2M1RA

Phd domain of ing4 n214d mutant
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
63
structure length
63
Chain Sequence
MDMPVDPNEPTYCLCHQVSYGEMIGCDDPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional impact of cancer-associated mutations in the tumor suppressor protein ING4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Inhibitor of growth protein 4
total genus 3
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m1rA00
4WZ3B 4A4CA 2XEUA 1WGMA 3N9NA 1CHCA 3KQIA 2YSMA 4L7XA 5C11A 4FIPA 4AYCA 2YUCA 5H1UA 3N9QA 1WEUA 2D8SA 5LCWB 5TABA 4GNFA 3QZVA 1MM2A 4GB0A 3LQIA 2KFTA 1WIMA 1G25A 4TKPB 2LDRA 4Q6FA 5C13A 2ECGA 2VPDA 5LKXA 5FB1A 3ZVYA 2LGVA 3ZPVE 1WFKA 2JRJA 1VFYA 2KU3A 3M99A 3RPGB 4YADA 4A0CD 4L58A 2EGPA 5H1TA 1WESA 4GNDA 1IYMA 3ZTGA 3O35A 4CA1A 1X4IA 3HTKC 2LN0A 2VP7A 2I50A 5KH3A 3VK6A 4N3WA 5DINA 3C5KA 4V3KC 3SHBA 5D1MB 2CKLB 2LGKA 2F6NA 2K1JA 3KV6A 3N9MA 3EB6A 4IC3A 2C2LA 2VPGA 5TBNA 2JMJA 4R2YA 4S3OB 2YT5A 4I7CA 3O36A 1WE9A 2Y43A 2FSAA 3SOXA 2JMDA 3U5PA 4YC9A 5G0FA 2FUIA 1WEOA 3N9PA 4WZ0A 1U6GB 5TDRA 2MT5A 2LQ6A 3DQVR 4UP5A 4MSXA 3N9LA 4ZUXU 3O7AA 4AP4A 4FK5A 3LRQA 4LADB 1X4JA 4ZDTA 1LDKC 1DVPA 1Z6UA 4NN2A 1XWHA 2YW8A 1T1HA 2C2VS 2MNZA 2OXQC 1JOCA 1E4UA 2RI7A 4N4FA 4BBQA 2KGIA 4C9ZA 5I3LA 4AVXA 5JG6A 2RSDA 2VJFB 2VJEB 1ZBDB 1WEWA 4AYCB 2VJEA 2NAAA 5TRBA 1JM7A 1JM7B 2H0DA 1MM3A 2M6MA 3LQHA 5DKAA 2Y1MA 4WZ2A 2EA6A 2PUYA 4YATA 3SOUA 2K17A 4R8PK 2VPEA 5FB0A 2ECVA 4LKAA 3O34A 1RMDA 3M63A 3KNVA 3HCTA 1N87A 5B75A 2ECJA 1HYIA 5J3XA 3HCSA 3GV4A 3ZNIA 2MIQA 5EYAF 4QF2A 3ASLA 2H0DB 2YQMA 3PURA 5B78A 4B86C 2ECIA 2KE1A 4MVTA 4I7DA 2YU4A 2XB1A 2CKLA 4FO9A 2KYUA 2MA6A 1F62A 2KIZA 2F42A 1X4UA 5AITA 2LGGA 3RTRB 3HCUA 1WEMA 2KWKA 3L11A 2AN6A 3MHHA 4S3OC 3U5OA 5FERA 4YBSA 5G05B 2M3HA 2E6SA 2L5UA 5KH7A 2YHOA 3U5MA 3NG2A 4X3GA 2K4DA 2YYRA 3EB5A 3MHSA 4LJNA 5LKTA 4W4UA 2L80A 3PHDA 5LKUA 2G43A 4UI9B 4B7YC 2KREA 2CT2A 3KV5A 2L0BA 4I7BA 4O64A 2HYED 5G04B 2Y1NA 2QIZA 4WA6A 3T7LA 2MNYA 4YABA 2KWOA 2ECWA 2G45A 3M62A 3RPGC 2LGLA 1WILA 2QJ0A 3GL6A 2ZETC 2PNXA 2UZGA 4GNGA 2IDAA 4F52B 4A49A 2DX8A 4GNEA 2K16A 3DPLR 3L1ZB 2HDPA 2MA5A 5LKZA 3PUQA 2KR4A 4YAXA 1VD4A 4QF3A 3L1XA 5H9MA 3SOWA 2E6RA 2KGGA 4BHWA 2JMIA 2QICA 4LLBA 2F6JA 5B79A 3O37A 2FUUA 3FL2A 1WEPA 2LRIC 2LV9A 4XI1A 5AIUA 3V43A 4LK9A 3IHPA 2ECNA 2G6QA 1FBVA 2KWJA 4A4BA 5H1VA 1WENA 3I2DA 4FJCA 2MD7B 5B76A 1Z60A 2LXHC 