2M1RA

Phd domain of ing4 n214d mutant
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
63
structure length
63
Chain Sequence
MDMPVDPNEPTYCLCHQVSYGEMIGCDDPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 4
publication title Functional impact of cancer-associated mutations in the tumor suppressor protein ING4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 3
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m1rA00
4GNFA 2H0DB 3V43A 5B76A 3L1ZB 5AITA 1WILA 3L11A 2EA6A 4Q6FA 2ECNA 4TKPB 2MA5A 2YYRA 2F42A 2UZGA 1Z2QA 5FB0A 4A4CA 2KGGA 2JMIA 2VPEA 3L1XA 3KNVA 5H1UA 3RPGB 3N9NA 4O64A 5J3XA 3T6RA 2JMJA 3PHDA 3KV5A 2ECTA 5D1KB 1Z60A 3ZVZB 2YSJA 4CA1A 4AYCA 4YADA 5B79A 4B86C 3LQHA 2YHNA 4BHWA 2E6RA 2YREA 4S3OC 1F62A 4WZ0A 1WEMA 3N9OA 1X4UA 2VPBA 3O35A 1VFYA 4X3GA 2RSDA 4N3WA 2G45A 4UI9B 3U5NA 2YSMA 5H1TA 4B7YC 4GNGA 5LKXA 3I2DA 1LDJB 3O37A 5TDRA 4LJNA 4LKAA 2G43A 3LQJA 2LN0A 5C11A 3GL6A 2JRJA 2JMDA 2I50A 4LK9A 5B8DA 4AP4A 5B78A 3U5MA 3ZNIA 4BBQA 1BORA 4AYCB 3HTKC 3RTRB 1WENA 2KWKA 3VK6A 2F6JA 2K4DA 5AIUA 5KH3A 1ZBDB 3O7AA 2KU3A 1FBVA 1E4UA 3HCSA 4PPEA 1MM2A 3M63A 3O33A 2HDPA 2KGIA 2MIQA 2VJEB 2ZETC 4FK5A 1X4JA 3ZPV1 1WEPA 2LGLA 4ZDTA 4A4BA 3N9PA 5TABA 3SOXA 2KREA 5B77A 1WEEA 4R8PK 3N9LA 1WESA 3FL2A 4YBMA 3EB6A 1JM7A 2DX8A 5FEYA 2PUYA 2MA6A 4WA6A 2Y1NA 4FJCA 2ECJA 3QZVA 4I7DA 4LLBA 2KR4A 3KQIA 4F52B 1Z6UA 3M62A 3PURA 4R2YA 5H1VA 5G05B 1WE9A 2KIZA 5G0FA 2CT2A 2KWJA 4NN2A 4I7BA 1WGMA 1XWHA 2AN6A 2YHOA 4S3OB 4A49A 1CHCA 2VJEA 5FB1A 5D1LB 3LQIA 3IHPA 4YBTA 4R7EA 2K16A 4IC2A 4QF2A 2KFTA 1WEUA 2YQMA 1VD4A 2EGPA 2YURA 1JM7B 4GNEA 2ECVA 3N9QA 3C6WA 4ZQLA 2C2VS 4XI1A 5C13A 2QICA 2LQ6A 2C2LA 2KYUA 1V87A 4YBSA 4ZUXU 2K1JA 5LKZA 1N87A 3DPLR 5DKAA 3O70A 2HYED 4L7XA 2YQLA 4UP0A 2Y1MA 3GV4A 2CSZA 3ZPVE 2LGVA 1RMDA 1U6GB 2KWNA 2MNZA 2OXQC 2LXHC 3O36A 2RI7A 3EB5A 5LKUA 1DVPA 2BAYA 2LGGA 3KV6A 1IYMA 5I3LA 2XB1A 4MSXA 2LGKA 5TDWA 2YW8A 1MM3A 4I7CA 2LRIC 2G6QA 4FO9A 2PNXA 1VYXA 2M85A 2VNFA 2IDAA 4WZ2A 4GNDA 5JG6A 1FP0A 2MD8C 5KH7A 4W4UA 1G25A 2YU4A 2MUMA 2E6SA 4YATA 4V3KC 4LADB 2KWOA 3ASLA 2M1RA 4YC9A 4GB0A 2L5UA 3C5KA 4MVTA 1WEOA 2XEUA 3RPGC 3ZYQA 4L58A 1T1HA 4FIPA 2L0BA 4V3LC 2FSAA 2YUCA 3HCUA 2ECIA 2LV9A 2MD7B 5B75A 2K17A 2M3HA 3SOWA 1JOCA 2NAAA 3U5OA 1HYJA 4YAXA 4N4FA 4YABA 2CKLB 3DQVR 2VP7A 2FUIA 5LCWB 2M6MA 3U5PA 5EYAF 2VJFB 4PTBA 3ZVYA 4UP5A 2LXPC 5TRBA 1LDKC 2ECWA 3N9MA 