2M1RA

Phd domain of ing4 n214d mutant
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
63
structure length
63
Chain Sequence
MDMPVDPNEPTYCLCHQVSYGEMIGCDDPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Inhibitor of growth protein 4
publication title Functional impact of cancer-associated mutations in the tumor suppressor protein ING4.
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m1rA00
3VK6A 3RPGB 4FJCA 3M63A 3PURA 2JMJA 2YW8A 3ZVYA 2RI7A 3ZNIA 3DPLR 2KFTA 2LRIC 2EODA 2PNXA 2VP7A 4AUQB 2K1JA 3T6RA 1WESA 2M3HA 3ZTGA 4A0CD 4MVTA 2CT2A 1WIMA 3I2DA 4L7XA 5KH7A 1WILA 3MHSA 4YBTA 5G04B 3SHBA 2FUIA 4ZUXU 3ZPV1 1IYMA 1Z2QA 2E6RA 2LGKA 2XEUA 3M62A 2L43A 2M1RA 4AYCB 2KWKA 2L5UA 2C2VS 4IC3A 3LQIA 1VD4A 5B79A 4PTBA 1MM3A 1JOCA 4S3OC 4FIPA 1FBVA 4AP4A 5J3XA 1N87A 1HYIA 2YREA 2JMIA 2QICA 4I7CA 5LKUA 2Y43A 3HCSA 1WEUA 1WE9A 2XB1A 3C5KA 5DINA 1LDKC 3T7LA 5TDWA 1Z60A 2LN0A 5KH9A 2ZETC 2MA6A 3O36A 4MSXA 2E6SA 1WFKA 3ZYQA 2JMDA 1WENA 4UI9B 3L11A 5I3LA 4QF3A 1E4UA 4F52B 3U5MA 4IC2A 5B78A 2ECNA 4WA6A 4Q6FA 4UP5A 1X4JA 3PHDA 3LQJA 5LKTA 5FB1A 5H1TA 1BORA 2Y1MA 2VJFA 4GNGA 2FSAA 2MD7B 2VJFB 4YC9A 2KGGA 4R8PK 2ECJA 2YU4A 4CCGX 2HYED 2Y1NA 5D1LB 2AN6A 4NN2A 4W4UA 2EA6A 2F6NA 4GB0A 1WEQA 1Z6UA 3RTRB 3U5NA 2ECGA 4V3LC 3SOUA 3SOWA 2YYRA 3O33A 3RPGC 2BAYA 1G25A 5C13A 2KU3A 4LLBA 5JG6A 2KIZA 3LQHA 4YADA 2K4DA 2MD8C 3V43A 2QJ0A 2MNZA 4TKPB 4B86C 2KYUA 2VJEA 4C9ZA 2YSMA 4FK5A 2LXHC 1XWHA 3GV4A 4N3WA 2C2LA 3U5PA 3IHPA 4O64A 2YT5A 2H0DA 5H1UA 4CA1A 2CKLA 1MM2A 1WGMA 1JM7A 2LV9A 4R2YA 2D8SA 2H0DB 4I7BA 3EB6A 2QIZA 3ZVZB 5G0FA 3N9MA 3O37A 4WZ2A 5LKZA 3ASLA 2ECWA 4ZQLA 4A4CA 5B8DA 5G05B 5B76A 4GNEA 1WEEA 2YHNA 5H1VA 1VYXA 2L0BA 2G6QA 3KNVA 2JRJA 1ZBDB 1RMDA 1CHCA 4YATA 5D1KB 3HCTA 2KR4A 2YQLA 2KWNA 2YUCA 2OXQC 5FEYA 5B75A 2VNFA 3O34A 3O7AA 5LKXA 5AITA 5B77A 2CSZA 2LXPC 4QF2A 1V87A 3N9PA 2VPBA 1LDJB 5H9MA 2G43A 4GNDA 2DX8A 2KGIA 4YBSA 5DKAA 4ZDTA 1X4IA 3ZPVE 2I50A 4WZ3B 2UZGA 4PPEA 3KQIA 5TABA 4A4BA 3M99A 1HYJA 4LADB 4R7EA 1U6GB 2IDAA 2MNYA 4GNFA 3N9OA 4A49A 4X3GA 5AIUA 1FP0A 1T1HA 4N4FA 2YQMA 2RSDA 3KV6A 2FUUA 2VPDA 2K16A 2VPGA 2HDPA 2M6MA 2L75A 2VJEB 2KWJA 3PUQA 4WZ0A 2LGLA 4S3OB 1VFYA 3GL6A 4AVXA 2YURA 4AYCA 2CSYA 4BHWA 4I7DA 2F6JA 3O35A 3O70A 2K17A 4FO9A 3SOXA 5FB0A 2CKLB 1JM7B 2PUYA 2ECVA 2G45A 2YHOA 4V3KC 3C6WA 4P5OB 2NAAA 3FL2A 3EB5A 1WEMA 5FERA 2MUMA 2YSJA 1DVPA 3KV5A 3L1ZB 5LCWB 1WEVA 3N9NA 2MIQA 3N9QA 1K2FA 4YBMA 2ECIA 3MHHA 5TRBA 4B7YC 2ECTA 2KREA 1X4UA 5D1MB 4LK9A 3HTKC 5TDRA 4XI1A 3NG2A 2L80A 2MT5A 4UP0A 3LRQA 1WEOA 4LKAA 1F62A 4L58A 3U5OA 2EGPA 2LDRA 5C11A 3HCUA 5EYAF 2KWOA 1WEPA 3DQVR 3N9LA 4YABA 2LGGA 2LQ6A 4LJNA 5KH3A 2VPEA 2F42A 1WEWA 2MA5A 4YAXA 3QZVA 2KE1A 4BBQA 2LGVA 5TBNA 3L1XA 2M85A