4PTBA 1FP0A 2M1RA 5B77A 2BAYA 1K2FA 2VJFA 2KWNA 1V87A 5FEYA 1WEQA 3ZVZB 4CCGX 5D1LB 1BORA 1WEVA 4P5OB 3T6RA 4YBTA 2YREA 2ECTA 2MUMA 5D1KB 3ZYQA 5B8DA 3LQJA 2YSJA 4UP0A 1Z2QA 2LXPC 2YURA 2CSYA 1LDJB 3U5NA 4YBMA 2VNFA 4ZQLA 1VYXA 1HYJA 2VPBA 3ZPV1 3O70A 4V3LC 2CSZA 3O33A 2L75A 1WEEA 2EODA 3N9OA 5TDWA 4PPEA 4AUQB 2L43A 2M85A 4IC2A 4R7EA 2MD8C 2YQLA 3C6WA 2YHNA 5KH9A
chains in the Genus database with same CATH superfamily
4WZ3B 4A4CA 2XEUA 1WGMA 3N9NA 1CHCA 3KQIA 2YSMA 4L7XA 5C11A 4FIPA 4AYCA 2YUCA 5H1UA 1MBMA 3N9QA 1WEUA 2D8SA 5LCWB 5TABA 4Z0OA 4GNFA 3QZVA 1MM2A 4GB0A 3LQIA 2KFTA 1WIMA 1G25A 2L7PA 4TKPB 2LDRA 3LVQE 4Q6FA 5C13A 2ECGA 2VPDA 5LKXA 5FB1A 3ZVYA 2LGVA 3ZPVE 2DSMA 1WFKA 2JRJA 1VFYA 2KU3A 3M99A 3RPGB 4YADA 4A0CD 4L58A 2EGPA 5H1TA 1WESA 4GNDA 1IYMA 3ZTGA 3O35A 4CA1A 1X4IA 2JM3A 3HTKC 2LN0A 2VP7A 2I50A 5KH3A 3VK6A 2OWAA 4N3WA 3C5KA 4V3KC 5DINA 3SHBA 5D1MB 2CKLB 2LGKA 2F6NA 2K1JA 3KV6A 3N9MA 3EB6A 4IC3A 3SUBA 2KKYA 2C2LA 5K3QA 2VPGA 5TBNA 4R2YA 2JMJA 2XOYA 4S3OB 2YT5A 4I7CA 3O36A 1WE9A 2Y43A 2FSAA 3SOXA 3FJUB 3H7HA 2JMDA 3U5PA 4YC9A 5G0FA 2FUIA 2XOCA 1WEOA 3N9PA 4WZ0A 3LJUX 1U6GB 5TDRA 2MT5A 3MDBC 2LQ6A 3DQVR 4UP5A 4MSXA 3N9LA 4ZUXU 3O7AA 4AP4A 4FK5A 5SVXA 3Q1DA 3LRQA 4LADB 1X4JA 4ZDTA 1LDKC 1DVPA 1Z6UA 2XP0A 4NN2A 1XWHA 2YW8A 1T1HA 2C2VS 2MNZA 2OXQC 1JOCA 1E4UA 2RI7A 4N4FA 4BBQA 2EXUA 2KGIA 4C9ZA 5I3LA 1DCQA 4AVXA 5JG6A 2RSDA 3LVRE 2VJFB 2VJEB 1ZBDB 2CSVA 2RR4A 1WEWA 4AYCB 2VJEA 2NAAA 5TRBA 1JM7A 2LAUA 2JUNA 1JM7B 2H0DA 1MM3A 2M6MA 3LQHA 5DKAA 2Y1MA 4F1PA 4WZ2A 2EA6A 2PUYA 4YATA 3SOUA 2K17A 4R8PK 2VPEA 5FB0A 2ECVA 4LKAA 4Z0RA 3O34A 1RMDA 3M63A 3KNVA 3HCTA 1N87A 5B75A 2ECJA 1HYIA 5J3XA 3HCSA 3O47A 3GV4A 3ZNIA 2MIQA 5EYAF 4QF2A 2MKEA 3ASLA 2H0DB 2YQMA 3PURA 5B78A 4B86C 2ECIA 2KE1A 4MVTA 4I7DA 2YU4A 2XB1A 2CKLA 2XOZA 4FO9A 2KYUA 2MA6A 1F62A 2KIZA 2F42A 1X4UA 5AITA 3LDYA 2LGGA 3RTRB 3HCUA 1WEMA 2KWKA 3L11A 2AN6A 2CRWA 3MHHA 2CONA 4S3OC 3U5OA 3DDTA 5FERA 4YBSA 2IQJA 5G05B 2M3HA 2E6SA 2L5UA 4H9DA 5KH7A 2YHOA 3U5MA 3NG2A 4X3GA 2K4DA 2YYRA 3EB5A 3MHSA 2B0OE 4LJNA 5LKTA 3KDEC 4W4UA 2L80A 3PHDA 5LKUA 2G43A 4UI9B 3M7KA 3T9KA 4B7YC 2KREA 2CT2A 3KV5A 2DJAA 2L0BA 4I7BA 4O64A 2HYED 5G04B 2Y1NA 2QIZA 4WA6A 3T7LA 2MNYA 4YABA 2KWOA 2ECWA 2G45A 3M62A 3RPGC 2D8UA 2LGLA 1WILA 2QJ0A 3GL6A 2ZETC 2PNXA 2UZGA 4GNGA 2IDAA 3E2DA 4QQ4A 4F52B 4A49A 2EGMA 2DX8A 4OGEA 3FANA 3DWDA 4GNEA 2K16A 