3LRQA 2L80A 2QJ0A 3SHBA 2H0DA 5H9MA 3MHSA 4CCGX 2YT5A 4WZ3B 1X4IA 3NG2A 5LKTA 5D1MB 4AVXA 2CSYA 2LDRA 5DINA 1WIMA 3SOUA 5G04B 4QF3A 2L43A 3T7LA 4P5OB 2Y43A 1WEWA 2MNYA 3O34A 1WFKA 2ECGA 4IC3A 2MT5A 3PUQA 1WEVA 2D8SA 2KE1A 3MHHA 4A0CD 5KH9A 1K2FA 3M99A 2L75A 1HYIA 3HCTA 2VPDA 2F6NA 2CKLA 5TBNA 2FUUA 2EODA 1WEQA 2QIZA 2VJFA 2VPGA 4AUQB 3ZTGA 5FERA 4C9ZA
chains in the Genus database with same CATH superfamily
4GNFA 2H0DB 3DDTA 3V43A 5B76A 3L1ZB 5AITA 1WILA 3L11A 2OWAA 2EA6A 4Q6FA 2ECNA 4TKPB 3FJUB 2MA5A 2YYRA 2F42A 2UZGA 1Z2QA 5FB0A 4A4CA 2KGGA 2JMIA 3LVQE 2CRRA 2VPEA 3L1XA 3KNVA 5H1UA 3RPGB 2LAUA 2XOZA 3N9NA 4O64A 5J3XA 3T6RA 3FM8C 2JMJA 3PHDA 3KV5A 2ECTA 5D1KB 1Z60A 3ZVZB 2YSJA 4CA1A 4AYCA 4YADA 5B79A 4B86C 3LQHA 2YHNA 4BHWA 2E6RA 2YREA 4S3OC 3KDEC 1F62A 4WZ0A 1WEMA 3N9OA 2JUNA 1X4UA 2VPBA 5K3QA 3O35A 1VFYA 1DCQA 4X3GA 2RSDA 4N3WA 3Q1DA 2G45A 4UI9B 3U5NA 2YSMA 5H1TA 2JM3A 3DWDA 4B7YC 4GNGA 5LKXA 3I2DA 1LDJB 3O37A 5TDRA 4LJNA 4LKAA 2G43A 3LQJA 2LN0A 2L7PA 5C11A 2D8UA 3GL6A 2JRJA 4OGCA 2JMDA 2I50A 3M7KA 4LK9A 5B8DA 4AP4A 5B78A 3U5MA 3ZNIA 4BBQA 1BORA 4AYCB 3HTKC 3RTRB 4F1PA 1WENA 2KWKA 3VK6A 2F6JA 2K4DA 2B0OE 5AIUA 5KH3A 1ZBDB 3O7AA 1MBMA 2KU3A 1FBVA 1E4UA 3HCSA 4PPEA 1MM2A 3M63A 3O33A 2HDPA 2KGIA 2MIQA 2VJEB 2ZETC 4FK5A 2CSVA 2IQJA 1X4JA 3LVRE 3ZPV1 1WEPA 2LGLA 3FAOA 4ZDTA 4A4BA 3N9PA 5TABA 3SOXA 2KREA 5B77A 5SVYA 1WEEA 4R8PK 3N9LA 1WESA 3FL2A 4YBMA 3EB6A 1JM7A 2DX8A 4Z0OA 5FEYA 2PUYA 3FEHA 2MA6A 4WA6A 2Y1NA 4FJCA 2ECJA 3QZVA 4I7DA 4LLBA 3LDYA 2KR4A 3KQIA 4F52B 1Z6UA 3M62A 3PURA 4H9DA 4R2YA 5H1VA 5G05B 1WE9A 2KIZA 5G0FA 2CT2A 3O47A 2KWJA 4NN2A 4I7BA 1WGMA 1XWHA 2AN6A 2YHOA 4S3OB 4A49A 1CHCA 2VJEA 5FB1A 5D1LB 2XOCA 3LQIA 3IHPA 4YBTA 4R7EA 2K16A 4IC2A 4QF2A 2RR4A 2KFTA 2EGMA 1WEUA 2YQMA 1VD4A 2EGPA 2YURA 2FD4A 1JM7B 4GNEA 2ECVA 3N9QA 3C6WA 4ZQLA 2C2VS 4XI1A 5C13A 2KKXA 2QICA 2LQ6A 2C2LA 2KYUA 1V87A 4YBSA 4ZUXU 2K1JA 5SVXA 5LKZA 1N87A 2M13A 3DPLR 5DKAA 3T9KA 3O70A 2HYED 4L7XA 2YQLA 4UP0A 2Y1MA 3GV4A 5SVIA 2CSZA 3ZPVE 2LGVA 1RMDA 1U6GB 2XOYA 2KWNA 2MNZA 2OXQC 2LXHC 3O36A 2RI7A 3EB5A 5LKUA 1DVPA 4QQ4A 2CONA 2BAYA 2LGGA 3KV6A 1IYMA 5I3LA 2P57A 2XB1A 4MSXA 2LGKA 5TDWA 2YW8A 1MM3A 3JUEA 4I7CA 2LRIC 2G6QA 4FO9A 2PNXA 1VYXA 2M85A 2VNFA 2IDAA 2DJAA 4WZ2A 4GNDA 5JG6A 1FP0A 2MD8C 5KH7A 4W4UA 1G25A 2YU4A 2MUMA 2E6SA 4YATA 4V3KC 4LADB 2KWOA 3LJUX 3SUBA 3ASLA 2M1RA 4YC9A 2FFWA 4GB0A 