2M1RA

Phd domain of ing4 n214d mutant
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
63
structure length
63
Chain Sequence
b'MDMPVDPNEPTYCLCHQVSYGEMIGCDDPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 4
publication title Functional impact of cancer-associated mutations in the tumor suppressor protein ING4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 3
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m1rA00
1HYJA 3RPGB 2DX8A 2LGGA 4GNFA 2FSAA 2M85A 1JM7A 4GB0A 2YU4A 2K4DA 3N9OA 2CKLB 3U5PA 2IDAA 4GNDA 3HTKC 3U5OA 3ZVYA 4C9ZA 5G04B 3PUQA 5KH3A 5H1TA 2VJFB 4LK9A 1WEMA 2LXPC 2Y1NA 2MIQA 4QF2A 2KE1A 4WZ3B 4I7BA 1WILA 1WEWA 2QJ0A 5KH9A 2LRIC 1VFYA 1WEPA 4S3OC 1MM2A 2LV9A 2Y1MA 3RTRB 4IC3A 1WESA 3DQVR 2G43A 2YURA 1X4UA 5B8DA 3IHPA 1FP0A 2FUIA 2M3HA 4Q6FA 2E6SA 2MNZA 1V87A 4YATA 4O64A 2YSJA 3T6RA 5B75A 4YABA 2LN0A 3HCUA 5AITA 5G05B 4AYCB 2D8SA 3L1XA 3KNVA 3T7LA 2HYED 2F42A 3C5KA 3EB5A 2L75A 5G0FA 2ECVA 3HCSA 3DPLR 4R8PK 2YHOA 2RSDA 5J3XA 1X4IA 2AN6A 2L43A 5LKXA 4CA1A 1WEEA 4UP5A 3N9LA 4V3LC 3GV4A 1Z60A 5AIUA 2F6NA 2KIZA 5B77A 4WA6A 3PHDA 4LADB 1JOCA 4R2YA 2YSMA 2EGPA 1XWHA 2KWJA 1LDKC 1JM7B 5TRBA 2BAYA 4V3KC 2ZETC 4MVTA 4UP0A 2LXHC 4BBQA 4S3OB 2EA6A 3PURA 4YBSA 5JG6A 4N3WA 2KFTA 2F6JA 2ECJA 3ZNIA 2M6MA 3N9PA 4FJCA 5TABA 3SOXA 2L80A 2UZGA 2KU3A 3N9NA 1X4JA 3NG2A 2YQMA 2KYUA 4YBMA 4YC9A 3KV6A 3C6WA 2NAAA 4AUQB 4A4BA 1T1HA 3N9MA 4FO9A 4GNEA 5FERA 4I7CA 5H9MA 1WIMA 3ZPV1 2MUMA 2E6RA 3O70A 3KV5A 2VPBA 4W4UA 2VP7A 2H0DA 4LKAA 3RPGC 2JMJA 2JRJA 3V43A 3ZTGA 2KWKA 2YHNA 1MM3A 2KWOA 1LDJB 2G45A 1WEQA 1K2FA 3M62A 4A4CA 3ZYQA 3LQHA 5LKUA 2CSYA 5TDRA 3M63A 3O33A 5B76A 3SOUA 2EODA 4MSXA 3I2DA 1ZBDB 3LQIA 2VJEA 2HDPA 2KR4A 3MHSA 1WEOA 5FEYA 1N87A 1WENA 1IYMA 1U6GB 3LRQA 2C2LA 2PUYA 4WZ2A 5LCWB 4FK5A 2L5UA 3U5NA 4B86C 4B7YC 3ASLA 4PPEA 4PTBA 5EYAF 2MD8C 1VYXA 5DKAA 2VPGA 2Y43A 2FUUA 2YREA 5C11A 3O36A 1FBVA 4IC2A 5D1MB 2G6QA 4ZDTA 5D1KB 3SOWA 5I3LA 2YQLA 3QZVA 2L0BA 5KH7A 4LJNA 1Z2QA 2JMIA 2LDRA 4TKPB 1G25A 5H1VA 3FL2A 4F52B 2KGIA 4AVXA 2ECGA 4N4FA 4QF3A 5TDWA 4A49A 3KQIA 2K16A 5C13A 2OXQC 3N9QA 4R7EA 4X3GA 4AP4A 2CKLA 4YBTA 3LQJA 2K1JA 2C2VS 4L58A 2YT5A 4A0CD 2M1RA 2QIZA 5B79A 3L11A 2H0DB 1WE9A 3U5MA 5DINA 2VJFA 1Z6UA 3O7AA 2MD7B 5D1LB 5FB1A 2YUCA 1BORA 2VPDA 2ECNA 4ZQLA 3ZPVE 1HYIA 3VK6A 3GL6A 5B78A 2LGLA 5TBNA 4XI1A 2PNXA 1F62A 4WZ0A 1RMDA 5LKZA 4I7DA 3ZVZB 2QICA 