3DPLR 3L1ZB 2HDPA 2MA5A 5LKZA 3PUQA 2KR4A 4YAXA 1VD4A 4QF3A 3L1XA 5H9MA 3SOWA 5SVYA 2E6RA 2KGGA 4BHWA 2JMIA 2QICA 4LLBA 2F6JA 2KKXA 5B79A 2CRRA 2FFWA 3O37A 2FUUA 3FL2A 1WEPA 5SVIB 2LRIC 2LV9A 4XI1A 5AIUA 3V43A 4LK9A 3IHPA 2ECNA 2G6QA 1FBVA 2KWJA 4A4BA 5H1VA 1WENA 3I2DA 4FJCA 2MD7B 5B76A 1Z60A 2LXHC 4PTBA 1FP0A 2M1RA 5B77A 2BAYA 1K2FA 2VJFA 2KWNA 1V87A 3FEHA 5FEYA 1WEQA 3ZVZB 4CCGX 2YVRA 3JUEA 3FM8C 5D1LB 1BORA 1WEVA 4P5OB 3T6RA 4YBTA 2E61A 2YREA 2ECTA 2MUMA 5D1KB 3ZYQA 5B8DA 4OGCA 3LQJA 2YSJA 4UP0A 1Z2QA 2LXPC 2FD4A 2YURA 2CSYA 1LDJB 3U5NA 4YBMA 2VNFA 4ZQLA 1VYXA 1HYJA 2VPBA 4O62A 3ZPV1 3FAOA 3O70A 4V3LC 2CSZA 3O33A 2L75A 1WEEA 2P57A 2EODA 3N9OA 5TDWA 4PPEA 4AUQB 2L43A 2M85A 4IC2A 4R7EA 2MD8C 2YQLA 3PLWA 5SVIA 3C6WA 2M13A 2YHNA 5KH9A
chains in the Genus database with same CATH topology
4WZ3B 4A4CA 2XEUA 1WGMA 3N9NA 1CHCA 3KQIA 2YSMA 4L7XA 5C11A 4FIPA 4AYCA 2YUCA 5H1UA 3N9QA 1WEUA 2D8SA 5LCWB 5TABA 4GNFA 3QZVA 1MM2A 4GB0A 3LQIA 2KFTA 1WIMA 1G25A 4TKPB 2LDRA 4Q6FA 5C13A 2ECGA 2VPDA 5LKXA 5FB1A 3ZVYA 2LGVA 3ZPVE 1WFKA 2JRJA 1VFYA 2KU3A 3M99A 3RPGB 4YADA 4A0CD 4L58A 2EGPA 5H1TA 1WESA 4GNDA 1IYMA 3ZTGA 3O35A 4CA1A 1X4IA 3HTKC 2LN0A 2VP7A 2I50A 5KH3A 3VK6A 4N3WA 5DINA 3C5KA 4V3KC 3SHBA 5D1MB 2CKLB 2LGKA 2F6NA 2K1JA 3KV6A 3N9MA 3EB6A 4IC3A 2C2LA 2VPGA 5TBNA 2JMJA 4R2YA 4S3OB 2YT5A 4I7CA 3O36A 1WE9A 2Y43A 2FSAA 3SOXA 2JMDA 3U5PA 4YC9A 5G0FA 2FUIA 1WEOA 3N9PA 4WZ0A 1U6GB 5TDRA 2MT5A 2LQ6A 3DQVR 4UP5A 4MSXA 3N9LA 4ZUXU 3O7AA 4AP4A 4FK5A 3LRQA 4LADB 1X4JA 4ZDTA 1LDKC 1DVPA 1Z6UA 4NN2A 1XWHA 2YW8A 1T1HA 2C2VS 2MNZA 2OXQC 1JOCA 1E4UA 2RI7A 4N4FA 4BBQA 2KGIA 4C9ZA 5I3LA 4AVXA 5JG6A 2RSDA 2VJFB 2VJEB 1ZBDB 1WEWA 4AYCB 2VJEA 2NAAA 5TRBA 1JM7A 1JM7B 2H0DA 1MM3A 2M6MA 3LQHA 5DKAA 2Y1MA 4WZ2A 2EA6A 2PUYA 4YATA 3SOUA 2K17A 4R8PK 2VPEA 5FB0A 2ECVA 4LKAA 3O34A 1RMDA 3M63A 3KNVA 3HCTA 1N87A 5B75A 2ECJA 1HYIA 5J3XA 3HCSA 3GV4A 3ZNIA 2MIQA 5EYAF 4QF2A 3ASLA 2H0DB 2YQMA 3PURA 5B78A 4B86C 2ECIA 2KE1A 4MVTA 4I7DA 2YU4A 2XB1A 2CKLA 4FO9A 2KYUA 2MA6A 1F62A 2KIZA 2F42A 1X4UA 5AITA 2LGGA 3RTRB 3HCUA 1WEMA 2KWKA 3L11A 2AN6A 3MHHA 4S3OC 3U5OA 5FERA 4YBSA 5G05B 2M3HA 2E6SA 2L5UA 5KH7A 2YHOA 3U5MA 3NG2A 4X3GA 2K4DA 2YYRA 3EB5A 3MHSA 4LJNA 5LKTA 4W4UA 2L80A 3PHDA 5LKUA 2G43A 4UI9B 4B7YC 2KREA 2CT2A 3KV5A 2L0BA 4I7BA 4O64A 2HYED 5G04B 2Y1NA 2QIZA 4WA6A 3T7LA 2MNYA 4YABA 2KWOA 2ECWA 2G45A 3M62A 3RPGC 2LGLA 