chains in the Genus database with same CATH superfamily
3VK6A 2IQJA 3RPGB 3M7KA 4FJCA 3M63A 3PURA 2JMJA 2YW8A 3ZVYA 2RI7A 3ZNIA 3DPLR 5SVIA 2KFTA 2LRIC 2XOCA 2EODA 2PNXA 2VP7A 2XP0A 4AUQB 2K1JA 3T6RA 1WESA 2M3HA 3ZTGA 4A0CD 4MVTA 2CT2A 1WIMA 3I2DA 4L7XA 5KH7A 1WILA 3MHSA 4YBTA 5G04B 3DWDA 3SHBA 2FUIA 1DCQA 4ZUXU 3ZPV1 1IYMA 1Z2QA 2E6RA 2LGKA 2XEUA 3M62A 2L43A 3MDBC 2M1RA 4AYCB 2KWKA 2L5UA 2C2VS 4IC3A 3LQIA 1VD4A 5B79A 4PTBA 1MM3A 1JOCA 4S3OC 4FIPA 1FBVA 4AP4A 5J3XA 1N87A 2DJAA 2RR4A 1HYIA 2YREA 2JMIA 2QICA 2CRRA 4I7CA 5LKUA 2Y43A 3HCSA 2MKEA 1WEUA 1WE9A 2XOYA 2XB1A 3C5KA 5DINA 1LDKC 3T7LA 5TDWA 1Z60A 3LVRE 2LN0A 5KH9A 2ZETC 2MA6A 3O36A 4MSXA 4OGCA 2OWAA 2YVRA 2E6SA 1WFKA 3ZYQA 2JMDA 1WENA 4UI9B 3L11A 1MBMA 5I3LA 4QF3A 1E4UA 4F52B 4Z0OA 3U5MA 4IC2A 2M13A 4O62A 2KKXA 4QQ4A 5B78A 2ECNA 4WA6A 3Q1DA 4Q6FA 4UP5A 1X4JA 3PHDA 3LQJA 5LKTA 5FB1A 5H1TA 1BORA 2Y1MA 2VJFA 4GNGA 2FSAA 2MD7B 2VJFB 4YC9A 3JUEA 2KGGA 4R8PK 2ECJA 2YU4A 4CCGX 2HYED 2Y1NA 5D1LB 2AN6A 4NN2A 4W4UA 2EA6A 2F6NA 4GB0A 1WEQA 5SVIB 1Z6UA 3RTRB 3U5NA 2ECGA 4V3LC 3SOUA 3SOWA 2YYRA 3O33A 3RPGC 2BAYA 2LAUA 1G25A 5C13A 2KU3A 4F1PA 4LLBA 5JG6A 2KIZA 3LQHA 2CONA 3LVQE 4YADA 2K4DA 2MD8C 3LJUX 3V43A 2QJ0A 2MNZA 4TKPB 4B86C 2KYUA 2VJEA 4C9ZA 2FFWA 2YSMA 4FK5A 2LXHC 1XWHA 3GV4A 4N3WA 2E61A 2C2LA 3U5PA 3IHPA 4O64A 2YT5A 2CRWA 2H0DA 5H1UA 4CA1A 2CKLA 1MM2A 1WGMA 1JM7A 2LV9A 2CSVA 4R2YA 2D8SA 4H9DA 2H0DB 5SVXA 4I7BA 3EB6A 2QIZA 2FD4A 4Z0RA 3ZVZB 5G0FA 3N9MA 3O37A 4WZ2A 5LKZA 3ASLA 2DSMA 2ECWA 4ZQLA 4A4CA 5B8DA 5G05B 5B76A 4GNEA 1WEEA 2YHNA 5H1VA 1VYXA 2L0BA 2G6QA 3KNVA 2JRJA 1ZBDB 3T9KA 1RMDA 1CHCA 4YATA 5D1KB 2JM3A 3HCTA 3LDYA 2KR4A 2YQLA 2KWNA 2YUCA 2OXQC 4OGEA 5FEYA 3H7HA 5B75A 2VNFA 3O34A 3O7AA 5LKXA 5AITA 5B77A 2CSZA 2LXPC 4QF2A 1V87A 3N9PA 2VPBA 1LDJB 3PLWA 5H9MA 2G43A 3DDTA 4GNDA 2DX8A 2KGIA 4YBSA 5DKAA 4ZDTA 1X4IA 3ZPVE 2I50A 2JUNA 4WZ3B 2UZGA 4PPEA 3KQIA 5TABA 3FANA 4A4BA 3M99A 1HYJA 4LADB 4R7EA 1U6GB 3E2DA 2IDAA 2MNYA 4GNFA 3N9OA 4A49A 4X3GA 3FJUB 5AIUA 2B0OE 1FP0A 1T1HA 4N4FA 3KDEC 