3L1ZB 2MT5A 4NN2A 2K17A 2VJEB 3MHHA 5H1UA 2ECTA 2RI7A 3M99A 2I50A 2KGGA 2XEUA 4BHWA 3HCTA 2CT2A 4CCGX 4FIPA 1WEVA 1WFKA 2MNYA 4L7XA 2CSZA 1E4UA 2LGVA 3O37A 4AYCA 3O34A 2XB1A 2LQ6A 5LKTA 2ECWA 1DVPA 2KREA 2KWNA 2MA5A 4UI9B 1CHCA 2VNFA 3EB6A 1VD4A 4P5OB 4LLBA 2JMDA 3O35A 4YAXA 4GNGA 1WEUA 2ECIA 2LGKA 3SHBA 1WGMA 2YW8A 5FB0A 4YADA 4ZUXU 2YYRA 2MA6A 2VPEA
chains in the Genus database with same CATH superfamily
1HYJA 3RPGB 2DX8A 2LGGA 4GNFA 2FSAA 2M85A 1JM7A 4GB0A 3O47A 2YU4A 2K4DA 3N9OA 2CKLB 3U5PA 2IDAA 4GNDA 2IQJA 3HTKC 3U5OA 3ZVYA 4C9ZA 5G04B 3PUQA 2MKEA 5KH3A 5H1TA 2VJFB 4LK9A 1WEMA 2LXPC 2Y1NA 2MIQA 4QF2A 2KE1A 4WZ3B 2CRWA 4I7BA 5SVXA 2CSVA 2XOYA 1WILA 5SVIA 1WEWA 2QJ0A 3LDYA 5KH9A 2LRIC 1VFYA 1WEPA 4QQ4A 4S3OC 1MM2A 2LV9A 2Y1MA 3RTRB 4IC3A 1WESA 3DQVR 2G43A 2YURA 1X4UA 5B8DA 3IHPA 2OWAA 3LVQE 1FP0A 2FUIA 2FFWA 2M3HA 4Q6FA 2E6SA 5K3QA 2MNZA 1V87A 4YATA 1DCQA 4O64A 2YSJA 3T6RA 5B75A 4YABA 3DWDA 2LN0A 3HCUA 3MDBC 5AITA 5G05B 4Z0RA 3LVRE 4AYCB 2D8SA 3L1XA 3SUBA 3KNVA 3T7LA 2HYED 2F42A 3C5KA 3EB5A 2L75A 5G0FA 2ECVA 3HCSA 3DPLR 4R8PK 2YHOA 2RSDA 5J3XA 1X4IA 2AN6A 2L43A 5LKXA 4CA1A 1WEEA 4UP5A 3N9LA 3FJUB 4O62A 4V3LC 3GV4A 1Z60A 5AIUA 2F6NA 2KIZA 5B77A 4F1PA 4WA6A 3PHDA 4LADB 1JOCA 4R2YA 2YSMA 2EGPA 1XWHA 2KWJA 1LDKC 2DJAA 1JM7B 5TRBA 2BAYA 3FEHA 4V3KC 2ZETC 4MVTA 4UP0A 2LXHC 4BBQA 4S3OB 2EA6A 3PURA 4YBSA 5JG6A 4N3WA 2KFTA 2F6JA 2ECJA 3ZNIA 2M6MA 3N9PA 4FJCA 5TABA 3SOXA 2L80A 2UZGA 5SVIB 2CRRA 2KU3A 3N9NA 1X4JA 3NG2A 2YQMA 2KYUA 4YBMA 4YC9A 2XOCA 3KV6A 3C6WA 2NAAA 4AUQB 4A4BA 1T1HA 3N9MA 4FO9A 4GNEA 5FERA 4I7CA 5H9MA 1WIMA 3JUEA 3ZPV1 2MUMA 2E6RA 3M7KA 2P57A 3O70A 2E61A 5SVYA 3KV5A 2VPBA 4W4UA 2VP7A 2H0DA 4LKAA 3RPGC 2JMJA 2FD4A 2JRJA 3V43A 3ZTGA 2KWKA 2YHNA 2JUNA 1MM3A 2KWOA 1LDJB 2G45A 1WEQA 1K2FA 2JM3A 3M62A 4A4CA 3ZYQA 3LQHA 5LKUA 2B0OE 2CSYA 5TDRA 3E2DA 3M63A 2CONA 3FANA 3O33A 2RR4A 5B76A 3SOUA 2EODA 4MSXA 3I2DA 2EGMA 1ZBDB 3LQIA 4Z0OA 2VJEA 2HDPA 2KR4A 3MHSA 1WEOA 3PLWA 5FEYA 1N87A 1WENA 1IYMA 3FAOA 1U6GB 3LRQA 2XOZA 2C2LA 4OGCA 3T9KA 2PUYA 4WZ2A 5LCWB 4FK5A 2L5UA 3U5NA 4B86C 4B7YC 3ASLA 4PPEA 2D8UA 4PTBA 5EYAF 2MD8C 1VYXA 5DKAA 3DDTA 2VPGA 2Y43A 2FUUA 3KDEC 2YREA 5C11A 3O36A 1FBVA 4IC2A 5D1MB 2G6QA 2LAUA 5D1KB 4ZDTA 3SOWA 5I3LA 2YQLA 2KKXA 2DSMA 3QZVA 2L0BA 5KH7A 3LJUX 4LJNA 1Z2QA 2JMIA 2LDRA 4TKPB 1G25A 5H1VA 3FL2A 4F52B 2KGIA 4AVXA 3Q1DA 2ECGA 4N4FA 4QF3A 5TDWA 