1WILA 2QJ0A 3GL6A 2ZETC 2PNXA 2UZGA 4GNGA 2IDAA 4F52B 4A49A 2DX8A 4GNEA 2K16A 3DPLR 3L1ZB 2HDPA 2MA5A 5LKZA 3PUQA 2KR4A 4YAXA 1VD4A 4QF3A 3L1XA 5H9MA 3SOWA 2E6RA 2KGGA 4BHWA 2JMIA 2QICA 4LLBA 2F6JA 5B79A 3O37A 2FUUA 3FL2A 1WEPA 2LRIC 2LV9A 4XI1A 5AIUA 3V43A 4LK9A 3IHPA 2ECNA 2G6QA 1FBVA 2KWJA 4A4BA 5H1VA 1WENA 3I2DA 4FJCA 2MD7B 5B76A 1Z60A 2LXHC 4PTBA 1FP0A 2M1RA 5B77A 2BAYA 1K2FA 2VJFA 2KWNA 1V87A 5FEYA 1WEQA 3ZVZB 4CCGX 5D1LB 1BORA 1WEVA 4P5OB 3T6RA 4YBTA 2YREA 2ECTA 2MUMA 5D1KB 3ZYQA 5B8DA 3LQJA 2YSJA 4UP0A 1Z2QA 2LXPC 2YURA 2CSYA 1LDJB 3U5NA 4YBMA 2VNFA 4ZQLA 1VYXA 1HYJA 2VPBA 3ZPV1 3O70A 4V3LC 2CSZA 3O33A 2L75A 1WEEA 2EODA 3N9OA 5TDWA 4PPEA 4AUQB 2L43A 2M85A 4IC2A 4R7EA 2MD8C 2YQLA 3C6WA 2YHNA 5KH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ3 B;  4A4C A;  2XEU A;  1WGM A;  3N9N A;  1CHC A;  3KQI A;  2YSM A;  4L7X A;  5C11 A;  4FIP A;  4AYC A;  2YUC A;  5H1U A;  3N9Q A;  1WEU A;  2D8S A;  5LCW B;  5TAB A;  4GNF A;  3QZV A;  1MM2 A;  4GB0 A;  3LQI A;  2KFT A;  1WIM A;  1G25 A;  4TKP B;  2LDR A;  4Q6F A;  5C13 A;  2ECG A;  2VPD A;  5LKX A;  5FB1 A;  3ZVY A;  2LGV A;  3ZPV E;  1WFK A;  2JRJ A;  1VFY A;  2KU3 A;  3M99 A;  3RPG B;  4YAD A;  4A0C D;  4L58 A;  2EGP A;  5H1T A;  1WES A;  4GND A;  1IYM A;  3ZTG A;  3O35 A;  4CA1 A;  1X4I A;  3HTK C;  2LN0 A;  2VP7 A;  2I50 A;  5KH3 A;  3VK6 A;  4N3W A;  5DIN A;  3C5K A;  4V3K C;  3SHB A;  5D1M B;  2CKL B;  2LGK A;  2F6N A;  2K1J A;  3KV6 A;  3N9M A;  3EB6 A;  4IC3 A;  2C2L A;  2VPG A;  5TBN A;  2JMJ A;  4R2Y A;  4S3O B;  2YT5 A;  4I7C A;  3O36 A;  1WE9 A;  2Y43 A;  2FSA A;  3SOX A;  2JMD A;  3U5P A;  4YC9 A;  5G0F A;  2FUI A;  1WEO A;  3N9P A;  4WZ0 A;  1U6G B;  5TDR A;  2MT5 A;  2LQ6 A;  3DQV R;  4UP5 A;  4MSX A;  3N9L A;  4ZUX U;  3O7A A;  4AP4 A;  4FK5 A;  3LRQ A;  4LAD B;  1X4J A;  4ZDT A;  1LDK C;  1DVP A;  1Z6U A;  4NN2 A;  1XWH A;  2YW8 A;  1T1H A;  2C2V S;  2MNZ A;  2OXQ C;  1JOC A;  1E4U A;  2RI7 A;  4N4F A;  4BBQ A;  2KGI A;  4C9Z A;  5I3L A;  4AVX A;  5JG6 A;  2RSD A;  2VJF B;  2VJE B;  1ZBD B;  1WEW A;  4AYC B;  2VJE A;  2NAA A;  5TRB A;  1JM7 A;  1JM7 B;  2H0D A;  1MM3 A;  2M6M A;  3LQH A;  5DKA A;  2Y1M A;  4WZ2 A;  2EA6 A;  2PUY A;  4YAT A;  3SOU A;  2K17 A;  4R8P K;  2VPE A;  5FB0 A;  2ECV A;  4LKA A;  3O34 A;  1RMD A;  3M63 A;  3KNV A;  3HCT A;  1N87 A;  5B75 A;  2ECJ A;  1HYI A;  5J3X A;  3HCS A;  3GV4 A;  3ZNI A;  2MIQ A;  5EYA F;  4QF2 A;  3ASL A;  2H0D B;  2YQM A;  3PUR A;  5B78 A;  4B86 C;  2ECI A;  2KE1 A;  4MVT A;  4I7D A;  2YU4 A;  2XB1 A;  2CKL A;  4FO9 A;  2KYU A;  2MA6 A;  1F62 A;  2KIZ A;  2F42 A;  1X4U A;  5AIT A;  2LGG A;  3RTR B;  3HCU A;  1WEM A;  2KWK A;  3L11 A;  2AN6 A;  3MHH A;  4S3O C;  3U5O A;  5FER A;  4YBS A;  5G05 B;  2M3H A;  2E6S A;  2L5U A;  5KH7 A;  2YHO A;  3U5M A;  3NG2 A;  4X3G A;  2K4D A;  2YYR A;  3EB5 A;  3MHS A;  4LJN A;  5LKT A;  4W4U A;  2L80 A;  3PHD A;  5LKU A;  2G43 A;  4UI9 B;  4B7Y C;  2KRE A;  2CT2 A;  3KV5 A;  2L0B A;  4I7B A;  4O64 A;  2HYE D;  5G04 B;  2Y1N A;  2QIZ A;  4WA6 A;  3T7L A;  2MNY A;  4YAB A;  2KWO A;  2ECW A;  2G45 A;  3M62 A;  3RPG C;  2LGL A;  1WIL A;  2QJ0 A;  3GL6 A;  2ZET C;  2PNX A;  2UZG A;  4GNG A;  2IDA A;  4F52 B;  4A49 A;  2DX8 A;  4GNE A;  2K16 A;  3DPL R;  3L1Z B;  2HDP A;  2MA5 A;  5LKZ A;  3PUQ A;  2KR4 A;  4YAX A;  1VD4 A;  4QF3 A;  3L1X A;  5H9M A;  3SOW A;  2E6R A;  2KGG A;  4BHW A;  2JMI A;  2QIC A;  4LLB A;  2F6J A;  5B79 A;  3O37 A;  2FUU A;  3FL2 A;  1WEP A;  2LRI C;  2LV9 A;  4XI1 A;  5AIU A;  3V43 A;  4LK9 A;  3IHP A;  2ECN A;  2G6Q A;  1FBV A;  2KWJ A;  4A4B A;  5H1V A;  1WEN A;  3I2D A;  4FJC A;  2MD7 B;  5B76 A;  1Z60 A;  2LXH C;  4PTB A;  1FP0 A;  2M1R A;  5B77 A;  2BAY A;  1K2F A;  2VJF A;  2KWN A;  1V87 A;  5FEY A;  1WEQ A;  3ZVZ B;  4CCG X;  5D1L B;  1BOR A;  1WEV A;  4P5O B;  3T6R A;  4YBT A;  2YRE A;  2ECT A;  2MUM A;  5D1K B;  3ZYQ A;  5B8D A;  3LQJ A;  2YSJ A;  4UP0 A;  1Z2Q A;  2LXP C;  2YUR A;  2CSY A;  1LDJ B;  3U5N A;  4YBM A;  2VNF A;  4ZQL A;  1VYX A;  1HYJ A;  2VPB A;  3ZPV 1;  3O70 A;  4V3L C;  2CSZ A;  3O33 A;  2L75 A;  1WEE A;  2EOD A;  3N9O A;  5TDW A;  4PPE A;  4AUQ B;  2L43 A;  2M85 A;  4IC2 A;  4R7E A;  2MD8 C;  2YQL A;  3C6W A;  2YHN A;  5KH9 A; 
#chains in the Genus database with same CATH topology
 4WZ3 B;  4A4C A;  2XEU A;  1WGM A;  3N9N A;  1CHC A;  3KQI A;  2YSM A;  4L7X A;  5C11 A;  4FIP A;  4AYC A;  2YUC A;  5H1U A;  1MBM A;  3N9Q A;  1WEU A;  2D8S A;  5LCW B;  5TAB A;  4Z0O A;  4GNF A;  3QZV A;  1MM2 A;  4GB0 A;  3LQI A;  2KFT A;  1WIM A;  1G25 A;  2L7P A;  4TKP B;  2LDR A;  3LVQ E;  4Q6F A;  5C13 A;  2ECG A;  2VPD A;  5LKX A;  5FB1 A;  3ZVY A;  2LGV A;  3ZPV E;  2DSM A;  1WFK A;  2JRJ A;  1VFY A;  2KU3 A;  3M99 A;  3RPG B;  4YAD A;  4A0C D;  