2YQMA 3O47A 2RSDA 3KV6A 2FUUA 2VPDA 2K16A 2VPGA 2HDPA 2M6MA 2L75A 2VJEB 2KWJA 3PUQA 4WZ0A 2LGLA 4S3OB 1VFYA 3GL6A 4AVXA 2YURA 4AYCA 2CSYA 5K3QA 4BHWA 4I7DA 2F6JA 3O35A 3O70A 2EGMA 2K17A 4FO9A 3FM8C 2D8UA 3SOXA 2P57A 5FB0A 2CKLB 3FAOA 1JM7B 2PUYA 2ECVA 2G45A 2YHOA 4V3KC 3C6WA 4P5OB 2NAAA 3FL2A 3EB5A 1WEMA 5FERA 2MUMA 2YSJA 1DVPA 3KV5A 3L1ZB 5LCWB 1WEVA 3N9NA 2MIQA 3N9QA 2KKYA 1K2FA 3SUBA 4YBMA 2ECIA 3MHHA 5TRBA 4B7YC 2ECTA 2KREA 1X4UA 5D1MB 4LK9A 3HTKC 5TDRA 4XI1A 2EXUA 3NG2A 2L80A 2MT5A 4UP0A 3LRQA 1WEOA 4LKAA 1F62A 4L58A 3U5OA 2EGPA 2LDRA 5C11A 2L7PA 3HCUA 5EYAF 2KWOA 5SVYA 1WEPA 3DQVR 2XOZA 3N9LA 4YABA 2LGGA 2LQ6A 4LJNA 5KH3A 3FEHA 2VPEA 2F42A 1WEWA 2MA5A 4YAXA 3QZVA 2KE1A 4BBQA 2LGVA 5TBNA 3L1XA 2M85A
chains in the Genus database with same CATH topology
3VK6A 3RPGB 4FJCA 3M63A 3PURA 2JMJA 2YW8A 3ZVYA 2RI7A 3ZNIA 3DPLR 2KFTA 2LRIC 2EODA 2PNXA 2VP7A 4AUQB 2K1JA 3T6RA 1WESA 2M3HA 3ZTGA 4A0CD 4MVTA 2CT2A 1WIMA 3I2DA 4L7XA 5KH7A 1WILA 3MHSA 4YBTA 5G04B 3SHBA 2FUIA 4ZUXU 3ZPV1 1IYMA 1Z2QA 2E6RA 2LGKA 2XEUA 3M62A 2L43A 2M1RA 4AYCB 2KWKA 2L5UA 2C2VS 4IC3A 3LQIA 1VD4A 5B79A 4PTBA 1MM3A 1JOCA 4S3OC 4FIPA 1FBVA 4AP4A 5J3XA 1N87A 1HYIA 2YREA 2JMIA 2QICA 4I7CA 5LKUA 2Y43A 3HCSA 1WEUA 1WE9A 2XB1A 3C5KA 5DINA 1LDKC 3T7LA 5TDWA 1Z60A 2LN0A 5KH9A 2ZETC 2MA6A 3O36A 4MSXA 2E6SA 1WFKA 3ZYQA 2JMDA 1WENA 4UI9B 3L11A 5I3LA 4QF3A 1E4UA 4F52B 3U5MA 4IC2A 5B78A 2ECNA 4WA6A 4Q6FA 4UP5A 1X4JA 3PHDA 3LQJA 5LKTA 5FB1A 5H1TA 1BORA 2Y1MA 2VJFA 4GNGA 2FSAA 2MD7B 2VJFB 4YC9A 2KGGA 4R8PK 2ECJA 2YU4A 4CCGX 2HYED 2Y1NA 5D1LB 2AN6A 4NN2A 4W4UA 2EA6A 2F6NA 4GB0A 1WEQA 1Z6UA 3RTRB 3U5NA 2ECGA 4V3LC 3SOUA 3SOWA 2YYRA 3O33A 3RPGC 2BAYA 1G25A 5C13A 2KU3A 4LLBA 5JG6A 2KIZA 3LQHA 4YADA 2K4DA 2MD8C 3V43A 2QJ0A 2MNZA 4TKPB 4B86C 2KYUA 2VJEA 4C9ZA 2YSMA 4FK5A 2LXHC 1XWHA 3GV4A 4N3WA 2C2LA 3U5PA 3IHPA 4O64A 2YT5A 2H0DA 5H1UA 4CA1A 2CKLA 1MM2A 1WGMA 1JM7A 2LV9A 4R2YA 2D8SA 2H0DB 4I7BA 3EB6A 2QIZA 3ZVZB 5G0FA 3N9MA 3O37A 4WZ2A 5LKZA 3ASLA 2ECWA 4ZQLA 4A4CA 5B8DA 5G05B 5B76A 4GNEA 1WEEA 2YHNA 5H1VA 1VYXA 2L0BA 2G6QA 3KNVA 2JRJA 1ZBDB 1RMDA 1CHCA 4YATA 5D1KB 3HCTA 2KR4A 2YQLA 2KWNA 2YUCA 2OXQC 5FEYA 5B75A 2VNFA 3O34A 3O7AA 5LKXA 5AITA 5B77A 2CSZA 2LXPC 4QF2A 1V87A 3N9PA 2VPBA 1LDJB 5H9MA 2G43A 4GNDA 2DX8A 2KGIA 4YBSA 5DKAA 4ZDTA 1X4IA 3ZPVE 2I50A 4WZ3B 2UZGA 4PPEA 3KQIA 5TABA 4A4BA 3M99A 1HYJA 4LADB 4R7EA 1U6GB 