2VJEA

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
LNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the MDM2/MDMX RING domain heterodimer reveals dimerization is required for their ubiquitylation in trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
total genus 12
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjeA00
2KGIA 2EODA 4WZ3B 1MM2A 5G04B 3RPGB 1E4UA 2LGGA 2MA6A 2VJFB 1WEMA 3DPLR 4N3WA 3ZVZB 2VJFA 2YUCA 2ECWA 4AYCA 3NG2A 2VP7A 4GNFA 4N4FA 4YAXA 3T7LA 2VPDA 2CSZA 2I50A 2K4DA 4S3OC 2F6NA 4YC9A 5LKZA 3HCTA 1HYIA 5TRBA 2G6QA 3HTKC 1VYXA 5H1UA 1X4JA 4FJCA 5TBNA 5J3XA 1WESA 5B8DA 2G43A 3QZVA 4O64A 1JM7B 3N9OA 3O34A 3SOWA 2HDPA 4QF3A 1K2FA 3FL2A 4XI1A 5FERA 2MD7B 5TDWA 2L0BA 4PPEA 2ECIA 2KGGA 2K17A 4W4UA 2C2VS 4I7BA 2LGKA 2YQMA 3HCUA 2F6JA 3ZNIA 3EB6A 4AUQB 1WGMA 5B78A 2MIQA 1FBVA 1WENA 4V3LC 2VPGA 4WA6A 4L58A 2JMDA 4WZ2A 5H1TA 4FK5A 3SOXA 1V87A 2JMJA 1WE9A 3M63A 3L1ZB 2ECJA 2F42A 4YABA 1DVPA 5FEYA 5LKXA 2ZETC 4Q6FA 3O70A 3ZPVE 2CSYA 1IYMA 4A49A 3O36A 1X4IA 4UI9B 3C5KA 2K1JA 2YSMA 3T6RA 3M99A 3O37A 2G45A 5H9MA 2KREA 2Y43A 4FIPA 2HYED 2KWKA 2OXQC 2PUYA 2VJEB 4S3OB 5I3LA 3N9PA 2L75A 4V3KC 1WEWA 1FP0A 4YATA 2D8SA 3LRQA 4R2YA 2VPBA 2CKLA 4ZDTA 1T1HA 2ECVA 1VFYA 4MVTA 2LGVA 3U5NA 1BORA 4NN2A 4B86C 4LLBA 2MA5A 5KH3A 2VPEA 1WEVA 5B79A 2M1RA 2Y1MA 3U5OA 4WZ0A 2AN6A 2EGPA 1VD4A 2FUIA 4I7DA 1WEPA 3GL6A 5LKUA 1RMDA 4L7XA 2JRJA 3MHSA 4GNGA 2LV9A 3HCSA 1Z2QA 3O7AA 2C2LA 2BAYA 5D1MB 4CCGX 1N87A 2XEUA 3ZTGA 5D1KB 2LGLA 4ZQLA 1ZBDB 2L5UA 2KR4A 2QIZA 4AVXA 5KH9A 1WEOA 2YSJA 1JOCA 2VJEA 2RSDA 1WIMA 5G0FA 5TABA 5LCWB 3IHPA 3KV6A 3KV5A 3LQHA 3N9NA 2L80A 2XB1A 3ZYQA 1WILA 3SHBA 4A4BA 2L43A 2LXHC 3ASLA 5FB0A 3KQIA 3PURA 2MT5A 