2VJEA

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
LNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the MDM2/MDMX RING domain heterodimer reveals dimerization is required for their ubiquitylation in trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
total genus 12
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjeA00
3HCUA 1LDKC 3M63A 3M62A 3ZPVE 4A49A 1X4UA 4GNFA 1VD4A 5LKTA 3T6RA 2JMJA 2KGIA 5G05B 4YBTA 5G04B 4B86C 5B78A 2KGGA 2YU4A 1WIMA 3O36A 5DKAA 4O64A 4ZUXU 2LGKA 2YUCA 2XB1A 4NN2A 3O70A 1VFYA 2YT5A 1U6GB 1WENA 5TDWA 5AIUA 2LRIC 2YYRA 4F52B 2G43A 5B75A 2CSYA 4C9ZA 1N87A 2VJEA 3PURA 2D8SA 2VNFA 4R2YA 1F62A 3ZNIA 3L11A 2VJFB 3EB5A 3SHBA 1E4UA 3ZVZB 2E6RA 2G6QA 3U5MA 4CA1A 2ECTA 2L5UA 3GL6A 3HCSA 5TBNA 4UP5A 4A4CA 2MIQA 3NG2A 5J3XA 3O33A 2VPEA 3RPGB 3KV5A 3T7LA 1HYIA 3PUQA 3N9PA 1DVPA 3HTKC 4I7DA 2LN0A 2MA5A 5H1TA 2Y43A 1VYXA 1FP0A 4S3OB 1JM7A 2ECJA 2VPGA 2VPDA 4I7CA 2AN6A 3N9MA 3DPLR 3U5NA 3DQVR 1WGMA 2IDAA 5H9MA 2LXPC 3ZPV1 3PHDA 5D1KB 4FJCA 2FUUA 4R7EA 3M99A 2EA6A 1LDJB 3ASLA 4UP0A 5DINA 2KREA 5LKZA 2F6NA 2C2VS 4A0CD 2KWKA 4YBMA 4WZ0A 1WESA 2LGVA 2MNYA 2VJEB 2Y1MA 2ECVA 5H1VA 4YABA 2I50A 2LQ6A 2UZGA 4FO9A 5FB1A 4R8PK 4WA6A 2RSDA 2PNXA 3C5KA 3V43A 3LQJA 2LGGA 3O7AA 2HDPA 4PPEA 1HYJA 2MT5A 2QIZA 3MHSA 2ECIA 2CT2A 1WEPA 2EGPA 2M6MA 3U5PA 2RI7A 4FIPA 4ZQLA 4AYCB 2KIZA 2F6JA 2YHNA 4W4UA 1WEUA 4P5OB 2CSZA 5D1LB 4GB0A 1MM3A 3SOUA 4FK5A 3L1ZB 4MVTA 5C11A 4X3GA 1X4IA 3HCTA 1RMDA 2QICA 2XEUA 1WEQA 2YHOA 2YREA 4LLBA 4LK9A 2ECWA 2FUIA 3N9QA 5TABA 2DX8A 1K2FA 2KE1A 2K17A 3I2DA 2KU3A 3O37A 4I7BA 1WILA 2VP7A 3N9OA 3N9NA 2ZETC 3RPGC 4QF2A 2C2LA 5B8DA 2KFTA 4AP4A 4LKAA 4AYCA 2PUYA 5D1MB 2M3HA 3EB6A 2VPBA 2JRJA 1WEWA 4YATA 2E6SA 2LGLA 3LRQA 4N3WA 3RTRB 5TRBA 5LKUA 1WFKA 4ZDTA 2VJFA 5KH7A 4BHWA 5LKXA 2M85A 3ZVYA 2HYED 1IYMA 1FBVA 3LQIA 4WZ3B 3MHHA 4YADA 5G0FA 3FL2A 5FERA 1MM2A 5TDRA 2M1RA 2YQLA 1Z6UA 4L7XA 5EYAF 4LADB 2L80A 4LJNA 2G45A 4V3KC 2FSAA 4MSXA 4GNGA 4N4FA 1XWHA 2F42A 2Y1NA 2L0BA 4GNDA 5B76A 3ZYQA 4L58A 4AVXA 1ZBDB 1JOCA 2JMDA 4Q6FA 1JM7B 2H0DA 1X4JA 2MNZA 1WE9A 1Z2QA 4TKPB 2LXHC 1CHCA 1T1HA 3L1XA 2NAAA 3N9LA 1V87A 2L75A 2YQMA 4UI9B 3U5OA 2LV9A 5C13A 2CKLA 2BAYA 4B7YC 1Z60A 2K16A 2MA6A 5KH3A 2YURA 2KWOA 2EODA 4YAXA 3O35A 5H1UA 4YC9A 4WZ2A 2JMIA 4S3OC 2K1JA 3C6WA 3KQIA 5I3LA 5FB0A 3SOWA 3VK6A 1WEOA 3O34A 4BBQA 2MD7B 5B77A 3IHPA 2CKLB 4QF3A 1WEEA 5KH9A 5JG6A 4AUQB 2K4DA 2OXQC 2L43A 5AITA 2YSJA 1WEMA 4XI1A 3ZTGA 2KWJA 2KYUA 2YSMA 4IC3A 2ECNA 2YW8A 4A4BA 2ECGA 3LQHA 3QZVA 5FEYA 4YBSA 2KR4A 2QJ0A 2MD8C 4CCGX 2KWNA 4IC2A 3SOXA 1WEVA 2LDRA 2MUMA 4V3LC 3KNVA 4PTBA 4GNEA 2H0DB 3GV4A 1G25A 1BORA 5LCWB 5B79A 3KV6A