2IDAA 2MNYA 4GNFA 3N9OA 4A49A 4X3GA 5AIUA 1FP0A 1T1HA 4N4FA 2YQMA 2RSDA 3KV6A 2FUUA 2VPDA 2K16A 2VPGA 2HDPA 2M6MA 2L75A 2VJEB 2KWJA 3PUQA 4WZ0A 2LGLA 4S3OB 1VFYA 3GL6A 4AVXA 2YURA 4AYCA 2CSYA 4BHWA 4I7DA 2F6JA 3O35A 3O70A 2K17A 4FO9A 3SOXA 5FB0A 2CKLB 1JM7B 2PUYA 2ECVA 2G45A 2YHOA 4V3KC 3C6WA 4P5OB 2NAAA 3FL2A 3EB5A 1WEMA 5FERA 2MUMA 2YSJA 1DVPA 3KV5A 3L1ZB 5LCWB 1WEVA 3N9NA 2MIQA 3N9QA 1K2FA 4YBMA 2ECIA 3MHHA 5TRBA 4B7YC 2ECTA 2KREA 1X4UA 5D1MB 4LK9A 3HTKC 5TDRA 4XI1A 3NG2A 2L80A 2MT5A 4UP0A 3LRQA 1WEOA 4LKAA 1F62A 4L58A 3U5OA 2EGPA 2LDRA 5C11A 3HCUA 5EYAF 2KWOA 1WEPA 3DQVR 3N9LA 4YABA 2LGGA 2LQ6A 4LJNA 5KH3A 2VPEA 2F42A 1WEWA 2MA5A 4YAXA 3QZVA 2KE1A 4BBQA 2LGVA 5TBNA 3L1XA 2M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VK6 A;  3RPG B;  4FJC A;  3M63 A;  3PUR A;  2JMJ A;  2YW8 A;  3ZVY A;  2RI7 A;  3ZNI A;  3DPL R;  2KFT A;  2LRI C;  2EOD A;  2PNX A;  2VP7 A;  4AUQ B;  2K1J A;  3T6R A;  1WES A;  2M3H A;  3ZTG A;  4A0C D;  4MVT A;  2CT2 A;  1WIM A;  3I2D A;  4L7X A;  5KH7 A;  1WIL A;  3MHS A;  4YBT A;  5G04 B;  3SHB A;  2FUI A;  4ZUX U;  3ZPV 1;  1IYM A;  1Z2Q A;  2E6R A;  2LGK A;  2XEU A;  3M62 A;  2L43 A;  2M1R A;  4AYC B;  2KWK A;  2L5U A;  2C2V S;  4IC3 A;  3LQI A;  1VD4 A;  5B79 A;  4PTB A;  1MM3 A;  1JOC A;  4S3O C;  4FIP A;  1FBV A;  4AP4 A;  5J3X A;  1N87 A;  1HYI A;  2YRE A;  2JMI A;  2QIC A;  4I7C A;  5LKU A;  2Y43 A;  3HCS A;  1WEU A;  1WE9 A;  2XB1 A;  3C5K A;  5DIN A;  1LDK C;  3T7L A;  5TDW A;  1Z60 A;  2LN0 A;  5KH9 A;  2ZET C;  2MA6 A;  3O36 A;  4MSX A;  2E6S A;  1WFK A;  3ZYQ A;  2JMD A;  1WEN A;  4UI9 B;  3L11 A;  5I3L A;  4QF3 A;  1E4U A;  4F52 B;  3U5M A;  4IC2 A;  5B78 A;  2ECN A;  4WA6 A;  4Q6F A;  4UP5 A;  1X4J A;  3PHD A;  3LQJ A;  5LKT A;  5FB1 A;  5H1T A;  1BOR A;  2Y1M A;  2VJF A;  4GNG A;  2FSA A;  2MD7 B;  2VJF B;  4YC9 A;  2KGG A;  4R8P K;  2ECJ A;  2YU4 A;  4CCG X;  2HYE D;  2Y1N A;  5D1L B;  2AN6 A;  4NN2 A;  4W4U A;  2EA6 A;  2F6N A;  4GB0 A;  1WEQ A;  1Z6U A;  3RTR B;  3U5N A;  2ECG A;  4V3L C;  3SOU A;  3SOW A;  2YYR A;  3O33 A;  3RPG C;  2BAY A;  1G25 A;  5C13 A;  2KU3 A;  4LLB A;  5JG6 A;  2KIZ A;  3LQH A;  4YAD A;  2K4D A;  2MD8 C;  3V43 A;  2QJ0 A;  2MNZ A;  4TKP B;  4B86 C;  2KYU A;  2VJE A;  4C9Z A;  2YSM A;  4FK5 A;  2LXH C;  1XWH A;  3GV4 A;  4N3W A;  2C2L A;  3U5P A;  3IHP A;  4O64 A;  2YT5 A;  2H0D A;  5H1U A;  