2L5UA 2YVRA 3C5KA 5SVIB 4MVTA 1WEOA 2XEUA 4O62A 3RPGC 3ZYQA 4L58A 2E61A 2XP0A 1T1HA 4FIPA 2L0BA 4V3LC 2FSAA 2YUCA 3HCUA 2ECIA 2LV9A 2MD7B 5B75A 2K17A 2KKYA 2M3HA 1JOCA 3SOWA 2NAAA 3U5OA 1HYJA 4YAXA 4N4FA 2EXUA 3FANA 4YABA 2CKLB 3DQVR 2VP7A 2FUIA 5LCWB 2M6MA 3U5PA 5EYAF 2VJFB 4PTBA 3ZVYA 4UP5A 2LXPC 5TRBA 1LDKC 2ECWA 3N9MA 4OGEA 2CRWA 3LRQA 2L80A 3E2DA 3H7HA 2QJ0A 3SHBA 2H0DA 5H9MA 3MHSA 4CCGX 2YT5A 4WZ3B 1X4IA 3NG2A 5LKTA 2DSMA 4Z0RA 5D1MB 4AVXA 2CSYA 2LDRA 5DINA 1WIMA 3SOUA 5G04B 2MKEA 4QF3A 2L43A 3T7LA 4P5OB 2Y43A 1WEWA 2MNYA 3O34A 1WFKA 3MDBC 2ECGA 4IC3A 3PLWA 2MT5A 3PUQA 1WEVA 2D8SA 2KE1A 3MHHA 4A0CD 5KH9A 1K2FA 3M99A 2L75A 1HYIA 3HCTA 2VPDA 2F6NA 2CKLA 5TBNA 2FUUA 2EODA 1WEQA 2QIZA 2VJFA 2VPGA 4AUQB 3ZTGA 5FERA 4C9ZA
chains in the Genus database with same CATH topology
4GNFA 2H0DB 3V43A 5B76A 3L1ZB 5AITA 1WILA 3L11A 2EA6A 4Q6FA 2ECNA 4TKPB 2MA5A 2YYRA 2F42A 2UZGA 1Z2QA 5FB0A 4A4CA 2KGGA 2JMIA 2VPEA 3L1XA 3KNVA 5H1UA 3RPGB 3N9NA 4O64A 5J3XA 3T6RA 2JMJA 3PHDA 3KV5A 2ECTA 5D1KB 1Z60A 3ZVZB 2YSJA 4CA1A 4AYCA 4YADA 5B79A 4B86C 3LQHA 2YHNA 4BHWA 2E6RA 2YREA 4S3OC 1F62A 4WZ0A 1WEMA 3N9OA 1X4UA 2VPBA 3O35A 1VFYA 4X3GA 2RSDA 4N3WA 2G45A 4UI9B 3U5NA 2YSMA 5H1TA 4B7YC 4GNGA 5LKXA 3I2DA 1LDJB 3O37A 5TDRA 4LJNA 4LKAA 2G43A 3LQJA 2LN0A 5C11A 3GL6A 2JRJA 2JMDA 2I50A 4LK9A 5B8DA 4AP4A 5B78A 3U5MA 3ZNIA 4BBQA 1BORA 4AYCB 3HTKC 3RTRB 1WENA 2KWKA 3VK6A 2F6JA 2K4DA 5AIUA 5KH3A 1ZBDB 3O7AA 2KU3A 1FBVA 1E4UA 3HCSA 4PPEA 1MM2A 3M63A 3O33A 2HDPA 2KGIA 2MIQA 2VJEB 2ZETC 4FK5A 1X4JA 3ZPV1 1WEPA 2LGLA 4ZDTA 4A4BA 3N9PA 5TABA 3SOXA 2KREA 5B77A 1WEEA 4R8PK 3N9LA 1WESA 3FL2A 4YBMA 3EB6A 1JM7A 2DX8A 5FEYA 2PUYA 2MA6A 4WA6A 2Y1NA 4FJCA 2ECJA 3QZVA 4I7DA 4LLBA 2KR4A 3KQIA 4F52B 1Z6UA 3M62A 3PURA 4R2YA 5H1VA 5G05B 1WE9A 2KIZA 5G0FA 2CT2A 2KWJA 4NN2A 4I7BA 1WGMA 1XWHA 2AN6A 2YHOA 4S3OB 4A49A 1CHCA 2VJEA 5FB1A 5D1LB 3LQIA 3IHPA 4YBTA 4R7EA 2K16A 4IC2A 4QF2A 2KFTA 1WEUA 2YQMA 1VD4A 2EGPA 2YURA 1JM7B 4GNEA 2ECVA 3N9QA 3C6WA 4ZQLA 2C2VS 4XI1A 5C13A 2QICA 2LQ6A 2C2LA 2KYUA 1V87A 4YBSA 4ZUXU 2K1JA 5LKZA 1N87A 3DPLR 5DKAA 3O70A 2HYED 4L7XA 2YQLA 4UP0A 2Y1MA 3GV4A 2CSZA 3ZPVE 2LGVA 1RMDA 1U6GB 2KWNA 2MNZA 2OXQC 2LXHC 3O36A 2RI7A 3EB5A 5LKUA 1DVPA 2BAYA 2LGGA 3KV6A 1IYMA 5I3LA 2XB1A 4MSXA 2LGKA 5TDWA 2YW8A 1MM3A 4I7CA 2LRIC 2G6QA 4FO9A 2PNXA 1VYXA 2M85A 2VNFA 2IDAA 4WZ2A 4GNDA 5JG6A 1FP0A 2MD8C 5KH7A 4W4UA 