chains in the Genus database with same CATH superfamily
3HCUA 1LDKC 3M63A 3M62A 3ZPVE 2CRRA 4A49A 2DJAA 1X4UA 4GNFA 1VD4A 5LKTA 2RR4A 3T6RA 2JMJA 2KGIA 5G05B 2P57A 2IQJA 4YBTA 5G04B 4B86C 5B78A 1MBMA 2KGGA 3Q1DA 2D8UA 2YU4A 1WIMA 3O36A 5DKAA 4O64A 4ZUXU 2LGKA 2YUCA 2XB1A 4NN2A 3O70A 1VFYA 2YT5A 1U6GB 1WENA 5TDWA 5AIUA 2LRIC 2YYRA 2OWAA 2L7PA 4F52B 2G43A 5B75A 2CSYA 4C9ZA 2EXUA 1N87A 2VJEA 3PURA 2D8SA 2VNFA 4R2YA 1F62A 3L11A 3ZNIA 1DCQA 2VJFB 3EB5A 3SHBA 1E4UA 3ZVZB 2E6RA 2G6QA 2MKEA 3U5MA 4CA1A 2ECTA 2L5UA 3GL6A 3HCSA 5TBNA 4UP5A 4A4CA 2MIQA 3NG2A 5J3XA 3DWDA 2VPEA 3O33A 3RPGB 3KV5A 3T7LA 1HYIA 3PUQA 3N9PA 1DVPA 3HTKC 4I7DA 5SVIA 2LN0A 2MA5A 2KKXA 5H1TA 2Y43A 3JUEA 5K3QA 1VYXA 1FP0A 4S3OB 1JM7A 2ECJA 2VPGA 2VPDA 4I7CA 2AN6A 3N9MA 3DPLR 3U5NA 3DQVR 1WGMA 2IDAA 5H9MA 2LXPC 3ZPV1 3PHDA 5D1KB 4FJCA 2FUUA 4R7EA 2M13A 3M99A 2EA6A 1LDJB 3ASLA 4UP0A 5DINA 2KREA 5LKZA 2F6NA 2C2VS 4A0CD 2KWKA 4YBMA 4WZ0A 1WESA 2LGVA 2MNYA 2VJEB 2Y1MA 2ECVA 5H1VA 4YABA 2I50A 2LQ6A 2UZGA 4FO9A 3MDBC 5FB1A 4R8PK 4WA6A 2RSDA 2PNXA 3C5KA 3V43A 3FAOA 3LQJA 2LGGA 3O7AA 5SVIB 2HDPA 4PPEA 1HYJA 2MT5A 2QIZA 3MHSA 2ECIA 2CT2A 1WEPA 5SVYA 4F1PA 2EGPA 3E2DA 2M6MA 3U5PA 4ZQLA 2RI7A 3LJUX 4FIPA 4AYCB 2CONA 2KIZA 2F6JA 2YHNA 4W4UA 1WEUA 4P5OB 2CSZA 5D1LB 4GB0A 1MM3A 3SOUA 4FK5A 3L1ZB 4MVTA 3M7KA 5C11A 4X3GA 1X4IA 3LDYA 2JM3A 3HCTA 3LVQE 1RMDA 2QICA 2XEUA 1WEQA 2YHOA 2YREA 4LLBA 4LK9A 2ECWA 3SUBA 2XP0A 2FUIA 3N9QA 5TABA 2DX8A 1K2FA 4Z0RA 2KE1A 2K17A 3I2DA 2KU3A 3O37A 4I7BA 1WILA 2VP7A 3N9OA 3N9NA 2ZETC 2EGMA 2CRWA 3RPGC 4QF2A 2C2LA 5B8DA 2KFTA 4AP4A 4LKAA 4AYCA 2PUYA 5D1MB 2M3HA 3EB6A 2VPBA 2JRJA 3FEHA 1WEWA 4YATA 2E6SA 2LGLA 3LRQA 2DSMA 3FJUB 4N3WA 3RTRB 5TRBA 3FM8C 5LKUA 1WFKA 4OGCA 4ZDTA 2VJFA 4H9DA 5KH7A 4BHWA 5LKXA 2M85A 3ZVYA 2HYED 1IYMA 1FBVA 3LQIA 4WZ3B 3MHHA 4YADA 5G0FA 2JUNA 3FL2A 5FERA 1MM2A 5TDRA 2M1RA 2YQLA 1Z6UA 2CSVA 4L7XA 5EYAF 4LADB 2L80A 4LJNA 2G45A 2XOCA 4V3KC 2FSAA 4MSXA 2XOZA 4GNGA 4N4FA 1XWHA 2F42A 5SVXA 2Y1NA 2L0BA 4GNDA 5B76A 3FANA 3ZYQA 4O62A 4L58A 3KDEC 4AVXA 1ZBDB 1JOCA 2JMDA 4Q6FA 1JM7B 2H0DA 1X4JA 