAD A;  4A9J A;  2RSD A;  5DW1 A;  3SOU A;  3N9M A;  1WEO A;  5C11 A;  4AUQ B;  4LYI A;  4NYX A;  5TCM A;  5HRX A;  1WEW A;  4AYC B;  3JVK A;  3RTR B;  5FE9 A;  3RCW A;  2G45 A;  4O75 A;  2KWO A;  3ZYU A;  5CUG A;  4PTB A;  4NS5 A;  4QBM A;  4W4U A;  5A7C A;  5FE3 A;  3KQI A;  1X4J A;  4NXJ A;  4C67 A;  2Y1N A;  4TKP B;  4YBM A;  1VFY A;  2YUR A;  5CZG A;  5HRV A;  5HQ6 A;  3EB5 A;  2Y1M A;  4WZ2 A;  5A5S A;  2YSM A;  2MJV B;  4PY6 A;  3N9O A;  5G4S A;  5IID A;  4N3W A;  5FE4 A;  5DFD A;  4QNS A;  4WZ3 B;  5KH3 A;  5HEL A;  1JM7 A;  4LYW A;  3DAI A;  4J1P A;  3HMH A;  2JMJ A;  5I88 A;  4LZR A;  3LXJ A;  4TT4 A;  3JVM A;  5FBX A;  5A82 A;  2R10 A;  3S92 A;  4YYH A;  5KTW A;  2VJF B;  5I3L A;  2DAT A;  4QC1 A;  5F1L A;  4IR6 A;  5CQT A;  5FH7 A;  4N4F A;  2LGL A;  5A5P A;  5I29 A;  4NN2 A;  5KO4 A;  2ECG A;  5DLZ A;  2LDR A;  5HJC A;  5DKD A;  4OUF A;  5C8G A;  4OGI A;  2YQL A;  4KV1 A;  3MUK A;  4TZ8 A;  5D1L B;  5C89 A;  1WUG A;  3T7L A;  4GNG A;  5IGN A;  4LC2 A;  3KV6 A;  2UZG A;  4TT6 A;  2I8N A;  4A9E A;  4P5O B;  2DWW A;  1BOR A;  1T1H A;  5CGP A;  2DVV A;  5CQ4 A;  3UV5 A;  2E7N A;  3MQM A;  4CA1 A;  5FB1 A;  2WP2 A;  5F63 A;  5ENG A;  3SVF A;  2KWJ A;  2MD8 C;  4XY8 A;  4A9N A;  2VNF A;  5CTL A;  5L99 A;  4TTE A;  3QZT A;  3C5K A;  4AP4 A;  5DKA A;  5DLX A;  3HTK C;  5L97 A;  2CT2 A;  2OO1 A;  1FBV A;  5BT5 A;  4HXS A;  2EA6 A;  2H0D A;  5DYC A;  5TBN A;  5CRZ A;  4UYF A;  5C87 A;  2KGI A;  2LGV A;  5LCW B;  5CFW A;  3L1Z B;  4I7B A;  1N87 A;  4A9O A;  3MXF A;  4A9F A;  2VPE A;  5IGK A;  4NUC A;  2YRE A;  4UIX A;  5EWC A;  4UP5 A;  4Q0O A;  3LQH A;  4HXL A;  5LJ0 A;  4PCI A;  3HMF A;  2FUI A;  2KIZ A;  2YHN A;  3IU5 A;  3P1D A;  4LZ2 A;  3PHD A;  5A83 A;  4MVT A;  4FJC A;  3UVY A;  1G25 A;  4QUT A;  1VD4 A;  2MIQ A;  4UIZ A;  2RFJ A;  2G6Q A;  5DKH A;  4B7Y C;  5F3A A;  5TB6 A;  3MB4 A;  3O34 A;  4YY4 A;  5LKZ A;  4LRG A;  2FUU A;  4HXR A;  4DON A;  4IOO A;  4QY4 A;  3ZVY A;  2LN0 A;  4NRA A;  2ECV A;  5FG5 A;  4I7C A;  4GNF A;  5EWW A;  5AD3 A;  5CY9 A;  2WP1 A;  4XUB A;  5FE6 A;  4LLB A;  5A5O A;  4NRC A;  2L84 A;  2QIZ A;  4YYJ A;  5L8U A;  3HCU A;  