1G25A 2YU4A 2MUMA 2E6SA 4YATA 4V3KC 4LADB 2KWOA 3ASLA 2M1RA 4YC9A 4GB0A 2L5UA 3C5KA 4MVTA 1WEOA 2XEUA 3RPGC 3ZYQA 4L58A 1T1HA 4FIPA 2L0BA 4V3LC 2FSAA 2YUCA 3HCUA 2ECIA 2LV9A 2MD7B 5B75A 2K17A 2M3HA 3SOWA 1JOCA 2NAAA 3U5OA 1HYJA 4YAXA 4N4FA 4YABA 2CKLB 3DQVR 2VP7A 2FUIA 5LCWB 2M6MA 3U5PA 5EYAF 2VJFB 4PTBA 3ZVYA 4UP5A 2LXPC 5TRBA 1LDKC 2ECWA 3N9MA 3LRQA 2L80A 2QJ0A 3SHBA 2H0DA 5H9MA 3MHSA 4CCGX 2YT5A 4WZ3B 1X4IA 3NG2A 5LKTA 5D1MB 4AVXA 2CSYA 2LDRA 5DINA 1WIMA 3SOUA 5G04B 4QF3A 2L43A 3T7LA 4P5OB 2Y43A 1WEWA 2MNYA 3O34A 1WFKA 2ECGA 4IC3A 2MT5A 3PUQA 1WEVA 2D8SA 2KE1A 3MHHA 4A0CD 5KH9A 1K2FA 3M99A 2L75A 1HYIA 3HCTA 2VPDA 2F6NA 2CKLA 5TBNA 2FUUA 2EODA 1WEQA 2QIZA 2VJFA 2VPGA 4AUQB 3ZTGA 5FERA 4C9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNF A;  2H0D B;  3V43 A;  5B76 A;  3L1Z B;  5AIT A;  1WIL A;  3L11 A;  2EA6 A;  4Q6F A;  2ECN A;  4TKP B;  2MA5 A;  2YYR A;  2F42 A;  2UZG A;  1Z2Q A;  5FB0 A;  4A4C A;  2KGG A;  2JMI A;  2VPE A;  3L1X A;  3KNV A;  5H1U A;  3RPG B;  3N9N A;  4O64 A;  5J3X A;  3T6R A;  2JMJ A;  3PHD A;  3KV5 A;  2ECT A;  5D1K B;  1Z60 A;  3ZVZ B;  2YSJ A;  4CA1 A;  4AYC A;  4YAD A;  5B79 A;  4B86 C;  3LQH A;  2YHN A;  4BHW A;  2E6R A;  2YRE A;  4S3O C;  1F62 A;  4WZ0 A;  1WEM A;  3N9O A;  1X4U A;  2VPB A;  3O35 A;  1VFY A;  4X3G A;  2RSD A;  4N3W A;  2G45 A;  4UI9 B;  3U5N A;  2YSM A;  5H1T A;  4B7Y C;  4GNG A;  5LKX A;  3I2D A;  1LDJ B;  3O37 A;  5TDR A;  4LJN A;  4LKA A;  2G43 A;  3LQJ A;  2LN0 A;  5C11 A;  3GL6 A;  2JRJ A;  2JMD A;  2I50 A;  4LK9 A;  5B8D A;  4AP4 A;  5B78 A;  3U5M A;  3ZNI A;  4BBQ A;  1BOR A;  4AYC B;  3HTK C;  3RTR B;  1WEN A;  2KWK A;  3VK6 A;  2F6J A;  2K4D A;  5AIU A;  5KH3 A;  1ZBD B;  3O7A A;  2KU3 A;  1FBV A;  1E4U A;  3HCS A;  4PPE A;  1MM2 A;  3M63 A;  3O33 A;  2HDP A;  2KGI A;  2MIQ A;  2VJE B;  2ZET C;  4FK5 A;  1X4J A;  3ZPV 1;  1WEP A;  2LGL A;  4ZDT A;  4A4B A;  3N9P A;  5TAB A;  3SOX A;  2KRE A;  5B77 A;  1WEE A;  4R8P K;  3N9L A;  1WES A;  3FL2 A;  4YBM A;  3EB6 A;  1JM7 A;  2DX8 A;  5FEY A;  2PUY A;  2MA6 A;  4WA6 A;  2Y1N A;  4FJC A;  2ECJ A;  3QZV A;  4I7D A;  4LLB A;  2KR4 A;  3KQI A;  4F52 B;  1Z6U A;  3M62 A;  3PUR A;  4R2Y A;  5H1V A;  5G05 B;  1WE9 A;  2KIZ A;  5G0F A;  2CT2 A;  2KWJ A;  4NN2 A;  4I7B A;  1WGM A;  1XWH A;  2AN6 A;  2YHO A;  4S3O B;  4A49 A;  1CHC A;  2VJE A;  5FB1 A;  5D1L B;  3LQI