2MNZA 1WE9A 1Z2QA 4TKPB 2LXHC 1CHCA 1T1HA 3O47A 3L1XA 2NAAA 3N9LA 1V87A 4QQ4A 2L75A 2YQMA 4UI9B 3U5OA 2LV9A 5C13A 2CKLA 2BAYA 4B7YC 1Z60A 3LVRE 2K16A 2MA6A 5KH3A 2YURA 2KWOA 2EODA 2LAUA 4YAXA 3O35A 5H1UA 4YC9A 4WZ2A 2JMIA 4S3OC 2K1JA 2FFWA 3C6WA 3KQIA 5I3LA 2E61A 2FD4A 5FB0A 3SOWA 3VK6A 2XOYA 1WEOA 3O34A 4BBQA 2MD7B 5B77A 3IHPA 2CKLB 4QF3A 1WEEA 5KH9A 2KKYA 5JG6A 4AUQB 3T9KA 2K4DA 2OXQC 2L43A 5AITA 2YSJA 1WEMA 4XI1A 3ZTGA 2KWJA 2KYUA 2YSMA 4IC3A 2ECNA 2YW8A 4A4BA 2ECGA 3PLWA 4Z0OA 3LQHA 2B0OE 3QZVA 5FEYA 4YBSA 2YVRA 2KR4A 2QJ0A 3DDTA 2MD8C 4CCGX 4IC2A 2KWNA 3SOXA 1WEVA 2LDRA 2MUMA 4V3LC 3KNVA 4PTBA 4GNEA 2H0DB 4OGEA 3GV4A 1G25A 1BORA 5LCWB 5B79A 3H7HA 3KV6A
chains in the Genus database with same CATH topology
3HCUA 1LDKC 3M63A 3M62A 3ZPVE 4A49A 1X4UA 4GNFA 1VD4A 5LKTA 3T6RA 2JMJA 2KGIA 5G05B 4YBTA 5G04B 4B86C 5B78A 2KGGA 2YU4A 1WIMA 3O36A 5DKAA 4O64A 4ZUXU 2LGKA 2YUCA 2XB1A 4NN2A 3O70A 1VFYA 2YT5A 1U6GB 1WENA 5TDWA 5AIUA 2LRIC 2YYRA 4F52B 2G43A 5B75A 2CSYA 4C9ZA 1N87A 2VJEA 3PURA 2D8SA 2VNFA 4R2YA 1F62A 3ZNIA 3L11A 2VJFB 3EB5A 3SHBA 1E4UA 3ZVZB 2E6RA 2G6QA 3U5MA 4CA1A 2ECTA 2L5UA 3GL6A 3HCSA 5TBNA 4UP5A 4A4CA 2MIQA 3NG2A 5J3XA 3O33A 2VPEA 3RPGB 3KV5A 3T7LA 1HYIA 3PUQA 3N9PA 1DVPA 3HTKC 4I7DA 2LN0A 2MA5A 5H1TA 2Y43A 1VYXA 1FP0A 4S3OB 1JM7A 2ECJA 2VPGA 2VPDA 4I7CA 2AN6A 3N9MA 3DPLR 3U5NA 3DQVR 1WGMA 2IDAA 5H9MA 2LXPC 3ZPV1 3PHDA 5D1KB 4FJCA 2FUUA 4R7EA 3M99A 2EA6A 1LDJB 3ASLA 4UP0A 5DINA 2KREA 5LKZA 2F6NA 2C2VS 4A0CD 2KWKA 4YBMA 4WZ0A 1WESA 2LGVA 2MNYA 2VJEB 2Y1MA 2ECVA 5H1VA 4YABA 2I50A 2LQ6A 2UZGA 4FO9A 5FB1A 4R8PK 4WA6A 2RSDA 2PNXA 3C5KA 3V43A 3LQJA 2LGGA 3O7AA 2HDPA 4PPEA 1HYJA 2MT5A 2QIZA 3MHSA 2ECIA 2CT2A 1WEPA 2EGPA 2M6MA 3U5PA 2RI7A 4FIPA 4ZQLA 4AYCB 2KIZA 2F6JA 2YHNA 4W4UA 1WEUA 4P5OB 2CSZA 5D1LB 4GB0A 1MM3A 3SOUA 4FK5A 3L1ZB 4MVTA 5C11A 4X3GA 1X4IA 3HCTA 1RMDA 2QICA 2XEUA 1WEQA 2YHOA 2YREA 4LLBA 4LK9A 2ECWA 2FUIA 3N9QA 5TABA 2DX8A 1K2FA 2KE1A 2K17A 3I2DA 2KU3A 3O37A 4I7BA 1WILA 2VP7A 3N9OA 3N9NA 2ZETC 3RPGC 4QF2A 2C2LA 5B8DA 2KFTA 4AP4A 4LKAA 4AYCA 2PUYA 5D1MB 2M3HA 3EB6A 2VPBA 2JRJA 1WEWA 4YATA 2E6SA 2LGLA 3LRQA 4N3WA 3RTRB 5TRBA 5LKUA 1WFKA 4ZDTA 2VJFA 5KH7A 4BHWA 5LKXA 2M85A 3ZVYA 2HYED 1IYMA 1FBVA 3LQIA 4WZ3B 3MHHA 4YADA 5G0FA 3FL2A 5FERA 1MM2A 5TDRA 2M1RA 2YQLA 1Z6UA 4L7XA 5EYAF 4LADB 2L80A 4LJNA 2G45A 4V3KC 2FSAA 4MSXA 4GNGA 4N4FA 1XWHA 2F42A 