4A49A 3KQIA 2K16A 5C13A 2OXQC 3N9QA 4R7EA 4X3GA 4AP4A 2CKLA 4YBTA 3LQJA 2K1JA 2C2VS 4L58A 2YT5A 4A0CD 2M1RA 2QIZA 5B79A 3L11A 2H0DB 1WE9A 3U5MA 5DINA 2VJFA 2KKYA 1Z6UA 3O7AA 2MD7B 5D1LB 5FB1A 2YUCA 1BORA 2VPDA 2ECNA 2M13A 4ZQLA 3ZPVE 1HYIA 3VK6A 3GL6A 5B78A 2LGLA 5TBNA 1MBMA 4XI1A 2PNXA 1F62A 4WZ0A 1RMDA 5LKZA 4I7DA 2XP0A 3ZVZB 2QICA 3L1ZB 2MT5A 4NN2A 2K17A 2VJEB 3MHHA 5H1UA 2ECTA 2RI7A 2EXUA 3M99A 2I50A 2KGGA 2XEUA 2YVRA 4BHWA 3HCTA 2CT2A 4CCGX 4FIPA 1WEVA 1WFKA 2MNYA 4L7XA 2CSZA 1E4UA 4OGEA 2L7PA 2LGVA 3O37A 4AYCA 3O34A 2XB1A 2LQ6A 5LKTA 2ECWA 1DVPA 2KREA 2KWNA 2MA5A 4UI9B 1CHCA 2VNFA 3EB6A 1VD4A 4P5OB 4LLBA 2JMDA 3FM8C 4H9DA 3O35A 4YAXA 4GNGA 1WEUA 2ECIA 2LGKA 1WGMA 2YW8A 3SHBA 5FB0A 4YADA 3H7HA 4ZUXU 2YYRA 2MA6A 2VPEA
chains in the Genus database with same CATH topology
1HYJA 3RPGB 2DX8A 2LGGA 4GNFA 2FSAA 2M85A 1JM7A 4GB0A 2YU4A 2K4DA 3N9OA 2CKLB 3U5PA 2IDAA 4GNDA 3HTKC 3U5OA 3ZVYA 4C9ZA 5G04B 3PUQA 5KH3A 5H1TA 2VJFB 4LK9A 1WEMA 2LXPC 2Y1NA 2MIQA 4QF2A 2KE1A 4WZ3B 4I7BA 1WILA 1WEWA 2QJ0A 5KH9A 2LRIC 1VFYA 1WEPA 4S3OC 1MM2A 2LV9A 2Y1MA 3RTRB 4IC3A 1WESA 3DQVR 2G43A 2YURA 1X4UA 5B8DA 3IHPA 1FP0A 2FUIA 2M3HA 4Q6FA 2E6SA 2MNZA 1V87A 4YATA 4O64A 2YSJA 3T6RA 5B75A 4YABA 2LN0A 3HCUA 5AITA 5G05B 4AYCB 2D8SA 3L1XA 3KNVA 3T7LA 2HYED 2F42A 3C5KA 3EB5A 2L75A 5G0FA 2ECVA 3HCSA 3DPLR 4R8PK 2YHOA 2RSDA 5J3XA 1X4IA 2AN6A 2L43A 5LKXA 4CA1A 1WEEA 4UP5A 3N9LA 4V3LC 3GV4A 1Z60A 5AIUA 2F6NA 2KIZA 5B77A 4WA6A 3PHDA 4LADB 1JOCA 4R2YA 2YSMA 2EGPA 1XWHA 2KWJA 1LDKC 1JM7B 5TRBA 2BAYA 4V3KC 2ZETC 4MVTA 4UP0A 2LXHC 4BBQA 4S3OB 2EA6A 3PURA 4YBSA 5JG6A 4N3WA 2KFTA 2F6JA 2ECJA 3ZNIA 2M6MA 3N9PA 4FJCA 5TABA 3SOXA 2L80A 2UZGA 2KU3A 3N9NA 1X4JA 3NG2A 2YQMA 2KYUA 4YBMA 4YC9A 3KV6A 3C6WA 2NAAA 4AUQB 4A4BA 1T1HA 3N9MA 4FO9A 4GNEA 5FERA 4I7CA 5H9MA 1WIMA 3ZPV1 2MUMA 2E6RA 3O70A 3KV5A 2VPBA 4W4UA 2VP7A 2H0DA 4LKAA 3RPGC 2JMJA 2JRJA 3V43A 3ZTGA 2KWKA 2YHNA 1MM3A 2KWOA 1LDJB 2G45A 1WEQA 1K2FA 3M62A 4A4CA 3ZYQA 3LQHA 5LKUA 2CSYA 5TDRA 3M63A 3O33A 5B76A 3SOUA 2EODA 4MSXA 3I2DA 1ZBDB 3LQIA 2VJEA 2HDPA 2KR4A 3MHSA 1WEOA 5FEYA 1N87A 1WENA 1IYMA 1U6GB 3LRQA 2C2LA 2PUYA 4WZ2A 5LCWB 4FK5A 2L5UA 3U5NA 4B86C 4B7YC 3ASLA 4PPEA 4PTBA 5EYAF 2MD8C 1VYXA 5DKAA 2VPGA 2Y43A 2FUUA 2YREA 5C11A 3O36A 1FBVA 4IC2A 5D1MB 2G6QA 4ZDTA 5D1KB 3SOWA 5I3LA 2YQLA 3QZVA 2L0BA 5KH7A 4LJNA 1Z2QA 2JMIA 2LDRA 4TKPB 1G25A 5H1VA 3FL2A 