4UIV A;  4BBQ A;  4IOQ A;  5I7X A;  3U5L A;  2RS9 B;  4N4H A;  2JRJ A;  2RNX A;  3D7C A;  2DX8 A;  2L80 A;  3G0J A;  1F62 A;  2MT5 A;  5E9M A;  5DY7 A;  5FE0 A;  5FE5 A;  4QEV A;  2K4D A;  2YYN A;  4NYV A;  3NG2 A;  5E3G A;  4UIT A;  2HYE D;  2IDA A;  2YYR A;  4MR5 A;  4NR8 A;  1WFK A;  4Z1S A;  2M85 A;  5CUE A;  4A9I A;  4QF2 A;  4MR3 A;  1JM7 B;  2MD7 B;  5E7D A;  3SVG A;  2C2V S;  4QSP A;  2YDW A;  5F1H A;  4F3I A;  3ZPV 1;  4IOR A;  5F36 A;  2DVS A;  4YAD A;  4MR4 A;  5CS8 A;  2MNY A;  5HLS A;  1VYX A;  5KTU A;  3HME A;  4NR9 A;  4CUT A;  5F25 A;  4CLB A;  4O7C A;  5II1 A;  2M1R A;  2KGG A;  4R2Y A;  4IR3 A;  2NAA A;  3ZNI A;  4QR4 A;  2KU3 A;  3M63 A;  4ZQL A;  2D8S A;  2ECJ A;  5A85 A;  4FO9 A;  5DYA A;  2OUO A;  3UVD A;  5E9V A;  3V43 A;  2JMD A;  1XWH A;  2RNW A;  4OGJ A;  1WEP A;  4O64 A;  5HM0 A;  2E6S A;  5LJ2 A;  4UP0 A;  4MEN A;  2XB1 A;  2H60 A;  1X4U A;  4V3K C;  3O35 A;  5HEM A;  4O78 A;  4TQN A;  4J0S A;  2YEM A;  5EPR A;  5I83 A;  4ZC9 A;  3U5M A;  1HYI A;  5EGU A;  2YUC A;  3MUL A;  5D3P A;  5D24 A;  5II2 A;  2K16 A;  3O70 A;  5EK9 A;  4CL9 A;  2F6N A;  3GG3 A;  1Z60 A;  5F60 A;  4FIP A;  4S3O B;  2H0D B;  4QSV A;  5G0F A;  3ZYQ A;  4UYF B;  2PUY A;  2M6M A;  3NXB A;  3IHP A;  5KTX A;  4HBW A;  3ZTG A;  4ALH A;  5C4Q A;  5IG6 A;  5EA1 A;  2QIC A;  5LVQ A;  5EIS A;  5FE2 A;  2YQM A;  5D3J A;  3HCT A;  4ZW1 A;  5CQA A;  4GPJ A;  3UVW A;  3U5J A;  4CUS A;  5CRM A;  5I86 A;  1DVP A;  3FL2 A;  4A4C A;  1ZS5 A;  2YSJ A;  2DKW A;  5LKX A;  2OXQ C;  4CUP A;  4QR5 A;  3ASL A;  5DFB A;  4XY9 A;  4C9Z A;  5F62 A;  4BW2 A;  2R0V A;  4XYA A;  2D9E A;  5E9Y A;  3FKM X;  5ENH A;  4O70 A;  5ENF A;  4RVR A;  5JI8 A;  5G05 B;  4F52 B;  2F6J A;  2FSA A;  5EWD A;  5FEY A;  5FE1 A;  4QSW A;  2HDP A;  5D0C A;  4LR6 A;  2RO1 A;  5B77 A;  3IU6 A;  3ZVZ B;  5D3T A;  5CQ7 A;  5ETB A;  5LJ1 A;  5DYU A;  1WGM A;  4FK5 A;  2KYU A;  2XEU A;  4LJN A;  4IR5 A;  1WEV A;  4YYG A;  2MA5 A;  4X3G A;  4Z6H A;  4A49 A;  4HXM A;  1LDK C;  5AME A;  4PPE A;  5B78 A;  5D3N A;  5ENE A;  5FH6 A;  4YH3 A;  1F68 A;  3P1E A;  2R0Y A;  5D1K B;  4L58 A;  5KH9 A;  5F5Z A;  5CUB A;  4R8P K;  