2Y1NA 2L0BA 4GNDA 5B76A 3ZYQA 4L58A 4AVXA 1ZBDB 1JOCA 2JMDA 4Q6FA 1JM7B 2H0DA 1X4JA 2MNZA 1WE9A 1Z2QA 4TKPB 2LXHC 1CHCA 1T1HA 3L1XA 2NAAA 3N9LA 1V87A 2L75A 2YQMA 4UI9B 3U5OA 2LV9A 5C13A 2CKLA 2BAYA 4B7YC 1Z60A 2K16A 2MA6A 5KH3A 2YURA 2KWOA 2EODA 4YAXA 3O35A 5H1UA 4YC9A 4WZ2A 2JMIA 4S3OC 2K1JA 3C6WA 3KQIA 5I3LA 5FB0A 3SOWA 3VK6A 1WEOA 3O34A 4BBQA 2MD7B 5B77A 3IHPA 2CKLB 4QF3A 1WEEA 5KH9A 5JG6A 4AUQB 2K4DA 2OXQC 2L43A 5AITA 2YSJA 1WEMA 4XI1A 3ZTGA 2KWJA 2KYUA 2YSMA 4IC3A 2ECNA 2YW8A 4A4BA 2ECGA 3LQHA 3QZVA 5FEYA 4YBSA 2KR4A 2QJ0A 2MD8C 4CCGX 2KWNA 4IC2A 3SOXA 1WEVA 2LDRA 2MUMA 4V3LC 3KNVA 4PTBA 4GNEA 2H0DB 3GV4A 1G25A 1BORA 5LCWB 5B79A 3KV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCU A;  1LDK C;  3M63 A;  3M62 A;  3ZPV E;  4A49 A;  1X4U A;  4GNF A;  1VD4 A;  5LKT A;  3T6R A;  2JMJ A;  2KGI A;  5G05 B;  4YBT A;  5G04 B;  4B86 C;  5B78 A;  2KGG A;  2YU4 A;  1WIM A;  3O36 A;  5DKA A;  4O64 A;  4ZUX U;  2LGK A;  2YUC A;  2XB1 A;  4NN2 A;  3O70 A;  1VFY A;  2YT5 A;  1U6G B;  1WEN A;  5TDW A;  5AIU A;  2LRI C;  2YYR A;  4F52 B;  2G43 A;  5B75 A;  2CSY A;  4C9Z A;  1N87 A;  2VJE A;  3PUR A;  2D8S A;  2VNF A;  4R2Y A;  1F62 A;  3ZNI A;  3L11 A;  2VJF B;  3EB5 A;  3SHB A;  1E4U A;  3ZVZ B;  2E6R A;  2G6Q A;  3U5M A;  4CA1 A;  2ECT A;  2L5U A;  3GL6 A;  3HCS A;  5TBN A;  4UP5 A;  4A4C A;  2MIQ A;  3NG2 A;  5J3X A;  3O33 A;  2VPE A;  3RPG B;  3KV5 A;  3T7L A;  1HYI A;  3PUQ A;  3N9P A;  1DVP A;  3HTK C;  4I7D A;  2LN0 A;  2MA5 A;  5H1T A;  2Y43 A;  1VYX A;  1FP0 A;  4S3O B;  1JM7 A;  2ECJ A;  2VPG A;  2VPD A;  4I7C A;  2AN6 A;  3N9M A;  3DPL R;  3U5N A;  3DQV R;  1WGM A;  2IDA A;  5H9M A;  2LXP C;  3ZPV 1;  3PHD A;  5D1K B;  4FJC A;  2FUU A;  4R7E A;  3M99 A;  2EA6 A;  1LDJ B;  3ASL A;  4UP0 A;  5DIN A;  2KRE A;  5LKZ A;  2F6N A;  2C2V S;  4A0C D;  2KWK A;  4YBM A;  4WZ0 A;  1WES A;  2LGV A;  2MNY A;  2VJE B;  2Y1M A;  2ECV A;  5H1V A;  4YAB A;  2I50 A;  2LQ6 A;  2UZG A;  4FO9 A;  5FB1 A;  4R8P K;  4WA6 A;  2RSD A;  2PNX A;  3C5K A;  3V43 A;  3LQJ A;  2LGG A;  3O7A A;  2HDP A;  4PPE A;  1HYJ A;  2MT5 A;  2QIZ A;  3MHS A;  2ECI A;  2CT2 A;  1WEP A;  2EGP A;  2M6M A;  3U5P A;  2RI7 A;  4FIP A;  4ZQL A;  4AYC B;  2KIZ A;  2F6J A;  2YHN A;  4W4U A;  1WEU A;  4P5O B;  2CSZ A;  5D1L B;  4GB0 A;  1MM3 A;  3SOU A;  4FK5 A;  3L1Z B;  4MVT A;  5C11 A;  4X3G A;  1X4I