4F52B 2KGIA 4AVXA 2ECGA 4N4FA 4QF3A 5TDWA 4A49A 3KQIA 2K16A 5C13A 2OXQC 3N9QA 4R7EA 4X3GA 4AP4A 2CKLA 4YBTA 3LQJA 2K1JA 2C2VS 4L58A 2YT5A 4A0CD 2M1RA 2QIZA 5B79A 3L11A 2H0DB 1WE9A 3U5MA 5DINA 2VJFA 1Z6UA 3O7AA 2MD7B 5D1LB 5FB1A 2YUCA 1BORA 2VPDA 2ECNA 4ZQLA 3ZPVE 1HYIA 3VK6A 3GL6A 5B78A 2LGLA 5TBNA 4XI1A 2PNXA 1F62A 4WZ0A 1RMDA 5LKZA 4I7DA 3ZVZB 2QICA 3L1ZB 2MT5A 4NN2A 2K17A 2VJEB 3MHHA 5H1UA 2ECTA 2RI7A 3M99A 2I50A 2KGGA 2XEUA 4BHWA 3HCTA 2CT2A 4CCGX 4FIPA 1WEVA 1WFKA 2MNYA 4L7XA 2CSZA 1E4UA 2LGVA 3O37A 4AYCA 3O34A 2XB1A 2LQ6A 5LKTA 2ECWA 1DVPA 2KREA 2KWNA 2MA5A 4UI9B 1CHCA 2VNFA 3EB6A 1VD4A 4P5OB 4LLBA 2JMDA 3O35A 4YAXA 4GNGA 1WEUA 2ECIA 2LGKA 3SHBA 1WGMA 2YW8A 5FB0A 4YADA 4ZUXU 2YYRA 2MA6A 2VPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYJ A;  3RPG B;  2DX8 A;  2LGG A;  4GNF A;  2FSA A;  2M85 A;  1JM7 A;  4GB0 A;  2YU4 A;  2K4D A;  3N9O A;  2CKL B;  3U5P A;  2IDA A;  4GND A;  3HTK C;  3U5O A;  3ZVY A;  4C9Z A;  5G04 B;  3PUQ A;  5KH3 A;  5H1T A;  2VJF B;  4LK9 A;  1WEM A;  2LXP C;  2Y1N A;  2MIQ A;  4QF2 A;  2KE1 A;  4WZ3 B;  4I7B A;  1WIL A;  1WEW A;  2QJ0 A;  5KH9 A;  2LRI C;  1VFY A;  1WEP A;  4S3O C;  1MM2 A;  2LV9 A;  2Y1M A;  3RTR B;  4IC3 A;  1WES A;  3DQV R;  2G43 A;  2YUR A;  1X4U A;  5B8D A;  3IHP A;  1FP0 A;  2FUI A;  2M3H A;  4Q6F A;  2E6S A;  2MNZ A;  1V87 A;  4YAT A;  4O64 A;  2YSJ A;  3T6R A;  5B75 A;  4YAB A;  2LN0 A;  3HCU A;  5AIT A;  5G05 B;  4AYC B;  2D8S A;  3L1X A;  3KNV A;  3T7L A;  2HYE D;  2F42 A;  3C5K A;  3EB5 A;  2L75 A;  5G0F A;  2ECV A;  3HCS A;  3DPL R;  4R8P K;  2YHO A;  2RSD A;  5J3X A;  1X4I A;  2AN6 A;  2L43 A;  5LKX A;  4CA1 A;  1WEE A;  4UP5 A;  3N9L A;  4V3L C;  3GV4 A;  1Z60 A;  5AIU A;  2F6N A;  2KIZ A;  5B77 A;  4WA6 A;  3PHD A;  4LAD B;  1JOC A;  4R2Y A;  2YSM A;  2EGP A;  1XWH A;  2KWJ A;  1LDK C;  1JM7 B;  5TRB A;  2BAY A;  4V3K C;  2ZET C;  4MVT A;  4UP0 A;  2LXH C;  4BBQ A;  4S3O B;  2EA6 A;  3PUR A;  4YBS A;  5JG6 A;  4N3W A;  2KFT A;  2F6J A;  2ECJ A;  3ZNI A;  2M6M A;  3N9P A;  4FJC A;  5TAB A;  3SOX A;  2L80 A;  2UZG A;  2KU3 A;  3N9N A;  1X4J A;  3NG2 A;  2YQM A;  2KYU A;  4YBM A;  4YC9 A;  3KV6 A;  3C6W A;  2NAA A;  4AUQ B;  4A4B A;  1T1H A;  3N9M A;  4FO9 A;  4GNE A;  5FER A;  4I7C A;  5H9M A;  1WIM A;  3ZPV 1;  2MUM A;  2E6R A;  3O70 A;  3KV5 A;  2VPB A;  4W4U A;  2VP7 A;  2H0D A;  4LKA A;  3RPG C;  2JMJ A;  2JRJ A;  3V43 A;  3ZTG A;  2KWK A;  2YHN A;  1MM3 A;  2KWO A;  1LDJ B;  2G45 A;  1WEQ A;  1K2F A;  3M62 A;  4A4C A;  3ZYQ A;  3LQH A;  5LKU A;  2CSY A;  5TDR A;  3M63 A;  3O33 A;  5B76 A;  3SOU A;  2EOD A;  4MSX A;  3I2D A;  1ZBD B;  3LQI A;  2VJE A;  2HDP A;  2KR4 A;  3MHS A;  1WEO A;  5FEY A;  1N87 A;  1WEN A;  1IYM A;  1U6G B;  3LRQ A;  2C2L A;  2PUY A;  4WZ2 A;  5LCW B;  4FK5 A;  2L5U A;  3U5N A;  4B86 C;  4B7Y C;  3ASL A;  4PPE A;  4PTB A;  5EYA F;  2MD8 C;  1VYX A;  5DKA A;  2VPG A;  2Y43 A;  2FUU A;  2YRE A;  5C11 A;  3O36 A;  1FBV A;  4IC2 A;  5D1M B;  2G6Q A;  4ZDT A;  5D1K B;  3SOW A;  5I3L A;  2YQL A;  3QZV A;  2L0B A;  5KH7 A;  4LJN A;  1Z2Q A;  2JMI A;  2LDR A;  4TKP B;  1G25 A;  5H1V A;  3FL2 A;  4F52 B;  2KGI A;  4AVX A;  2ECG A;  4N4F A;  4QF3 A;  5TDW A;  4A49 A;  3KQI A;  2K16 A;  5C13 A;  2OXQ C;  3N9Q A;  4R7E A;  4X3G A;  4AP4 A;  2CKL A;  4YBT A;  3LQJ A;  2K1J A;  2C2V S;  4L58 A;  2YT5 A;  4A0C D;  2M1R A;  2QIZ A;  5B79 A;  3L11 A;  2H0D B;  1WE9 A;  3U5M A;  5DIN A;  2VJF A;  1Z6U A;  3O7A A;  2MD7 B;  5D1L B;  5FB1 A;  2YUC A;  1BOR A;  2VPD A;  2ECN A;  4ZQL A;  3ZPV E;  1HYI A;  3VK6 A;  3GL6 A;  5B78 A;  2LGL A;  5TBN A;  4XI1 A;  2PNX A;  1F62 A;  4WZ0 A;  1RMD A;  5LKZ A;  4I7D A;  3ZVZ B;  2QIC A;  3L1Z B;  2MT5 A;  4NN2 A;  2K17 A;  2VJE B;  3MHH A;  5H1U A;  2ECT A;  2RI7 A;  3M99 A;  2I50 A;  2KGG A;  2XEU A;  4BHW A;  3HCT A;  2CT2 A;  4CCG X;  4FIP A;  1WEV A;  1WFK A;  2MNY A;  4L7X A;  2CSZ A;  1E4U A;  2LGV A;  3O37 A;  4AYC A;  3O34 A;  2XB1 A;  2LQ6 A;  5LKT A;  2ECW A;  1DVP A;  2KRE A;  2KWN A;  2MA5 A;  4UI9 B;  1CHC A;  2VNF A;  3EB6 A;  1VD4 A;  4P5O B;  4LLB A;  2JMD A;  3O35 A;  4YAX A;  4GNG A;  1WEU A;  2ECI A;  2LGK A;  3SHB A;  1WGM A;  2YW8 A;  5FB0 A;  4YAD A;  4ZUX U;  2YYR A;  2MA6 A;  2VPE A; 
#chains in the Genus database with same CATH topology
 1HYJ A;  3RPG B;  2DX8 A;  2LGG A;  4GNF A;  2FSA A;  2M85 A;  1JM7 A;  4GB0 A;  3O47 A;  2YU4 A;  2K4D A;  3N9O A;  2CKL B;  3U5P A;  2IDA A;  4GND A;  2IQJ A;  3HTK C;  3U5O A;  3ZVY A;  4C9Z A;  5G04 B;  3PUQ A;  2MKE A;  5KH3 A;  5H1T A;  2VJF B;  4LK9 A;  1WEM A;  2LXP C;  2Y1N A;  2MIQ A;  4QF2 A;  2KE1 A;  4WZ3 B;  2CRW A;  4I7B A;  5SVX A;  2CSV A;  2XOY A;  1WIL A;  5SVI A;  1WEW A;  2QJ0 A;  3LDY A;  5KH9 A;  2LRI C;  1VFY A;  1WEP A;  4QQ4 A;  4S3O