A;  3IHP A;  4YBT A;  4R7E A;  2K16 A;  4IC2 A;  4QF2 A;  2KFT A;  1WEU A;  2YQM A;  1VD4 A;  2EGP A;  2YUR A;  1JM7 B;  4GNE A;  2ECV A;  3N9Q A;  3C6W A;  4ZQL A;  2C2V S;  4XI1 A;  5C13 A;  2QIC A;  2LQ6 A;  2C2L A;  2KYU A;  1V87 A;  4YBS A;  4ZUX U;  2K1J A;  5LKZ A;  1N87 A;  3DPL R;  5DKA A;  3O70 A;  2HYE D;  4L7X A;  2YQL A;  4UP0 A;  2Y1M A;  3GV4 A;  2CSZ A;  3ZPV E;  2LGV A;  1RMD A;  1U6G B;  2KWN A;  2MNZ A;  2OXQ C;  2LXH C;  3O36 A;  2RI7 A;  3EB5 A;  5LKU A;  1DVP A;  2BAY A;  2LGG A;  3KV6 A;  1IYM A;  5I3L A;  2XB1 A;  4MSX A;  2LGK A;  5TDW A;  2YW8 A;  1MM3 A;  4I7C A;  2LRI C;  2G6Q A;  4FO9 A;  2PNX A;  1VYX A;  2M85 A;  2VNF A;  2IDA A;  4WZ2 A;  4GND A;  5JG6 A;  1FP0 A;  2MD8 C;  5KH7 A;  4W4U A;  1G25 A;  2YU4 A;  2MUM A;  2E6S A;  4YAT A;  4V3K C;  4LAD B;  2KWO A;  3ASL A;  2M1R A;  4YC9 A;  4GB0 A;  2L5U A;  3C5K A;  4MVT A;  1WEO A;  2XEU A;  3RPG C;  3ZYQ A;  4L58 A;  1T1H A;  4FIP A;  2L0B A;  4V3L C;  2FSA A;  2YUC A;  3HCU A;  2ECI A;  2LV9 A;  2MD7 B;  5B75 A;  2K17 A;  2M3H A;  3SOW A;  1JOC A;  2NAA A;  3U5O A;  1HYJ A;  4YAX A;  4N4F A;  4YAB A;  2CKL B;  3DQV R;  2VP7 A;  2FUI A;  5LCW B;  2M6M A;  3U5P A;  5EYA F;  2VJF B;  4PTB A;  3ZVY A;  4UP5 A;  2LXP C;  5TRB A;  1LDK C;  2ECW A;  3N9M A;  3LRQ A;  2L80 A;  2QJ0 A;  3SHB A;  2H0D A;  5H9M A;  3MHS A;  4CCG X;  2YT5 A;  4WZ3 B;  1X4I A;  3NG2 A;  5LKT A;  5D1M B;  4AVX A;  2CSY A;  2LDR A;  5DIN A;  1WIM A;  3SOU A;  5G04 B;  4QF3 A;  2L43 A;  3T7L A;  4P5O B;  2Y43 A;  1WEW A;  2MNY A;  3O34 A;  1WFK A;  2ECG A;  4IC3 A;  2MT5 A;  3PUQ A;  1WEV A;  2D8S A;  2KE1 A;  3MHH A;  4A0C D;  5KH9 A;  1K2F A;  3M99 A;  2L75 A;  1HYI A;  3HCT A;  2VPD A;  2F6N A;  2CKL A;  5TBN A;  2FUU A;  2EOD A;  1WEQ A;  2QIZ A;  2VJF A;  2VPG A;  4AUQ B;  3ZTG A;  5FER A;  4C9Z A; 
#chains in the Genus database with same CATH topology
 4GNF A;  2H0D B;  3DDT A;  3V43 A;  5B76 A;  3L1Z B;  5AIT A;  1WIL A;  3L11 A;  2OWA A;  2EA6 A;  4Q6F A;  2ECN A;  4TKP B;  3FJU B;  2MA5 A;  2YYR A;  2F42 A;  2UZG A;  1Z2Q A;  5FB0 A;  4A4C A;  2KGG A;  2JMI A;  3LVQ E;  2CRR A;  2VPE A;  3L1X A;  3KNV A;  5H1U A;  3RPG B;  2LAU A;  2XOZ A;  3N9N A;  4O64 A;  5J3X A;  3T6R A;  3FM8 C;  2JMJ A;  3PHD A;  3KV5 A;  2ECT A;  5D1K B;  1Z60 A;  3ZVZ B;  2YSJ A;  4CA1 A;  4AYC A;  4YAD A;  5B79 A;  4B86 C;  3LQH A;  