A;  3HCT A;  1RMD A;  2QIC A;  2XEU A;  1WEQ A;  2YHO A;  2YRE A;  4LLB A;  4LK9 A;  2ECW A;  2FUI A;  3N9Q A;  5TAB A;  2DX8 A;  1K2F A;  2KE1 A;  2K17 A;  3I2D A;  2KU3 A;  3O37 A;  4I7B A;  1WIL A;  2VP7 A;  3N9O A;  3N9N A;  2ZET C;  3RPG C;  4QF2 A;  2C2L A;  5B8D A;  2KFT A;  4AP4 A;  4LKA A;  4AYC A;  2PUY A;  5D1M B;  2M3H A;  3EB6 A;  2VPB A;  2JRJ A;  1WEW A;  4YAT A;  2E6S A;  2LGL A;  3LRQ A;  4N3W A;  3RTR B;  5TRB A;  5LKU A;  1WFK A;  4ZDT A;  2VJF A;  5KH7 A;  4BHW A;  5LKX A;  2M85 A;  3ZVY A;  2HYE D;  1IYM A;  1FBV A;  3LQI A;  4WZ3 B;  3MHH A;  4YAD A;  5G0F A;  3FL2 A;  5FER A;  1MM2 A;  5TDR A;  2M1R A;  2YQL A;  1Z6U A;  4L7X A;  5EYA F;  4LAD B;  2L80 A;  4LJN A;  2G45 A;  4V3K C;  2FSA A;  4MSX A;  4GNG A;  4N4F A;  1XWH A;  2F42 A;  2Y1N A;  2L0B A;  4GND A;  5B76 A;  3ZYQ A;  4L58 A;  4AVX A;  1ZBD B;  1JOC A;  2JMD A;  4Q6F A;  1JM7 B;  2H0D A;  1X4J A;  2MNZ A;  1WE9 A;  1Z2Q A;  4TKP B;  2LXH C;  1CHC A;  1T1H A;  3L1X A;  2NAA A;  3N9L A;  1V87 A;  2L75 A;  2YQM A;  4UI9 B;  3U5O A;  2LV9 A;  5C13 A;  2CKL A;  2BAY A;  4B7Y C;  1Z60 A;  2K16 A;  2MA6 A;  5KH3 A;  2YUR A;  2KWO A;  2EOD A;  4YAX A;  3O35 A;  5H1U A;  4YC9 A;  4WZ2 A;  2JMI A;  4S3O C;  2K1J A;  3C6W A;  3KQI A;  5I3L A;  5FB0 A;  3SOW A;  3VK6 A;  1WEO A;  3O34 A;  4BBQ A;  2MD7 B;  5B77 A;  3IHP A;  2CKL B;  4QF3 A;  1WEE A;  5KH9 A;  5JG6 A;  4AUQ B;  2K4D A;  2OXQ C;  2L43 A;  5AIT A;  2YSJ A;  1WEM A;  4XI1 A;  3ZTG A;  2KWJ A;  2KYU A;  2YSM A;  4IC3 A;  2ECN A;  2YW8 A;  4A4B A;  2ECG A;  3LQH A;  3QZV A;  5FEY A;  4YBS A;  2KR4 A;  2QJ0 A;  2MD8 C;  4CCG X;  2KWN A;  4IC2 A;  3SOX A;  1WEV A;  2LDR A;  2MUM A;  4V3L C;  3KNV A;  4PTB A;  4GNE A;  2H0D B;  3GV4 A;  1G25 A;  1BOR A;  5LCW B;  5B79 A;  3KV6 A; 
#chains in the Genus database with same CATH topology
 3HCU A;  1LDK C;  3M63 A;  3M62 A;  3ZPV E;  2CRR A;  4A49 A;  2DJA A;  1X4U A;  4GNF A;  1VD4 A;  5LKT A;  2RR4 A;  3T6R A;  2JMJ A;  2KGI A;  5G05 B;  2P57 A;  2IQJ A;  4YBT A;  5G04 B;  4B86 C;  5B78 A;  1MBM A;  2KGG A;  3Q1D A;  2D8U A;  2YU4 A;  1WIM A;  3O36 A;  5DKA A;  4O64 A;  4ZUX U;  2LGK A;  2YUC A;  2XB1 A;  4NN2 A;  3O70 A;  1VFY A;  2YT5 A;  1U6G B;  1WEN A;  5TDW A;  5AIU A;  2LRI C;  2YYR A;  2OWA A;  2L7P A;  4F52 B;  2G43 A;  5B75 A;  2CSY A;  4C9Z A;  2EXU A;  1N87 A;  2VJE