C;  1MM2 A;  2LV9 A;  2Y1M A;  3RTR B;  4IC3 A;  1WES A;  3DQV R;  2G43 A;  2YUR A;  1X4U A;  5B8D A;  3IHP A;  2OWA A;  3LVQ E;  1FP0 A;  2FUI A;  2FFW A;  2M3H A;  4Q6F A;  2E6S A;  5K3Q A;  2MNZ A;  1V87 A;  4YAT A;  1DCQ A;  4O64 A;  2YSJ A;  3T6R A;  5B75 A;  4YAB A;  3DWD A;  2LN0 A;  3HCU A;  3MDB C;  5AIT A;  5G05 B;  4Z0R A;  3LVR E;  4AYC B;  2D8S A;  3L1X A;  3SUB A;  3KNV A;  3T7L A;  2HYE D;  2F42 A;  3C5K A;  3EB5 A;  2L75 A;  5G0F A;  2ECV A;  3HCS A;  3DPL R;  4R8P K;  2YHO A;  2RSD A;  5J3X A;  1X4I A;  2AN6 A;  2L43 A;  5LKX A;  4CA1 A;  1WEE A;  4UP5 A;  3N9L A;  3FJU B;  4O62 A;  4V3L C;  3GV4 A;  1Z60 A;  5AIU A;  2F6N A;  2KIZ A;  5B77 A;  4F1P A;  4WA6 A;  3PHD A;  4LAD B;  1JOC A;  4R2Y A;  2YSM A;  2EGP A;  1XWH A;  2KWJ A;  1LDK C;  2DJA A;  1JM7 B;  5TRB A;  2BAY A;  3FEH A;  4V3K C;  2ZET C;  4MVT A;  4UP0 A;  2LXH C;  4BBQ A;  4S3O B;  2EA6 A;  3PUR A;  4YBS A;  5JG6 A;  4N3W A;  2KFT A;  2F6J A;  2ECJ A;  3ZNI A;  2M6M A;  3N9P A;  4FJC A;  5TAB A;  3SOX A;  2L80 A;  2UZG A;  5SVI B;  2CRR A;  2KU3 A;  3N9N A;  1X4J A;  3NG2 A;  2YQM A;  2KYU A;  4YBM A;  4YC9 A;  2XOC A;  3KV6 A;  3C6W A;  2NAA A;  4AUQ B;  4A4B A;  1T1H A;  3N9M A;  4FO9 A;  4GNE A;  5FER A;  4I7C A;  5H9M A;  1WIM A;  3JUE A;  3ZPV 1;  2MUM A;  2E6R A;  3M7K A;  2P57 A;  3O70 A;  2E61 A;  5SVY A;  3KV5 A;  2VPB A;  4W4U A;  2VP7 A;  2H0D A;  4LKA A;  3RPG C;  2JMJ A;  2FD4 A;  2JRJ A;  3V43 A;  3ZTG A;  2KWK A;  2YHN A;  2JUN A;  1MM3 A;  2KWO A;  1LDJ B;  2G45 A;  1WEQ A;  1K2F A;  2JM3 A;  3M62 A;  4A4C A;  3ZYQ A;  3LQH A;  5LKU A;  2B0O E;  2CSY A;  5TDR A;  3E2D A;  3M63 A;  2CON A;  3FAN A;  3O33 A;  2RR4 A;  5B76 A;  3SOU A;  2EOD A;  4MSX A;  3I2D A;  2EGM A;  1ZBD B;  3LQI A;  4Z0O A;  2VJE A;  2HDP A;  2KR4 A;  3MHS A;  1WEO A;  3PLW A;  5FEY A;  1N87 A;  1WEN A;  1IYM A;  3FAO A;  1U6G B;  3LRQ A;  2XOZ A;  2C2L A;  4OGC A;  3T9K A;  2PUY A;  4WZ2 A;  5LCW B;  4FK5 A;  2L5U A;  3U5N A;  4B86 C;  4B7Y C;  3ASL A;  4PPE A;  2D8U A;  4PTB A;  5EYA F;  2MD8 C;  1VYX A;  5DKA A;  3DDT A;  2VPG A;  2Y43 A;  2FUU A;  3KDE C;  2YRE A;  5C11 A;  3O36 A;  1FBV A;  4IC2 A;  5D1M B;  2G6Q A;  2LAU A;  5D1K B;  4ZDT A;  3SOW A;  5I3L A;  2YQL A;  2KKX A;  2DSM A;  3QZV A;  2L0B A;  5KH7 A;  3LJU X;  4LJN A;  1Z2Q A;  2JMI A;  2LDR A;  4TKP B;  1G25 A;  5H1V A;  3FL2 A;  