4GNEA 4X3GA 2ECGA 4TKPB 4IC3A 2MD8C 5C11A 2YHOA 2H0DB 2PNXA 1Z60A 3L11A 2E6SA 4LADB 5DINA 4LKAA 2MNYA 5EYAF 2YYRA 2KE1A 2YHNA 3PHDA 2YURA 4GB0A 5D1LB 2YREA 2CT2A 3N9QA 1WEUA 4QF2A 2NAAA 3O35A 5DKAA 5KH7A 1XWHA 2YU4A 2MUMA 2H0DA 3MHHA 2YQLA 1WFKA 4YADA 1G25A 2FSAA 4YBMA 3N9LA 1HYJA 3I2DA 4C9ZA 2FUUA 4AP4A 4F52B 2KWNA 2M85A 3LQIA 4UP5A 3O33A 1JM7A 2LRIC 4P5OB 2LQ6A 3RTRB 2VNFA 1WEEA 2KWOA 4R8PK 5H1VA 2Y1NA 4IC2A 3V43A 3N9MA 2LN0A 2YW8A 1Z6UA 5B76A 4GNDA 2YT5A 5AITA 1LDKC 2UZGA 3ZPV1 2M6MA 2K16A 3M62A 4A0CD 5FB1A 3ZVYA 2EA6A 4FO9A 4A4CA 2M3HA 4YBTA 3U5MA 3C6WA 3EB5A 1F62A 2QICA 1LDJB 4MSXA 2LDRA 3L1XA 3PUQA 4YBSA 2KU3A 5AIUA 3DQVR 2RI7A 1MM3A 5LKTA 2LXPC 2MNZA 4R7EA 3SOUA 4CA1A 2JMIA 3KNVA 4UP0A 3U5PA 3RPGC 3VK6A 2DX8A 2ECTA 5JG6A 1U6GB 2KIZA 2ECNA 2IDAA 5C13A 3LQJA 4ZUXU 4I7CA 4BHWA 5G05B 5B77A 5B75A 2CKLB 4B7YC 2KWJA 2QJ0A 1X4UA 2KYUA 4BBQA 2E6RA 4PTBA 1CHCA 4LJNA 4AYCB 4LK9A 2KFTA 1WEQA 3GV4A 5TDRA
chains in the Genus database with same CATH superfamily
2KGIA 2EODA 4WZ3B 1MM2A 5G04B 2B0OE 3RPGB 1E4UA 2LGGA 2MA6A 2VJFB 1WEMA 3DPLR 2FD4A 4N3WA 3ZVZB 2VJFA 2YUCA 2ECWA 4AYCA 3NG2A 2VP7A 4GNFA 4N4FA 4YAXA 3T7LA 2VPDA 2CSZA 2I50A 2K4DA 4S3OC 2F6NA 4YC9A 5LKZA 3HCTA 1HYIA 5TRBA 2G6QA 3HTKC 1VYXA 5H1UA 1X4JA 4H9DA 3FJUB 4FJCA 5TBNA 5J3XA 1WESA 5B8DA 2G43A 3QZVA 4O64A 1JM7B 3N9OA 3O34A 3SOWA 2EGMA 2HDPA 4QF3A 1K2FA 3FL2A 3SUBA 4XI1A 5FERA 2XOZA 3LVQE 2MD7B 5TDWA 3LJUX 2L0BA 4PPEA 2ECIA 2P57A 2KGGA 2K17A 4W4UA 2C2VS 4I7BA 2LGKA 2YQMA 3HCUA 5SVYA 2F6JA 3ZNIA 3EB6A 4AUQB 1DCQA 2LAUA 1WGMA 5B78A 2MIQA 2FFWA 4OGEA 3FAOA 1FBVA 1WENA 4V3LC 2VPGA 4WA6A 4L58A 2JMDA 4Z0OA 4WZ2A 5H1TA 4FK5A 2DJAA 3SOXA 3FEHA 1V87A 3E2DA 2JMJA 1WE9A 3M63A 3L1ZB 2XP0A 