4L58 A;  2EGP A;  5H1T A;  1WES A;  4GND A;  1IYM A;  3ZTG A;  3O35 A;  4CA1 A;  1X4I A;  2JM3 A;  3HTK C;  2LN0 A;  2VP7 A;  2I50 A;  5KH3 A;  3VK6 A;  2OWA A;  4N3W A;  3C5K A;  4V3K C;  5DIN A;  3SHB A;  5D1M B;  2CKL B;  2LGK A;  2F6N A;  2K1J A;  3KV6 A;  3N9M A;  3EB6 A;  4IC3 A;  3SUB A;  2KKY A;  2C2L A;  5K3Q A;  2VPG A;  5TBN A;  4R2Y A;  2JMJ A;  2XOY A;  4S3O B;  2YT5 A;  4I7C A;  3O36 A;  1WE9 A;  2Y43 A;  2FSA A;  3SOX A;  3FJU B;  3H7H A;  2JMD A;  3U5P A;  4YC9 A;  5G0F A;  2FUI A;  2XOC A;  1WEO A;  3N9P A;  4WZ0 A;  3LJU X;  1U6G B;  5TDR A;  2MT5 A;  3MDB C;  2LQ6 A;  3DQV R;  4UP5 A;  4MSX A;  3N9L A;  4ZUX U;  3O7A A;  4AP4 A;  4FK5 A;  5SVX A;  3Q1D A;  3LRQ A;  4LAD B;  1X4J A;  4ZDT A;  1LDK C;  1DVP A;  1Z6U A;  2XP0 A;  4NN2 A;  1XWH A;  2YW8 A;  1T1H A;  2C2V S;  2MNZ A;  2OXQ C;  1JOC A;  1E4U A;  2RI7 A;  4N4F A;  4BBQ A;  2EXU A;  2KGI A;  4C9Z A;  5I3L A;  1DCQ A;  4AVX A;  5JG6 A;  2RSD A;  3LVR E;  2VJF B;  2VJE B;  1ZBD B;  2CSV A;  2RR4 A;  1WEW A;  4AYC B;  2VJE A;  2NAA A;  5TRB A;  1JM7 A;  2LAU A;  2JUN A;  1JM7 B;  2H0D A;  1MM3 A;  2M6M A;  3LQH A;  5DKA A;  2Y1M A;  4F1P A;  4WZ2 A;  2EA6 A;  2PUY A;  4YAT A;  3SOU A;  2K17 A;  4R8P K;  2VPE A;  5FB0 A;  2ECV A;  4LKA A;  4Z0R A;  3O34 A;  1RMD A;  3M63 A;  3KNV A;  3HCT A;  1N87 A;  5B75 A;  2ECJ A;  1HYI A;  5J3X A;  3HCS A;  3O47 A;  3GV4 A;  3ZNI A;  2MIQ A;  5EYA F;  4QF2 A;  2MKE A;  3ASL A;  2H0D B;  2YQM A;  3PUR A;  5B78 A;  4B86 C;  2ECI A;  2KE1 A;  4MVT A;  4I7D A;  2YU4 A;  2XB1 A;  2CKL A;  2XOZ A;  4FO9 A;  2KYU A;  2MA6 A;  1F62 A;  2KIZ A;  2F42 A;  1X4U A;  5AIT A;  3LDY A;  2LGG A;  3RTR B;  3HCU A;  1WEM A;  2KWK A;  3L11 A;  2AN6 A;  2CRW A;  3MHH A;  2CON A;  4S3O C;  3U5O A;  3DDT A;  5FER A;  4YBS A;  2IQJ A;  5G05 B;  2M3H A;  2E6S A;  2L5U A;  4H9D A;  5KH7 A;  2YHO A;  3U5M A;  3NG2 A;  4X3G A;  2K4D A;  2YYR A;  3EB5 A;  3MHS A;  2B0O E;  4LJN A;  5LKT A;  3KDE C;  4W4U A;  2L80 A;  3PHD A;  5LKU A;  2G43 A;  4UI9 B;  3M7K A;  3T9K A;  4B7Y C;  2KRE A;  2CT2 A;  3KV5 A;  2DJA A;  2L0B A;  4I7B A;  4O64 A;  2HYE D;  5G04 B;  2Y1N A;  2QIZ A;  4WA6 A;  3T7L A;  2MNY A;  4YAB A;  2KWO A;  2ECW A;  2G45 A;  3M62 A;  3RPG C;  2D8U A;  2LGL A;  1WIL A;  2QJ0 A;  3GL6 A;  2ZET C;  2PNX A;  2UZG A;  4GNG A;  2IDA A;  3E2D A;  4QQ4 A;  4F52 B;  4A49 A;  2EGM