4F52 B;  2KGI A;  4AVX A;  3Q1D A;  2ECG A;  4N4F A;  4QF3 A;  5TDW A;  4A49 A;  3KQI A;  2K16 A;  5C13 A;  2OXQ C;  3N9Q A;  4R7E A;  4X3G A;  4AP4 A;  2CKL A;  4YBT A;  3LQJ A;  2K1J A;  2C2V S;  4L58 A;  2YT5 A;  4A0C D;  2M1R A;  2QIZ A;  5B79 A;  3L11 A;  2H0D B;  1WE9 A;  3U5M A;  5DIN A;  2VJF A;  2KKY A;  1Z6U A;  3O7A A;  2MD7 B;  5D1L B;  5FB1 A;  2YUC A;  1BOR A;  2VPD A;  2ECN A;  2M13 A;  4ZQL A;  3ZPV E;  1HYI A;  3VK6 A;  3GL6 A;  5B78 A;  2LGL A;  5TBN A;  1MBM A;  4XI1 A;  2PNX A;  1F62 A;  4WZ0 A;  1RMD A;  5LKZ A;  4I7D A;  2XP0 A;  3ZVZ B;  2QIC A;  3L1Z B;  2MT5 A;  4NN2 A;  2K17 A;  2VJE B;  3MHH A;  5H1U A;  2ECT A;  2RI7 A;  2EXU A;  3M99 A;  2I50 A;  2KGG A;  2XEU A;  2YVR A;  4BHW A;  3HCT A;  2CT2 A;  4CCG X;  4FIP A;  1WEV A;  1WFK A;  2MNY A;  4L7X A;  2CSZ A;  1E4U A;  4OGE A;  2L7P A;  2LGV A;  3O37 A;  4AYC A;  3O34 A;  2XB1 A;  2LQ6 A;  5LKT A;  2ECW A;  1DVP A;  2KRE A;  2KWN A;  2MA5 A;  4UI9 B;  1CHC A;  2VNF A;  3EB6 A;  1VD4 A;  4P5O B;  4LLB A;  2JMD A;  3FM8 C;  4H9D A;  3O35 A;  4YAX A;  4GNG A;  1WEU A;  2ECI A;  2LGK A;  1WGM A;  2YW8 A;  3SHB A;  5FB0 A;  4YAD A;  3H7H A;  4ZUX U;  2YYR A;  2MA6 A;  2VPE A; 
#chains in the Genus database with same CATH homology
 1HYJ A;  3RPG B;  2DX8 A;  2LGG A;  4GNF A;  2FSA A;  2M85 A;  1JM7 A;  4GB0 A;  2YU4 A;  2K4D A;  3N9O A;  2CKL B;  3U5P A;  2IDA A;  4GND A;  3HTK C;  3U5O A;  3ZVY A;  4C9Z A;  5G04 B;  3PUQ A;  5KH3 A;  5H1T A;  2VJF B;  4LK9 A;  1WEM A;  2LXP C;  2Y1N A;  2MIQ A;  4QF2 A;  2KE1 A;  4WZ3 B;  4I7B A;  1WIL A;  1WEW A;  2QJ0 A;  5KH9 A;  2LRI C;  1VFY A;  1WEP A;  4S3O C;  1MM2 A;  2LV9 A;  2Y1M A;  3RTR B;  4IC3 A;  1WES A;  3DQV R;  2G43 A;  2YUR A;  1X4U A;  5B8D A;  3IHP A;  1FP0 A;  2FUI A;  2M3H A;  4Q6F A;  2E6S A;  2MNZ A;  1V87 A;  4YAT A;  4O64 A;  2YSJ A;  3T6R A;  5B75 A;  4YAB A;  2LN0 A;  3HCU A;  5AIT A;  5G05 B;  4AYC B;  2D8S A;  3L1X A;  3KNV A;  3T7L A;  2HYE D;  2F42 A;  3C5K A;  3EB5 A;  2L75 A;  5G0F A;  2ECV A;  3HCS A;  3DPL R;  4R8P K;  2YHO A;  2RSD A;  5J3X A;  1X4I A;  2AN6 A;  2L43 A;  5LKX A;  4CA1 A;  1WEE A;  4UP5 A;  3N9L A;  4V3L C;  3GV4 A;  1Z60 A;  5AIU A;  2F6N A;  2KIZ A;  5B77 A;  4WA6 A;  3PHD A;  4LAD B;  1JOC A;  4R2Y A;  2YSM A;  2EGP A;  1XWH A;  2KWJ A;  1LDK C;  1JM7 B;  5TRB A;  2BAY A;  4V3K C;  2ZET C;  4MVT A;  