2YHN A;  4BHW A;  2E6R A;  2YRE A;  4S3O C;  3KDE C;  1F62 A;  4WZ0 A;  1WEM A;  3N9O A;  2JUN A;  1X4U A;  2VPB A;  5K3Q A;  3O35 A;  1VFY A;  1DCQ A;  4X3G A;  2RSD A;  4N3W A;  3Q1D A;  2G45 A;  4UI9 B;  3U5N A;  2YSM A;  5H1T A;  2JM3 A;  3DWD A;  4B7Y C;  4GNG A;  5LKX A;  3I2D A;  1LDJ B;  3O37 A;  5TDR A;  4LJN A;  4LKA A;  2G43 A;  3LQJ A;  2LN0 A;  2L7P A;  5C11 A;  2D8U A;  3GL6 A;  2JRJ A;  4OGC A;  2JMD A;  2I50 A;  3M7K A;  4LK9 A;  5B8D A;  4AP4 A;  5B78 A;  3U5M A;  3ZNI A;  4BBQ A;  1BOR A;  4AYC B;  3HTK C;  3RTR B;  4F1P A;  1WEN A;  2KWK A;  3VK6 A;  2F6J A;  2K4D A;  2B0O E;  5AIU A;  5KH3 A;  1ZBD B;  3O7A A;  1MBM A;  2KU3 A;  1FBV A;  1E4U A;  3HCS A;  4PPE A;  1MM2 A;  3M63 A;  3O33 A;  2HDP A;  2KGI A;  2MIQ A;  2VJE B;  2ZET C;  4FK5 A;  2CSV A;  2IQJ A;  1X4J A;  3LVR E;  3ZPV 1;  1WEP A;  2LGL A;  3FAO A;  4ZDT A;  4A4B A;  3N9P A;  5TAB A;  3SOX A;  2KRE A;  5B77 A;  5SVY A;  1WEE A;  4R8P K;  3N9L A;  1WES A;  3FL2 A;  4YBM A;  3EB6 A;  1JM7 A;  2DX8 A;  4Z0O A;  5FEY A;  2PUY A;  3FEH A;  2MA6 A;  4WA6 A;  2Y1N A;  4FJC A;  2ECJ A;  3QZV A;  4I7D A;  4LLB A;  3LDY A;  2KR4 A;  3KQI A;  4F52 B;  1Z6U A;  3M62 A;  3PUR A;  4H9D A;  4R2Y A;  5H1V A;  5G05 B;  1WE9 A;  2KIZ A;  5G0F A;  2CT2 A;  3O47 A;  2KWJ A;  4NN2 A;  4I7B A;  1WGM A;  1XWH A;  2AN6 A;  2YHO A;  4S3O B;  4A49 A;  1CHC A;  2VJE A;  5FB1 A;  5D1L B;  2XOC A;  3LQI A;  3IHP A;  4YBT A;  4R7E A;  2K16 A;  4IC2 A;  4QF2 A;  2RR4 A;  2KFT A;  2EGM A;  1WEU A;  2YQM A;  1VD4 A;  2EGP A;  2YUR A;  2FD4 A;  1JM7 B;  4GNE A;  2ECV A;  3N9Q A;  3C6W A;  4ZQL A;  2C2V S;  4XI1 A;  5C13 A;  2KKX A;  2QIC A;  2LQ6 A;  2C2L A;  2KYU A;  1V87 A;  4YBS A;  4ZUX U;  2K1J A;  5SVX A;  5LKZ A;  1N87 A;  2M13 A;  3DPL R;  5DKA A;  3T9K A;  3O70 A;  2HYE D;  4L7X A;  2YQL A;  4UP0 A;  2Y1M A;  3GV4 A;  5SVI A;  2CSZ A;  3ZPV E;  2LGV A;  1RMD A;  1U6G B;  2XOY A;  2KWN A;  2MNZ A;  2OXQ C;  2LXH C;  3O36 A;  2RI7 A;  3EB5 A;  5LKU A;  1DVP A;  4QQ4 A;  2CON A;  2BAY A;  2LGG A;  3KV6 A;  1IYM A;  5I3L A;  2P57 A;  2XB1 A;  4MSX A;  2LGK A;  5TDW A;  2YW8 A;  1MM3 A;  3JUE A;  4I7C A;  2LRI C;  2G6Q A;  4FO9 A;  2PNX A;  1VYX A;  2M85 A;  2VNF A;  2IDA A;  2DJA A;  4WZ2 A;  4GND A;  5JG6 A;  1FP0 A;  2MD8 C;  5KH7 A;  4W4U A;  1G25 A;  2YU4 A;  2MUM A;  2E6S A;  4YAT A;  4V3K C;  4LAD B;  