A;  3PUR A;  2D8S A;  2VNF A;  4R2Y A;  1F62 A;  3L11 A;  3ZNI A;  1DCQ A;  2VJF B;  3EB5 A;  3SHB A;  1E4U A;  3ZVZ B;  2E6R A;  2G6Q A;  2MKE A;  3U5M A;  4CA1 A;  2ECT A;  2L5U A;  3GL6 A;  3HCS A;  5TBN A;  4UP5 A;  4A4C A;  2MIQ A;  3NG2 A;  5J3X A;  3DWD A;  2VPE A;  3O33 A;  3RPG B;  3KV5 A;  3T7L A;  1HYI A;  3PUQ A;  3N9P A;  1DVP A;  3HTK C;  4I7D A;  5SVI A;  2LN0 A;  2MA5 A;  2KKX A;  5H1T A;  2Y43 A;  3JUE A;  5K3Q A;  1VYX A;  1FP0 A;  4S3O B;  1JM7 A;  2ECJ A;  2VPG A;  2VPD A;  4I7C A;  2AN6 A;  3N9M A;  3DPL R;  3U5N A;  3DQV R;  1WGM A;  2IDA A;  5H9M A;  2LXP C;  3ZPV 1;  3PHD A;  5D1K B;  4FJC A;  2FUU A;  4R7E A;  2M13 A;  3M99 A;  2EA6 A;  1LDJ B;  3ASL A;  4UP0 A;  5DIN A;  2KRE A;  5LKZ A;  2F6N A;  2C2V S;  4A0C D;  2KWK A;  4YBM A;  4WZ0 A;  1WES A;  2LGV A;  2MNY A;  2VJE B;  2Y1M A;  2ECV A;  5H1V A;  4YAB A;  2I50 A;  2LQ6 A;  2UZG A;  4FO9 A;  3MDB C;  5FB1 A;  4R8P K;  4WA6 A;  2RSD A;  2PNX A;  3C5K A;  3V43 A;  3FAO A;  3LQJ A;  2LGG A;  3O7A A;  5SVI B;  2HDP A;  4PPE A;  1HYJ A;  2MT5 A;  2QIZ A;  3MHS A;  2ECI A;  2CT2 A;  1WEP A;  5SVY A;  4F1P A;  2EGP A;  3E2D A;  2M6M A;  3U5P A;  4ZQL A;  2RI7 A;  3LJU X;  4FIP A;  4AYC B;  2CON A;  2KIZ A;  2F6J A;  2YHN A;  4W4U A;  1WEU A;  4P5O B;  2CSZ A;  5D1L B;  4GB0 A;  1MM3 A;  3SOU A;  4FK5 A;  3L1Z B;  4MVT A;  3M7K A;  5C11 A;  4X3G A;  1X4I A;  3LDY A;  2JM3 A;  3HCT A;  3LVQ E;  1RMD A;  2QIC A;  2XEU A;  1WEQ A;  2YHO A;  2YRE A;  4LLB A;  4LK9 A;  2ECW A;  3SUB A;  2XP0 A;  2FUI A;  3N9Q A;  5TAB A;  2DX8 A;  1K2F A;  4Z0R A;  2KE1 A;  2K17 A;  3I2D A;  2KU3 A;  3O37 A;  4I7B A;  1WIL A;  2VP7 A;  3N9O A;  3N9N A;  2ZET C;  2EGM A;  2CRW A;  3RPG C;  4QF2 A;  2C2L A;  5B8D A;  2KFT A;  4AP4 A;  4LKA A;  4AYC A;  2PUY A;  5D1M B;  2M3H A;  3EB6 A;  2VPB A;  2JRJ A;  3FEH A;  1WEW A;  4YAT A;  2E6S A;  2LGL A;  3LRQ A;  2DSM A;  3FJU B;  4N3W A;  3RTR B;  5TRB A;  3FM8 C;  5LKU A;  1WFK A;  4OGC A;  4ZDT A;  2VJF A;  4H9D A;  5KH7 A;  4BHW A;  5LKX A;  2M85 A;  3ZVY A;  2HYE D;  1IYM A;  1FBV A;  3LQI A;  4WZ3 B;  3MHH A;  4YAD A;  5G0F A;  2JUN A;  3FL2 A;  5FER A;  1MM2 A;  5TDR A;  2M1R A;  2YQL A;  1Z6U A;  2CSV A;  4L7X A;  5EYA F;  4LAD B;  2L80 A;  4LJN A;  2G45 A;  2XOC A;  4V3K C;  2FSA A;  4MSX A;  2XOZ A;  4GNG A;  4N4F A;  1XWH A;  2F42 A;  5SVX A;  2Y1N