4UYD A;  5FG6 A;  5KU3 A;  4MR6 A;  5FG4 A;  5EQ1 A;  3M99 A;  4NQM A;  5D1M B;  2R0S A;  1K2F A;  4BHW A;  3SOX A;  5DBM A;  3VK6 A;  5ENI A;  4YK0 A;  4IC2 A;  5E0R A;  5EM3 A;  5G4R A;  2VJE B;  4XUA A;  2ECT A;  3N9P A;  3PUQ A;  5I40 A;  4NUD A;  2KE1 A;  5KH7 A;  5DFC A;  4CCG X;  5CUA A;  2VJF A;  4PKL A;  3L11 A;  4A9H A;  1WE9 A;  4HXO A;  4HXK A;  4Z1Q A;  5FFY A;  2G4A A;  2ZET C;  3JVL A;  5FFW A;  4Q6F A;  2YEK A;  2VPB A;  2KRE A;  4NUE A;  3K2J A;  4HBY A;  4UIY A;  5E73 A;  5BT3 A;  4ALG A;  3MB3 A;  3RPG B;  5JG6 A;  5E74 A;  5HQ7 A;  4BW4 A;  2E6R A;  5DIN A;  2YW5 A;  4BW3 A;  5H1U A;  4N4I A;  5LUU A;  3DPL R;  5E3D A;  1WIL A;  4QC3 A;  2YHO A;  2YQD A;  5EV9 A;  3N9L A;  4LKA A;  3ZPV E;  2PNX A;  4TYL A;  3EB6 A;  5D3S A;  2BAY A;  5FER A;  4PCE A;  2I7K A;  5KHM A;  2Y43 A;  3KV5 A;  1EQF A;  2OSS A;  2LSP B;  1WIM A;  5IGL A;  5HQ5 A;  3O33 A;  3DWY A;  4HXN A;  1JOC A;  4E96 A;  4R7E A;  4PS5 A;  5D26 A;  3U5O A;  2LV9 A;  4QSS A;  5D3R A;  2MA6 A;  3PUR A;  5EYA F;  4NQN A;  4YAX A;  2KWN A;  2LGG A;  3M62 A;  5EWH A;  2K17 A;  4X2I A;  4YH4 A;  4UYG A;  5H85 A;  4NR5 A;  3MHH A;  2L43 A;  2YW8 A;  4NRB A;  5EIC A;  5A5Q A;  1LDJ B;  2L5E A;  5COI A;  2GRC A;  5CQ3 A;  5ENJ A;  2KWK A;  5C13 A;  4YYN A;  5B8D A;  5FH8 A;  4Z93 A;  2AN6 A;  2ECI A;  5D25 A;  2C2L A;  2EOD A;  4LK9 A;  5J3X A;  4CFL A;  4KCX A;  5TRB A;  5CUC A;  3UW9 A;  3HCS A;  4MSX A;  4GND A;  4YC9 A;  2CKL A;  3P1F A;  4WHW A;  1X4I A;  3P5O A;  5FE7 A;  4YYM A;  4YBS A;  4ZDT A;  4YAB A;  4BJX A;  5F2P A;  3SOW A;  5LVR A;  4NR6 A;  4QST A;  4NR4 A;  3C6W A;  2YU4 A;  2VPD A;  5B79 A;  2MNZ A;  5FE8 A;  5F61 A;  2RI7 A;  5E9K A;  5H1V A;  4QSX A;  3MHS A;  4ZUX U;  2MUM A;  5D3L A;  4TU6 A;  4QEU A;  3G0L A;  5B75 A;  4HXP A;  5EP7 A;  5ENC A;  3S91 A;  1IYM A;  3Q2F A;  1WES A;  3I2D A;  4NR7 A;  3L1X A;  5EWV A;  5TDR A;  1E6I A;  4O71 A;  2VP7 A;  5DW2 A;  5JWM A;  4N4G A;  2LGK A;  2E3K A;  3LQI A;  4O7E A;  4TZ2 A;  5H1T A;  2F42 A;  3Q2E A;  4MEQ A;  5L8T A;  1MM2 A;  5TAB A;  4QYL A;  1WEN A;  2L75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...