A;  2DX8 A;  4OGE A;  3FAN A;  3DWD A;  4GNE A;  2K16 A;  3DPL R;  3L1Z B;  2HDP A;  2MA5 A;  5LKZ A;  3PUQ A;  2KR4 A;  4YAX A;  1VD4 A;  4QF3 A;  3L1X A;  5H9M A;  3SOW A;  5SVY A;  2E6R A;  2KGG A;  4BHW A;  2JMI A;  2QIC A;  4LLB A;  2F6J A;  2KKX A;  5B79 A;  2CRR A;  2FFW A;  3O37 A;  2FUU A;  3FL2 A;  1WEP A;  5SVI B;  2LRI C;  2LV9 A;  4XI1 A;  5AIU A;  3V43 A;  4LK9 A;  3IHP A;  2ECN A;  2G6Q A;  1FBV A;  2KWJ A;  4A4B A;  5H1V A;  1WEN A;  3I2D A;  4FJC A;  2MD7 B;  5B76 A;  1Z60 A;  2LXH C;  4PTB A;  1FP0 A;  2M1R A;  5B77 A;  2BAY A;  1K2F A;  2VJF A;  2KWN A;  1V87 A;  3FEH A;  5FEY A;  1WEQ A;  3ZVZ B;  4CCG X;  2YVR A;  3JUE A;  3FM8 C;  5D1L B;  1BOR A;  1WEV A;  4P5O B;  3T6R A;  4YBT A;  2E61 A;  2YRE A;  2ECT A;  2MUM A;  5D1K B;  3ZYQ A;  5B8D A;  4OGC A;  3LQJ A;  2YSJ A;  4UP0 A;  1Z2Q A;  2LXP C;  2FD4 A;  2YUR A;  2CSY A;  1LDJ B;  3U5N A;  4YBM A;  2VNF A;  4ZQL A;  1VYX A;  1HYJ A;  2VPB A;  4O62 A;  3ZPV 1;  3FAO A;  3O70 A;  4V3L C;  2CSZ A;  3O33 A;  2L75 A;  1WEE A;  2P57 A;  2EOD A;  3N9O A;  5TDW A;  4PPE A;  4AUQ B;  2L43 A;  2M85 A;  4IC2 A;  4R7E A;  2MD8 C;  2YQL A;  3PLW A;  5SVI A;  3C6W A;  2M13 A;  2YHN A;  5KH9 A; 
#chains in the Genus database with same CATH homology
 4WZ3 B;  4A4C A;  2XEU A;  1WGM A;  3N9N A;  1CHC A;  3KQI A;  2YSM A;  4L7X A;  5C11 A;  4FIP A;  4AYC A;  2YUC A;  5H1U A;  3N9Q A;  1WEU A;  2D8S A;  5LCW B;  5TAB A;  4GNF A;  3QZV A;  1MM2 A;  4GB0 A;  3LQI A;  2KFT A;  1WIM A;  1G25 A;  4TKP B;  2LDR A;  4Q6F A;  5C13 A;  2ECG A;  2VPD A;  5LKX A;  5FB1 A;  3ZVY A;  2LGV A;  3ZPV E;  1WFK A;  2JRJ A;  1VFY A;  2KU3 A;  3M99 A;  3RPG B;  4YAD A;  4A0C D;  4L58 A;  2EGP A;  5H1T A;  1WES A;  4GND A;  1IYM A;  3ZTG A;  3O35 A;  4CA1 A;  1X4I A;  3HTK C;  2LN0 A;  2VP7 A;  2I50 A;  5KH3 A;  3VK6 A;  4N3W A;  5DIN A;  3C5K A;  4V3K C;  3SHB A;  5D1M B;  2CKL B;  2LGK A;  2F6N A;  2K1J A;  3KV6 A;  3N9M A;  3EB6 A;  4IC3 A;  2C2L A;  2VPG A;  5TBN A;  2JMJ A;  4R2Y A;  4S3O B;  2YT5 A;  4I7C A;  3O36 A;  1WE9 A;  2Y43 A;  2FSA A;  3SOX A;  2JMD A;  3U5P A;  4YC9 A;  5G0F A;  2FUI A;  1WEO A;  3N9P A;  4WZ0 A;  1U6G B;  5TDR A;  2MT5 A;  2LQ6 A;  3DQV R;  4UP5 A;  4MSX A;  3N9L A;  4ZUX U;  3O7A A;  4AP4 A;  4FK5 A;  3LRQ A;  4LAD B;  1X4J A;  4ZDT A;  1LDK C;  1DVP A;  1Z6U A;  4NN2 A;  1XWH A;  2YW8 A;  1T1H A;  