A;  2L0B A;  4GND A;  5B76 A;  3FAN A;  3ZYQ A;  4O62 A;  4L58 A;  3KDE C;  4AVX A;  1ZBD B;  1JOC A;  2JMD A;  4Q6F A;  1JM7 B;  2H0D A;  1X4J A;  2MNZ A;  1WE9 A;  1Z2Q A;  4TKP B;  2LXH C;  1CHC A;  1T1H A;  3O47 A;  3L1X A;  2NAA A;  3N9L A;  1V87 A;  4QQ4 A;  2L75 A;  2YQM A;  4UI9 B;  3U5O A;  2LV9 A;  5C13 A;  2CKL A;  2BAY A;  4B7Y C;  1Z60 A;  3LVR E;  2K16 A;  2MA6 A;  5KH3 A;  2YUR A;  2KWO A;  2EOD A;  2LAU A;  4YAX A;  3O35 A;  5H1U A;  4YC9 A;  4WZ2 A;  2JMI A;  4S3O C;  2K1J A;  2FFW A;  3C6W A;  3KQI A;  5I3L A;  2E61 A;  2FD4 A;  5FB0 A;  3SOW A;  3VK6 A;  2XOY A;  1WEO A;  3O34 A;  4BBQ A;  2MD7 B;  5B77 A;  3IHP A;  2CKL B;  4QF3 A;  1WEE A;  5KH9 A;  2KKY A;  5JG6 A;  4AUQ B;  3T9K A;  2K4D A;  2OXQ C;  2L43 A;  5AIT A;  2YSJ A;  1WEM A;  4XI1 A;  3ZTG A;  2KWJ A;  2KYU A;  2YSM A;  4IC3 A;  2ECN A;  2YW8 A;  4A4B A;  2ECG A;  3PLW A;  4Z0O A;  3LQH A;  2B0O E;  3QZV A;  5FEY A;  4YBS A;  2YVR A;  2KR4 A;  2QJ0 A;  3DDT A;  2MD8 C;  4CCG X;  4IC2 A;  2KWN A;  3SOX A;  1WEV A;  2LDR A;  2MUM A;  4V3L C;  3KNV A;  4PTB A;  4GNE A;  2H0D B;  4OGE A;  3GV4 A;  1G25 A;  1BOR A;  5LCW B;  5B79 A;  3H7H A;  3KV6 A; 
#chains in the Genus database with same CATH homology
 3HCU A;  1LDK C;  3M63 A;  3M62 A;  3ZPV E;  4A49 A;  1X4U A;  4GNF A;  1VD4 A;  5LKT A;  3T6R A;  2JMJ A;  2KGI A;  5G05 B;  4YBT A;  5G04 B;  4B86 C;  5B78 A;  2KGG A;  2YU4 A;  1WIM A;  3O36 A;  5DKA A;  4O64 A;  4ZUX U;  2LGK A;  2YUC A;  2XB1 A;  4NN2 A;  3O70 A;  1VFY A;  2YT5 A;  1U6G B;  1WEN A;  5TDW A;  5AIU A;  2LRI C;  2YYR A;  4F52 B;  2G43 A;  5B75 A;  2CSY A;  4C9Z A;  1N87 A;  2VJE A;  3PUR A;  2D8S A;  2VNF A;  4R2Y A;  1F62 A;  3ZNI A;  3L11 A;  2VJF B;  3EB5 A;  3SHB A;  1E4U A;  3ZVZ B;  2E6R A;  2G6Q A;  3U5M A;  4CA1 A;  2ECT A;  2L5U A;  3GL6 A;  3HCS A;  5TBN A;  4UP5 A;  4A4C A;  2MIQ A;  3NG2 A;  5J3X A;  3O33 A;  2VPE A;  3RPG B;  3KV5 A;  3T7L A;  1HYI A;  3PUQ A;  3N9P A;  1DVP A;  3HTK C;  4I7D A;  2LN0 A;  2MA5 A;  5H1T A;  2Y43 A;  1VYX A;  1FP0 A;  4S3O B;  1JM7 A;  2ECJ A;  2VPG A;  2VPD A;  4I7C A;  2AN6 A;  3N9M A;  3DPL R;  3U5N A;  3DQV R;  1WGM A;  2IDA A;  5H9M A;  2LXP C;  3ZPV 1;  3PHD A;  5D1K B;  4FJC A;  2FUU A;  4R7E A;  3M99 A;  2EA6 A;  1LDJ B;  3ASL A;  4UP0 A;  5DIN A;  2KRE A;  5LKZ A;  2F6N A;  2C2V S;  4A0C D;  2KWK A;  4YBM