4CA1 A;  2CKL A;  1MM2 A;  1WGM A;  1JM7 A;  2LV9 A;  4R2Y A;  2D8S A;  2H0D B;  4I7B A;  3EB6 A;  2QIZ A;  3ZVZ B;  5G0F A;  3N9M A;  3O37 A;  4WZ2 A;  5LKZ A;  3ASL A;  2ECW A;  4ZQL A;  4A4C A;  5B8D A;  5G05 B;  5B76 A;  4GNE A;  1WEE A;  2YHN A;  5H1V A;  1VYX A;  2L0B A;  2G6Q A;  3KNV A;  2JRJ A;  1ZBD B;  1RMD A;  1CHC A;  4YAT A;  5D1K B;  3HCT A;  2KR4 A;  2YQL A;  2KWN A;  2YUC A;  2OXQ C;  5FEY A;  5B75 A;  2VNF A;  3O34 A;  3O7A A;  5LKX A;  5AIT A;  5B77 A;  2CSZ A;  2LXP C;  4QF2 A;  1V87 A;  3N9P A;  2VPB A;  1LDJ B;  5H9M A;  2G43 A;  4GND A;  2DX8 A;  2KGI A;  4YBS A;  5DKA A;  4ZDT A;  1X4I A;  3ZPV E;  2I50 A;  4WZ3 B;  2UZG A;  4PPE A;  3KQI A;  5TAB A;  4A4B A;  3M99 A;  1HYJ A;  4LAD B;  4R7E A;  1U6G B;  2IDA A;  2MNY A;  4GNF A;  3N9O A;  4A49 A;  4X3G A;  5AIU A;  1FP0 A;  1T1H A;  4N4F A;  2YQM A;  2RSD A;  3KV6 A;  2FUU A;  2VPD A;  2K16 A;  2VPG A;  2HDP A;  2M6M A;  2L75 A;  2VJE B;  2KWJ A;  3PUQ A;  4WZ0 A;  2LGL A;  4S3O B;  1VFY A;  3GL6 A;  4AVX A;  2YUR A;  4AYC A;  2CSY A;  4BHW A;  4I7D A;  2F6J A;  3O35 A;  3O70 A;  2K17 A;  4FO9 A;  3SOX A;  5FB0 A;  2CKL B;  1JM7 B;  2PUY A;  2ECV A;  2G45 A;  2YHO A;  4V3K C;  3C6W A;  4P5O B;  2NAA A;  3FL2 A;  3EB5 A;  1WEM A;  5FER A;  2MUM A;  2YSJ A;  1DVP A;  3KV5 A;  3L1Z B;  5LCW B;  1WEV A;  3N9N A;  2MIQ A;  3N9Q A;  1K2F A;  4YBM A;  2ECI A;  3MHH A;  5TRB A;  4B7Y C;  2ECT A;  2KRE A;  1X4U A;  5D1M B;  4LK9 A;  3HTK C;  5TDR A;  4XI1 A;  3NG2 A;  2L80 A;  2MT5 A;  4UP0 A;  3LRQ A;  1WEO A;  4LKA A;  1F62 A;  4L58 A;  3U5O A;  2EGP A;  2LDR A;  5C11 A;  3HCU A;  5EYA F;  2KWO A;  1WEP A;  3DQV R;  3N9L A;  4YAB A;  2LGG A;  2LQ6 A;  4LJN A;  5KH3 A;  2VPE A;  2F42 A;  1WEW A;  2MA5 A;  4YAX A;  3QZV A;  2KE1 A;  4BBQ A;  2LGV A;  5TBN A;  3L1X A;  2M85 A; 
#chains in the Genus database with same CATH topology
 3VK6 A;  2IQJ A;  3RPG B;  3M7K A;  4FJC A;  3M63 A;  3PUR A;  2JMJ A;  2YW8 A;  3ZVY A;  2RI7 A;  3ZNI A;  3DPL R;  5SVI A;  2KFT A;  2LRI C;  2XOC A;  2EOD A;  2PNX A;  2VP7 A;  2XP0 A;  4AUQ B;  2K1J A;  3T6R A;  1WES A;  2M3H A;  3ZTG A;  4A0C D;  4MVT A;  2CT2 A;  1WIM A;  3I2D A;  4L7X A;  5KH7 A;  1WIL A;  3MHS A;  4YBT A;  5G04 B;  3DWD A;  3SHB A;  2FUI A;  1DCQ A;  4ZUX U;  3ZPV 1;  1IYM A;  1Z2Q A;  2E6R A;  2LGK A;  2XEU A;  3M62 A;  2L43 A;  3MDB C;  2M1R A;  