2KWO A;  3LJU X;  3SUB A;  3ASL A;  2M1R A;  4YC9 A;  2FFW A;  4GB0 A;  2L5U A;  2YVR A;  3C5K A;  5SVI B;  4MVT A;  1WEO A;  2XEU A;  4O62 A;  3RPG C;  3ZYQ A;  4L58 A;  2E61 A;  2XP0 A;  1T1H A;  4FIP A;  2L0B A;  4V3L C;  2FSA A;  2YUC A;  3HCU A;  2ECI A;  2LV9 A;  2MD7 B;  5B75 A;  2K17 A;  2KKY A;  2M3H A;  1JOC A;  3SOW A;  2NAA A;  3U5O A;  1HYJ A;  4YAX A;  4N4F A;  2EXU A;  3FAN A;  4YAB A;  2CKL B;  3DQV R;  2VP7 A;  2FUI A;  5LCW B;  2M6M A;  3U5P A;  5EYA F;  2VJF B;  4PTB A;  3ZVY A;  4UP5 A;  2LXP C;  5TRB A;  1LDK C;  2ECW A;  3N9M A;  4OGE A;  2CRW A;  3LRQ A;  2L80 A;  3E2D A;  3H7H A;  2QJ0 A;  3SHB A;  2H0D A;  5H9M A;  3MHS A;  4CCG X;  2YT5 A;  4WZ3 B;  1X4I A;  3NG2 A;  5LKT A;  2DSM A;  4Z0R A;  5D1M B;  4AVX A;  2CSY A;  2LDR A;  5DIN A;  1WIM A;  3SOU A;  5G04 B;  2MKE A;  4QF3 A;  2L43 A;  3T7L A;  4P5O B;  2Y43 A;  1WEW A;  2MNY A;  3O34 A;  1WFK A;  3MDB C;  2ECG A;  4IC3 A;  3PLW A;  2MT5 A;  3PUQ A;  1WEV A;  2D8S A;  2KE1 A;  3MHH A;  4A0C D;  5KH9 A;  1K2F A;  3M99 A;  2L75 A;  1HYI A;  3HCT A;  2VPD A;  2F6N A;  2CKL A;  5TBN A;  2FUU A;  2EOD A;  1WEQ A;  2QIZ A;  2VJF A;  2VPG A;  4AUQ B;  3ZTG A;  5FER A;  4C9Z A; 
#chains in the Genus database with same CATH homology
 4GNF A;  2H0D B;  3V43 A;  5B76 A;  3L1Z B;  5AIT A;  1WIL A;  3L11 A;  2EA6 A;  4Q6F A;  2ECN A;  4TKP B;  2MA5 A;  2YYR A;  2F42 A;  2UZG A;  1Z2Q A;  5FB0 A;  4A4C A;  2KGG A;  2JMI A;  2VPE A;  3L1X A;  3KNV A;  5H1U A;  3RPG B;  3N9N A;  4O64 A;  5J3X A;  3T6R A;  2JMJ A;  3PHD A;  3KV5 A;  2ECT A;  5D1K B;  1Z60 A;  3ZVZ B;  2YSJ A;  4CA1 A;  4AYC A;  4YAD A;  5B79 A;  4B86 C;  3LQH A;  2YHN A;  4BHW A;  2E6R A;  2YRE A;  4S3O C;  1F62 A;  4WZ0 A;  1WEM A;  3N9O A;  1X4U A;  2VPB A;  3O35 A;  1VFY A;  4X3G A;  2RSD A;  4N3W A;  2G45 A;  4UI9 B;  3U5N A;  2YSM A;  5H1T A;  4B7Y C;  4GNG A;  5LKX A;  3I2D A;  1LDJ B;  3O37 A;  5TDR A;  4LJN A;  4LKA A;  2G43 A;  3LQJ A;  2LN0 A;  5C11 A;  3GL6 A;  2JRJ A;  2JMD A;  2I50 A;  4LK9 A;  5B8D A;  4AP4 A;  5B78 A;  3U5M A;  3ZNI A;  4BBQ A;  1BOR A;  4AYC B;  3HTK C;  3RTR B;  1WEN A;  2KWK A;  3VK6 A;  2F6J A;  2K4D A;  5AIU A;  5KH3 A;  1ZBD B;  3O7A A;  2KU3 A;  1FBV A;  1E4U A;  3HCS A;  4PPE A;  1MM2 A;  3M63 A;  3O33 A;  2HDP A;  2KGI A;  2MIQ A;  2VJE B;  2ZET C;  4FK5 A;  1X4J A;  3ZPV 1;  1WEP A;  2LGL A;  