2C2V S;  2MNZ A;  2OXQ C;  1JOC A;  1E4U A;  2RI7 A;  4N4F A;  4BBQ A;  2KGI A;  4C9Z A;  5I3L A;  4AVX A;  5JG6 A;  2RSD A;  2VJF B;  2VJE B;  1ZBD B;  1WEW A;  4AYC B;  2VJE A;  2NAA A;  5TRB A;  1JM7 A;  1JM7 B;  2H0D A;  1MM3 A;  2M6M A;  3LQH A;  5DKA A;  2Y1M A;  4WZ2 A;  2EA6 A;  2PUY A;  4YAT A;  3SOU A;  2K17 A;  4R8P K;  2VPE A;  5FB0 A;  2ECV A;  4LKA A;  3O34 A;  1RMD A;  3M63 A;  3KNV A;  3HCT A;  1N87 A;  5B75 A;  2ECJ A;  1HYI A;  5J3X A;  3HCS A;  3GV4 A;  3ZNI A;  2MIQ A;  5EYA F;  4QF2 A;  3ASL A;  2H0D B;  2YQM A;  3PUR A;  5B78 A;  4B86 C;  2ECI A;  2KE1 A;  4MVT A;  4I7D A;  2YU4 A;  2XB1 A;  2CKL A;  4FO9 A;  2KYU A;  2MA6 A;  1F62 A;  2KIZ A;  2F42 A;  1X4U A;  5AIT A;  2LGG A;  3RTR B;  3HCU A;  1WEM A;  2KWK A;  3L11 A;  2AN6 A;  3MHH A;  4S3O C;  3U5O A;  5FER A;  4YBS A;  5G05 B;  2M3H A;  2E6S A;  2L5U A;  5KH7 A;  2YHO A;  3U5M A;  3NG2 A;  4X3G A;  2K4D A;  2YYR A;  3EB5 A;  3MHS A;  4LJN A;  5LKT A;  4W4U A;  2L80 A;  3PHD A;  5LKU A;  2G43 A;  4UI9 B;  4B7Y C;  2KRE A;  2CT2 A;  3KV5 A;  2L0B A;  4I7B A;  4O64 A;  2HYE D;  5G04 B;  2Y1N A;  2QIZ A;  4WA6 A;  3T7L A;  2MNY A;  4YAB A;  2KWO A;  2ECW A;  2G45 A;  3M62 A;  3RPG C;  2LGL A;  1WIL A;  2QJ0 A;  3GL6 A;  2ZET C;  2PNX A;  2UZG A;  4GNG A;  2IDA A;  4F52 B;  4A49 A;  2DX8 A;  4GNE A;  2K16 A;  3DPL R;  3L1Z B;  2HDP A;  2MA5 A;  5LKZ A;  3PUQ A;  2KR4 A;  4YAX A;  1VD4 A;  4QF3 A;  3L1X A;  5H9M A;  3SOW A;  2E6R A;  2KGG A;  4BHW A;  2JMI A;  2QIC A;  4LLB A;  2F6J A;  5B79 A;  3O37 A;  2FUU A;  3FL2 A;  1WEP A;  2LRI C;  2LV9 A;  4XI1 A;  5AIU A;  3V43 A;  4LK9 A;  3IHP A;  2ECN A;  2G6Q A;  1FBV A;  2KWJ A;  4A4B A;  5H1V A;  1WEN A;  3I2D A;  4FJC A;  2MD7 B;  5B76 A;  1Z60 A;  2LXH C;  4PTB A;  1FP0 A;  2M1R A;  5B77 A;  2BAY A;  1K2F A;  2VJF A;  2KWN A;  1V87 A;  5FEY A;  1WEQ A;  3ZVZ B;  4CCG X;  5D1L B;  1BOR A;  1WEV A;  4P5O B;  3T6R A;  4YBT A;  2YRE A;  2ECT A;  2MUM A;  5D1K B;  3ZYQ A;  5B8D A;  3LQJ A;  2YSJ A;  4UP0 A;  1Z2Q A;  2LXP C;  2YUR A;  2CSY A;  1LDJ B;  3U5N A;  4YBM A;  2VNF A;  4ZQL A;  1VYX A;  1HYJ A;  2VPB A;  3ZPV 1;  3O70 A;  4V3L C;  2CSZ A;  3O33 A;  2L75 A;  1WEE A;  2EOD A;  3N9O A;  5TDW A;  4PPE A;  4AUQ B;  2L43 A;  2M85 A;  4IC2 A;  4R7E A;  2MD8 C;  2YQL A;  3C6W A;  2YHN A;  5KH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...