A;  4WZ0 A;  1WES A;  2LGV A;  2MNY A;  2VJE B;  2Y1M A;  2ECV A;  5H1V A;  4YAB A;  2I50 A;  2LQ6 A;  2UZG A;  4FO9 A;  5FB1 A;  4R8P K;  4WA6 A;  2RSD A;  2PNX A;  3C5K A;  3V43 A;  3LQJ A;  2LGG A;  3O7A A;  2HDP A;  4PPE A;  1HYJ A;  2MT5 A;  2QIZ A;  3MHS A;  2ECI A;  2CT2 A;  1WEP A;  2EGP A;  2M6M A;  3U5P A;  2RI7 A;  4FIP A;  4ZQL A;  4AYC B;  2KIZ A;  2F6J A;  2YHN A;  4W4U A;  1WEU A;  4P5O B;  2CSZ A;  5D1L B;  4GB0 A;  1MM3 A;  3SOU A;  4FK5 A;  3L1Z B;  4MVT A;  5C11 A;  4X3G A;  1X4I A;  3HCT A;  1RMD A;  2QIC A;  2XEU A;  1WEQ A;  2YHO A;  2YRE A;  4LLB A;  4LK9 A;  2ECW A;  2FUI A;  3N9Q A;  5TAB A;  2DX8 A;  1K2F A;  2KE1 A;  2K17 A;  3I2D A;  2KU3 A;  3O37 A;  4I7B A;  1WIL A;  2VP7 A;  3N9O A;  3N9N A;  2ZET C;  3RPG C;  4QF2 A;  2C2L A;  5B8D A;  2KFT A;  4AP4 A;  4LKA A;  4AYC A;  2PUY A;  5D1M B;  2M3H A;  3EB6 A;  2VPB A;  2JRJ A;  1WEW A;  4YAT A;  2E6S A;  2LGL A;  3LRQ A;  4N3W A;  3RTR B;  5TRB A;  5LKU A;  1WFK A;  4ZDT A;  2VJF A;  5KH7 A;  4BHW A;  5LKX A;  2M85 A;  3ZVY A;  2HYE D;  1IYM A;  1FBV A;  3LQI A;  4WZ3 B;  3MHH A;  4YAD A;  5G0F A;  3FL2 A;  5FER A;  1MM2 A;  5TDR A;  2M1R A;  2YQL A;  1Z6U A;  4L7X A;  5EYA F;  4LAD B;  2L80 A;  4LJN A;  2G45 A;  4V3K C;  2FSA A;  4MSX A;  4GNG A;  4N4F A;  1XWH A;  2F42 A;  2Y1N A;  2L0B A;  4GND A;  5B76 A;  3ZYQ A;  4L58 A;  4AVX A;  1ZBD B;  1JOC A;  2JMD A;  4Q6F A;  1JM7 B;  2H0D A;  1X4J A;  2MNZ A;  1WE9 A;  1Z2Q A;  4TKP B;  2LXH C;  1CHC A;  1T1H A;  3L1X A;  2NAA A;  3N9L A;  1V87 A;  2L75 A;  2YQM A;  4UI9 B;  3U5O A;  2LV9 A;  5C13 A;  2CKL A;  2BAY A;  4B7Y C;  1Z60 A;  2K16 A;  2MA6 A;  5KH3 A;  2YUR A;  2KWO A;  2EOD A;  4YAX A;  3O35 A;  5H1U A;  4YC9 A;  4WZ2 A;  2JMI A;  4S3O C;  2K1J A;  3C6W A;  3KQI A;  5I3L A;  5FB0 A;  3SOW A;  3VK6 A;  1WEO A;  3O34 A;  4BBQ A;  2MD7 B;  5B77 A;  3IHP A;  2CKL B;  4QF3 A;  1WEE A;  5KH9 A;  5JG6 A;  4AUQ B;  2K4D A;  2OXQ C;  2L43 A;  5AIT A;  2YSJ A;  1WEM A;  4XI1 A;  3ZTG A;  2KWJ A;  2KYU A;  2YSM A;  4IC3 A;  2ECN A;  2YW8 A;  4A4B A;  2ECG A;  3LQH A;  3QZV A;  5FEY A;  4YBS A;  2KR4 A;  2QJ0 A;  2MD8 C;  4CCG X;  2KWN A;  4IC2 A;  3SOX A;  1WEV A;  2LDR A;  2MUM A;  4V3L C;  3KNV A;  4PTB A;  4GNE A;  2H0D B;  3GV4 A;  1G25 A;  1BOR A;  5LCW B;  5B79 A;  3KV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...