4ZDT A;  4A4B A;  3N9P A;  5TAB A;  3SOX A;  2KRE A;  5B77 A;  1WEE A;  4R8P K;  3N9L A;  1WES A;  3FL2 A;  4YBM A;  3EB6 A;  1JM7 A;  2DX8 A;  5FEY A;  2PUY A;  2MA6 A;  4WA6 A;  2Y1N A;  4FJC A;  2ECJ A;  3QZV A;  4I7D A;  4LLB A;  2KR4 A;  3KQI A;  4F52 B;  1Z6U A;  3M62 A;  3PUR A;  4R2Y A;  5H1V A;  5G05 B;  1WE9 A;  2KIZ A;  5G0F A;  2CT2 A;  2KWJ A;  4NN2 A;  4I7B A;  1WGM A;  1XWH A;  2AN6 A;  2YHO A;  4S3O B;  4A49 A;  1CHC A;  2VJE A;  5FB1 A;  5D1L B;  3LQI A;  3IHP A;  4YBT A;  4R7E A;  2K16 A;  4IC2 A;  4QF2 A;  2KFT A;  1WEU A;  2YQM A;  1VD4 A;  2EGP A;  2YUR A;  1JM7 B;  4GNE A;  2ECV A;  3N9Q A;  3C6W A;  4ZQL A;  2C2V S;  4XI1 A;  5C13 A;  2QIC A;  2LQ6 A;  2C2L A;  2KYU A;  1V87 A;  4YBS A;  4ZUX U;  2K1J A;  5LKZ A;  1N87 A;  3DPL R;  5DKA A;  3O70 A;  2HYE D;  4L7X A;  2YQL A;  4UP0 A;  2Y1M A;  3GV4 A;  2CSZ A;  3ZPV E;  2LGV A;  1RMD A;  1U6G B;  2KWN A;  2MNZ A;  2OXQ C;  2LXH C;  3O36 A;  2RI7 A;  3EB5 A;  5LKU A;  1DVP A;  2BAY A;  2LGG A;  3KV6 A;  1IYM A;  5I3L A;  2XB1 A;  4MSX A;  2LGK A;  5TDW A;  2YW8 A;  1MM3 A;  4I7C A;  2LRI C;  2G6Q A;  4FO9 A;  2PNX A;  1VYX A;  2M85 A;  2VNF A;  2IDA A;  4WZ2 A;  4GND A;  5JG6 A;  1FP0 A;  2MD8 C;  5KH7 A;  4W4U A;  1G25 A;  2YU4 A;  2MUM A;  2E6S A;  4YAT A;  4V3K C;  4LAD B;  2KWO A;  3ASL A;  2M1R A;  4YC9 A;  4GB0 A;  2L5U A;  3C5K A;  4MVT A;  1WEO A;  2XEU A;  3RPG C;  3ZYQ A;  4L58 A;  1T1H A;  4FIP A;  2L0B A;  4V3L C;  2FSA A;  2YUC A;  3HCU A;  2ECI A;  2LV9 A;  2MD7 B;  5B75 A;  2K17 A;  2M3H A;  3SOW A;  1JOC A;  2NAA A;  3U5O A;  1HYJ A;  4YAX A;  4N4F A;  4YAB A;  2CKL B;  3DQV R;  2VP7 A;  2FUI A;  5LCW B;  2M6M A;  3U5P A;  5EYA F;  2VJF B;  4PTB A;  3ZVY A;  4UP5 A;  2LXP C;  5TRB A;  1LDK C;  2ECW A;  3N9M A;  3LRQ A;  2L80 A;  2QJ0 A;  3SHB A;  2H0D A;  5H9M A;  3MHS A;  4CCG X;  2YT5 A;  4WZ3 B;  1X4I A;  3NG2 A;  5LKT A;  5D1M B;  4AVX A;  2CSY A;  2LDR A;  5DIN A;  1WIM A;  3SOU A;  5G04 B;  4QF3 A;  2L43 A;  3T7L A;  4P5O B;  2Y43 A;  1WEW A;  2MNY A;  3O34 A;  1WFK A;  2ECG A;  4IC3 A;  2MT5 A;  3PUQ A;  1WEV A;  2D8S A;  2KE1 A;  3MHH A;  4A0C D;  5KH9 A;  1K2F A;  3M99 A;  2L75 A;  1HYI A;  3HCT A;  2VPD A;  2F6N A;  2CKL A;  5TBN A;  2FUU A;  2EOD A;  1WEQ A;  2QIZ A;  2VJF A;  2VPG A;  4AUQ B;  3ZTG A;  5FER A;  4C9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...