4AYC B;  2KWK A;  2L5U A;  2C2V S;  4IC3 A;  3LQI A;  1VD4 A;  5B79 A;  4PTB A;  1MM3 A;  1JOC A;  4S3O C;  4FIP A;  1FBV A;  4AP4 A;  5J3X A;  1N87 A;  2DJA A;  2RR4 A;  1HYI A;  2YRE A;  2JMI A;  2QIC A;  2CRR A;  4I7C A;  5LKU A;  2Y43 A;  3HCS A;  2MKE A;  1WEU A;  1WE9 A;  2XOY A;  2XB1 A;  3C5K A;  5DIN A;  1LDK C;  3T7L A;  5TDW A;  1Z60 A;  3LVR E;  2LN0 A;  5KH9 A;  2ZET C;  2MA6 A;  3O36 A;  4MSX A;  4OGC A;  2OWA A;  2YVR A;  2E6S A;  1WFK A;  3ZYQ A;  2JMD A;  1WEN A;  4UI9 B;  3L11 A;  1MBM A;  5I3L A;  4QF3 A;  1E4U A;  4F52 B;  4Z0O A;  3U5M A;  4IC2 A;  2M13 A;  4O62 A;  2KKX A;  4QQ4 A;  5B78 A;  2ECN A;  4WA6 A;  3Q1D A;  4Q6F A;  4UP5 A;  1X4J A;  3PHD A;  3LQJ A;  5LKT A;  5FB1 A;  5H1T A;  1BOR A;  2Y1M A;  2VJF A;  4GNG A;  2FSA A;  2MD7 B;  2VJF B;  4YC9 A;  3JUE A;  2KGG A;  4R8P K;  2ECJ A;  2YU4 A;  4CCG X;  2HYE D;  2Y1N A;  5D1L B;  2AN6 A;  4NN2 A;  4W4U A;  2EA6 A;  2F6N A;  4GB0 A;  1WEQ A;  5SVI B;  1Z6U A;  3RTR B;  3U5N A;  2ECG A;  4V3L C;  3SOU A;  3SOW A;  2YYR A;  3O33 A;  3RPG C;  2BAY A;  2LAU A;  1G25 A;  5C13 A;  2KU3 A;  4F1P A;  4LLB A;  5JG6 A;  2KIZ A;  3LQH A;  2CON A;  3LVQ E;  4YAD A;  2K4D A;  2MD8 C;  3LJU X;  3V43 A;  2QJ0 A;  2MNZ A;  4TKP B;  4B86 C;  2KYU A;  2VJE A;  4C9Z A;  2FFW A;  2YSM A;  4FK5 A;  2LXH C;  1XWH A;  3GV4 A;  4N3W A;  2E61 A;  2C2L A;  3U5P A;  3IHP A;  4O64 A;  2YT5 A;  2CRW A;  2H0D A;  5H1U A;  4CA1 A;  2CKL A;  1MM2 A;  1WGM A;  1JM7 A;  2LV9 A;  2CSV A;  4R2Y A;  2D8S A;  4H9D A;  2H0D B;  5SVX A;  4I7B A;  3EB6 A;  2QIZ A;  2FD4 A;  4Z0R A;  3ZVZ B;  5G0F A;  3N9M A;  3O37 A;  4WZ2 A;  5LKZ A;  3ASL A;  2DSM A;  2ECW A;  4ZQL A;  4A4C A;  5B8D A;  5G05 B;  5B76 A;  4GNE A;  1WEE A;  2YHN A;  5H1V A;  1VYX A;  2L0B A;  2G6Q A;  3KNV A;  2JRJ A;  1ZBD B;  3T9K A;  1RMD A;  1CHC A;  4YAT A;  5D1K B;  2JM3 A;  3HCT A;  3LDY A;  2KR4 A;  2YQL A;  2KWN A;  2YUC A;  2OXQ C;  4OGE A;  5FEY A;  3H7H A;  5B75 A;  2VNF A;  3O34 A;  3O7A A;  5LKX A;  5AIT A;  5B77 A;  2CSZ A;  2LXP C;  4QF2 A;  1V87 A;  3N9P A;  2VPB A;  1LDJ B;  3PLW A;  5H9M A;  2G43 A;  3DDT A;  4GND A;  2DX8 A;  2KGI A;  4YBS A;  5DKA A;  4ZDT A;  1X4I A;  3ZPV E;  2I50 A;  2JUN A;  4WZ3 B;  2UZG A;  4PPE A;  3KQI A;  5TAB A;  3FAN A;  4A4B A;  3M99 A;  1HYJ A;  4LAD B;  4R7E A;  1U6G B;  3E2D A;  2IDA A;  2MNY A;  4GNF