4UP0 A;  2LXH C;  4BBQ A;  4S3O B;  2EA6 A;  3PUR A;  4YBS A;  5JG6 A;  4N3W A;  2KFT A;  2F6J A;  2ECJ A;  3ZNI A;  2M6M A;  3N9P A;  4FJC A;  5TAB A;  3SOX A;  2L80 A;  2UZG A;  2KU3 A;  3N9N A;  1X4J A;  3NG2 A;  2YQM A;  2KYU A;  4YBM A;  4YC9 A;  3KV6 A;  3C6W A;  2NAA A;  4AUQ B;  4A4B A;  1T1H A;  3N9M A;  4FO9 A;  4GNE A;  5FER A;  4I7C A;  5H9M A;  1WIM A;  3ZPV 1;  2MUM A;  2E6R A;  3O70 A;  3KV5 A;  2VPB A;  4W4U A;  2VP7 A;  2H0D A;  4LKA A;  3RPG C;  2JMJ A;  2JRJ A;  3V43 A;  3ZTG A;  2KWK A;  2YHN A;  1MM3 A;  2KWO A;  1LDJ B;  2G45 A;  1WEQ A;  1K2F A;  3M62 A;  4A4C A;  3ZYQ A;  3LQH A;  5LKU A;  2CSY A;  5TDR A;  3M63 A;  3O33 A;  5B76 A;  3SOU A;  2EOD A;  4MSX A;  3I2D A;  1ZBD B;  3LQI A;  2VJE A;  2HDP A;  2KR4 A;  3MHS A;  1WEO A;  5FEY A;  1N87 A;  1WEN A;  1IYM A;  1U6G B;  3LRQ A;  2C2L A;  2PUY A;  4WZ2 A;  5LCW B;  4FK5 A;  2L5U A;  3U5N A;  4B86 C;  4B7Y C;  3ASL A;  4PPE A;  4PTB A;  5EYA F;  2MD8 C;  1VYX A;  5DKA A;  2VPG A;  2Y43 A;  2FUU A;  2YRE A;  5C11 A;  3O36 A;  1FBV A;  4IC2 A;  5D1M B;  2G6Q A;  4ZDT A;  5D1K B;  3SOW A;  5I3L A;  2YQL A;  3QZV A;  2L0B A;  5KH7 A;  4LJN A;  1Z2Q A;  2JMI A;  2LDR A;  4TKP B;  1G25 A;  5H1V A;  3FL2 A;  4F52 B;  2KGI A;  4AVX A;  2ECG A;  4N4F A;  4QF3 A;  5TDW A;  4A49 A;  3KQI A;  2K16 A;  5C13 A;  2OXQ C;  3N9Q A;  4R7E A;  4X3G A;  4AP4 A;  2CKL A;  4YBT A;  3LQJ A;  2K1J A;  2C2V S;  4L58 A;  2YT5 A;  4A0C D;  2M1R A;  2QIZ A;  5B79 A;  3L11 A;  2H0D B;  1WE9 A;  3U5M A;  5DIN A;  2VJF A;  1Z6U A;  3O7A A;  2MD7 B;  5D1L B;  5FB1 A;  2YUC A;  1BOR A;  2VPD A;  2ECN A;  4ZQL A;  3ZPV E;  1HYI A;  3VK6 A;  3GL6 A;  5B78 A;  2LGL A;  5TBN A;  4XI1 A;  2PNX A;  1F62 A;  4WZ0 A;  1RMD A;  5LKZ A;  4I7D A;  3ZVZ B;  2QIC A;  3L1Z B;  2MT5 A;  4NN2 A;  2K17 A;  2VJE B;  3MHH A;  5H1U A;  2ECT A;  2RI7 A;  3M99 A;  2I50 A;  2KGG A;  2XEU A;  4BHW A;  3HCT A;  2CT2 A;  4CCG X;  4FIP A;  1WEV A;  1WFK A;  2MNY A;  4L7X A;  2CSZ A;  1E4U A;  2LGV A;  3O37 A;  4AYC A;  3O34 A;  2XB1 A;  2LQ6 A;  5LKT A;  2ECW A;  1DVP A;  2KRE A;  2KWN A;  2MA5 A;  4UI9 B;  1CHC A;  2VNF A;  3EB6 A;  1VD4 A;  4P5O B;  4LLB A;  2JMD A;  3O35 A;  4YAX A;  4GNG A;  1WEU A;  2ECI A;  2LGK A;  3SHB A;  1WGM A;  2YW8 A;  5FB0 A;  4YAD A;  4ZUX U;  2YYR A;  2MA6 A;  2VPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...