2ECJA 2F42A 4YABA 1DVPA 5FEYA 5LKXA 2ZETC 4Q6FA 4OGCA 3O70A 3ZPVE 2CSYA 4Z0RA 1IYMA 4A49A 3O36A 1X4IA 2CONA 5SVIA 4UI9B 3C5KA 3H7HA 2K1JA 2YSMA 3T6RA 3M99A 3O37A 2G45A 5H9MA 2KREA 2Y43A 4FIPA 2HYED 2KWKA 2OXQC 2PUYA 2VJEB 4O62A 1MBMA 4S3OB 5I3LA 3N9PA 2L75A 4V3KC 1WEWA 1FP0A 4YATA 2D8SA 3LRQA 4R2YA 2VPBA 2CKLA 4ZDTA 1T1HA 2ECVA 1VFYA 4MVTA 2XOYA 2LGVA 3U5NA 1BORA 4NN2A 4B86C 3FANA 3O47A 4LLBA 3JUEA 2MA5A 5KH3A 2VPEA 1WEVA 5B79A 2XOCA 2M1RA 2Y1MA 3U5OA 4WZ0A 2AN6A 2EGPA 1VD4A 2FUIA 4I7DA 1WEPA 3MDBC 3GL6A 5LKUA 1RMDA 4L7XA 2JRJA 3MHSA 4GNGA 2DSMA 2LV9A 3HCSA 1Z2QA 2JM3A 5SVXA 3O7AA 2C2LA 2BAYA 5D1MB 4CCGX 1N87A 2XEUA 3ZTGA 5D1KB 2LGLA 4ZQLA 1ZBDB 2L5UA 2KR4A 2QIZA 4AVXA 5KH9A 4QQ4A 1WEOA 2YSJA 1JOCA 2VJEA 2RSDA 1WIMA 5G0FA 5TABA 2D8UA 5LCWB 3IHPA 3KV6A 3KV5A 3LQHA 3N9NA 3T9KA 2L80A 5K3QA 2XB1A 3ZYQA 1WILA 3Q1DA 3SHBA 4A4BA 2L43A 2LXHC 3ASLA 5FB0A 2E61A 3KQIA 3PURA 2MT5A 4GNEA 4X3GA 2ECGA 4TKPB 4IC3A 2MD8C 5C11A 3DDTA 2CRWA 2YHOA 2H0DB 2PNXA 1Z60A 3L11A 2E6SA 4LADB 5DINA 4F1PA 4LKAA 2MNYA 2MKEA 2IQJA 5EYAF 2YYRA 2OWAA 2KE1A 2YHNA 3PHDA 2YURA 4GB0A 5D1LB 2YREA 2CT2A 3N9QA 1WEUA 4QF2A 2NAAA 3O35A 5DKAA 5KH7A 1XWHA 2YU4A 2MUMA 2KKXA 2H0DA 3MHHA 2YQLA 1WFKA 4YADA 3M7KA 1G25A 2YVRA 2FSAA 4YBMA 3N9LA 1HYJA 3I2DA 2KKYA 4C9ZA 2FUUA 4AP4A 4F52B 2KWNA 2M85A 2CRRA 2JUNA 3LQIA 3O33A 4UP5A 1JM7A 2LRIC 4P5OB 2CSVA 3KDEC 3PLWA 2LQ6A 3RTRB 2VNFA 1WEEA 2KWOA 4R8PK 5H1VA 2Y1NA 4IC2A 2RR4A 3V43A 3N9MA 2LN0A 2YW8A 1Z6UA 5B76A 3LDYA 4GNDA 2YT5A 5AITA 1LDKC 2UZGA 3ZPV1 2M6MA 2K16A 3M62A 4A0CD 5FB1A 3ZVYA 2EA6A 4FO9A 4A4CA 2M3HA 3DWDA 3LVRE 4YBTA 3U5MA 3C6WA 3EB5A 1F62A 2QICA 1LDJB 4MSXA 2LDRA 2M13A 3L1XA 3PUQA 4YBSA 2KU3A 5AIUA 3DQVR 2L7PA 2RI7A 1MM3A 5LKTA 