A;  3N9O A;  4A49 A;  4X3G A;  3FJU B;  5AIU A;  2B0O E;  1FP0 A;  1T1H A;  4N4F A;  3KDE C;  2YQM A;  3O47 A;  2RSD A;  3KV6 A;  2FUU A;  2VPD A;  2K16 A;  2VPG A;  2HDP A;  2M6M A;  2L75 A;  2VJE B;  2KWJ A;  3PUQ A;  4WZ0 A;  2LGL A;  4S3O B;  1VFY A;  3GL6 A;  4AVX A;  2YUR A;  4AYC A;  2CSY A;  5K3Q A;  4BHW A;  4I7D A;  2F6J A;  3O35 A;  3O70 A;  2EGM A;  2K17 A;  4FO9 A;  3FM8 C;  2D8U A;  3SOX A;  2P57 A;  5FB0 A;  2CKL B;  3FAO A;  1JM7 B;  2PUY A;  2ECV A;  2G45 A;  2YHO A;  4V3K C;  3C6W A;  4P5O B;  2NAA A;  3FL2 A;  3EB5 A;  1WEM A;  5FER A;  2MUM A;  2YSJ A;  1DVP A;  3KV5 A;  3L1Z B;  5LCW B;  1WEV A;  3N9N A;  2MIQ A;  3N9Q A;  2KKY A;  1K2F A;  3SUB A;  4YBM A;  2ECI A;  3MHH A;  5TRB A;  4B7Y C;  2ECT A;  2KRE A;  1X4U A;  5D1M B;  4LK9 A;  3HTK C;  5TDR A;  4XI1 A;  2EXU A;  3NG2 A;  2L80 A;  2MT5 A;  4UP0 A;  3LRQ A;  1WEO A;  4LKA A;  1F62 A;  4L58 A;  3U5O A;  2EGP A;  2LDR A;  5C11 A;  2L7P A;  3HCU A;  5EYA F;  2KWO A;  5SVY A;  1WEP A;  3DQV R;  2XOZ A;  3N9L A;  4YAB A;  2LGG A;  2LQ6 A;  4LJN A;  5KH3 A;  3FEH A;  2VPE A;  2F42 A;  1WEW A;  2MA5 A;  4YAX A;  3QZV A;  2KE1 A;  4BBQ A;  2LGV A;  5TBN A;  3L1X A;  2M85 A; 
#chains in the Genus database with same CATH homology
 3VK6 A;  3RPG B;  4FJC A;  3M63 A;  3PUR A;  2JMJ A;  2YW8 A;  3ZVY A;  2RI7 A;  3ZNI A;  3DPL R;  2KFT A;  2LRI C;  2EOD A;  2PNX A;  2VP7 A;  4AUQ B;  2K1J A;  3T6R A;  1WES A;  2M3H A;  3ZTG A;  4A0C D;  4MVT A;  2CT2 A;  1WIM A;  3I2D A;  4L7X A;  5KH7 A;  1WIL A;  3MHS A;  4YBT A;  5G04 B;  3SHB A;  2FUI A;  4ZUX U;  3ZPV 1;  1IYM A;  1Z2Q A;  2E6R A;  2LGK A;  2XEU A;  3M62 A;  2L43 A;  2M1R A;  4AYC B;  2KWK A;  2L5U A;  2C2V S;  4IC3 A;  3LQI A;  1VD4 A;  5B79 A;  4PTB A;  1MM3 A;  1JOC A;  4S3O C;  4FIP A;  1FBV A;  4AP4 A;  5J3X A;  1N87 A;  1HYI A;  2YRE A;  2JMI A;  2QIC A;  4I7C A;  5LKU A;  2Y43 A;  3HCS A;  1WEU A;  1WE9 A;  2XB1 A;  3C5K A;  5DIN A;  1LDK C;  3T7L A;  5TDW A;  1Z60 A;  2LN0 A;  5KH9 A;  2ZET C;  2MA6 A;  3O36 A;  4MSX A;  2E6S A;  1WFK A;  3ZYQ A;  2JMD A;  1WEN A;  4UI9 B;  3L11 A;  5I3L A;  4QF3 A;  1E4U A;  4F52 B;  3U5M A;  4IC2 A;  5B78 A;  2ECN A;  4WA6 A;  4Q6F A;  4UP5 A;  1X4J A;  3PHD A;  3LQJ A;  5LKT A;  5FB1 A;  5H1T A;  1BOR A;  2Y1M A;  2VJF A;  4GNG A;  2FSA A;  2MD7 B;  2VJF B;  4YC9 A;  2KGG A;  4R8P K;  2ECJ A;  2YU4 A;  4CCG X;  2HYE D;  2Y1N A;  5D1L B;  2AN6 A;  4NN2 A;  4W4U A;  2EA6 A;  2F6N A;  4GB0 A;  1WEQ A;  1Z6U A;  3RTR B;  3U5N A;  2ECG A;  4V3L C;  3SOU A;  3SOW A;  2YYR A;  3O33 A;  3RPG C;  2BAY A;  1G25 A;  5C13 A;  2KU3 A;  4LLB A;  5JG6 A;  2KIZ A;  3LQH A;  4YAD A;  2K4D A;  2MD8 C;  3V43 A;  2QJ0 A;  2MNZ A;  4TKP B;  4B86 C;  2KYU A;  2VJE A;  4C9Z A;  2YSM A;  4FK5 A;  2LXH C;  1XWH A;  3GV4 A;  4N3W A;  2C2L A;  3U5P A;  3IHP A;  4O64 A;  2YT5 A;  2H0D A;  5H1U A;  4CA1 A;  2CKL A;  1MM2 A;  1WGM A;  1JM7 A;  2LV9 A;  4R2Y A;  2D8S A;  2H0D B;  4I7B A;  3EB6 A;  2QIZ A;  3ZVZ B;  5G0F A;  3N9M A;  3O37 A;  4WZ2 A;  5LKZ A;  3ASL A;  2ECW A;  4ZQL A;  4A4C A;  5B8D A;  5G05 B;  5B76 A;  4GNE A;  1WEE A;  2YHN A;  5H1V A;  1VYX A;  2L0B A;  2G6Q A;  3KNV A;  2JRJ A;  1ZBD B;  1RMD A;  1CHC A;  4YAT A;  5D1K B;  3HCT A;  2KR4 A;  2YQL A;  2KWN A;  2YUC A;  2OXQ C;  5FEY A;  5B75 A;  2VNF A;  3O34 A;  3O7A A;  5LKX A;  5AIT A;  5B77 A;  2CSZ A;  2LXP C;  4QF2 A;  1V87 A;  3N9P A;  2VPB A;  1LDJ B;  5H9M A;  2G43 A;  4GND A;  2DX8 A;  2KGI A;  4YBS A;  5DKA A;  4ZDT A;  1X4I A;  3ZPV E;  2I50 A;  4WZ3 B;  2UZG A;  4PPE A;  3KQI A;  5TAB A;  4A4B A;  3M99 A;  1HYJ A;  4LAD B;  4R7E A;  1U6G B;  2IDA A;  2MNY A;  4GNF A;  3N9O A;  4A49 A;  4X3G A;  5AIU A;  1FP0 A;  1T1H A;  4N4F A;  2YQM A;  2RSD A;  3KV6 A;  2FUU A;  2VPD A;  2K16 A;  2VPG A;  2HDP A;  2M6M A;  2L75 A;  2VJE B;  2KWJ A;  3PUQ A;  4WZ0 A;  2LGL A;  4S3O B;  1VFY A;  3GL6 A;  4AVX A;  2YUR A;  4AYC A;  2CSY A;  4BHW A;  4I7D A;  2F6J A;  3O35 A;  3O70 A;  2K17 A;  4FO9 A;  3SOX A;  5FB0 A;  2CKL B;  1JM7 B;  2PUY A;  2ECV A;  2G45 A;  2YHO A;  4V3K C;  3C6W A;  4P5O B;  2NAA A;  3FL2 A;  3EB5 A;  1WEM A;  5FER A;  2MUM A;  2YSJ A;  1DVP A;  3KV5 A;  3L1Z B;  5LCW B;  1WEV A;  3N9N A;  2MIQ A;  3N9Q A;  1K2F A;  4YBM A;  2ECI A;  3MHH A;  5TRB A;  4B7Y C;  2ECT A;  2KRE A;  1X4U A;  5D1M B;  4LK9 A;  3HTK C;  5TDR A;  4XI1 A;  3NG2 A;  2L80 A;  2MT5 A;  4UP0 A;  3LRQ A;  1WEO A;  4LKA A;  1F62 A;  4L58 A;  3U5O A;  2EGP A;  2LDR A;  5C11 A;  3HCU A;  5EYA F;  2KWO A;  1WEP A;  3DQV R;  3N9L A;  4YAB A;  2LGG A;  2LQ6 A;  4LJN A;  5KH3 A;  2VPE A;  2F42 A;  1WEW A;  2MA5 A;  4YAX A;  3QZV A;  2KE1 A;  4BBQ A;  2LGV A;  5TBN A;  3L1X A;  2M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...