2LXPC 2MNZA 4R7EA 3SOUA 4CA1A 2JMIA 3KNVA 4UP0A 3U5PA 3RPGC 3VK6A 2DX8A 2ECTA 5JG6A 1U6GB 2KIZA 2ECNA 2IDAA 5C13A 3LQJA 4ZUXU 4I7CA 5SVIB 4BHWA 5G05B 5B77A 5B75A 2CKLB 4B7YC 2KWJA 2QJ0A 1X4UA 2KYUA 3FM8C 4BBQA 2E6RA 4PTBA 1CHCA 2EXUA 4LJNA 4AYCB 4LK9A 2KFTA 1WEQA 3GV4A 5TDRA
chains in the Genus database with same CATH topology
2KGIA 2EODA 4WZ3B 1MM2A 5G04B 3RPGB 1E4UA 2LGGA 2MA6A 2VJFB 1WEMA 3DPLR 4N3WA 3ZVZB 2VJFA 2YUCA 2ECWA 4AYCA 3NG2A 2VP7A 4GNFA 4N4FA 4YAXA 3T7LA 2VPDA 2CSZA 2I50A 2K4DA 4S3OC 2F6NA 4YC9A 5LKZA 3HCTA 1HYIA 5TRBA 2G6QA 3HTKC 1VYXA 5H1UA 1X4JA 4FJCA 5TBNA 5J3XA 1WESA 5B8DA 2G43A 3QZVA 4O64A 1JM7B 3N9OA 3O34A 3SOWA 2HDPA 4QF3A 1K2FA 3FL2A 4XI1A 5FERA 2MD7B 5TDWA 2L0BA 4PPEA 2ECIA 2KGGA 2K17A 4W4UA 2C2VS 4I7BA 2LGKA 2YQMA 3HCUA 2F6JA 3ZNIA 3EB6A 4AUQB 1WGMA 5B78A 2MIQA 1FBVA 1WENA 4V3LC 2VPGA 4WA6A 4L58A 2JMDA 4WZ2A 5H1TA 4FK5A 3SOXA 1V87A 2JMJA 1WE9A 3M63A 3L1ZB 2ECJA 2F42A 4YABA 1DVPA 5FEYA 5LKXA 2ZETC 4Q6FA 3O70A 3ZPVE 2CSYA 1IYMA 4A49A 3O36A 1X4IA 4UI9B 3C5KA 2K1JA 2YSMA 3T6RA 3M99A 3O37A 2G45A 5H9MA 2KREA 2Y43A 4FIPA 2HYED 2KWKA 2OXQC 2PUYA 2VJEB 4S3OB 5I3LA 3N9PA 2L75A 4V3KC 1WEWA 1FP0A 4YATA 2D8SA 3LRQA 4R2YA 2VPBA 2CKLA 4ZDTA 1T1HA 2ECVA 1VFYA 4MVTA 2LGVA 3U5NA 1BORA 4NN2A 4B86C 4LLBA 2MA5A 5KH3A 2VPEA 1WEVA 5B79A 2M1RA 2Y1MA 3U5OA 4WZ0A 2AN6A 2EGPA 1VD4A 2FUIA 4I7DA 1WEPA 3GL6A 5LKUA 1RMDA 4L7XA 2JRJA 3MHSA 4GNGA 2LV9A 3HCSA 1Z2QA 3O7AA 2C2LA 2BAYA 5D1MB 4CCGX 1N87A 2XEUA 3ZTGA 5D1KB 2LGLA 4ZQLA 1ZBDB 2L5UA 2KR4A 2QIZA 4AVXA 5KH9A 1WEOA 2YSJA 1JOCA 2VJEA 2RSDA 1WIMA 5G0FA 5TABA 5LCWB 3IHPA 3KV6A 3KV5A 3LQHA 3N9NA 2L80A 2XB1A 3ZYQA 1WILA 3SHBA 4A4BA 2L43A 2LXHC 3ASLA 5FB0A 3KQIA 3PURA 2MT5A 4GNEA 4X3GA 2ECGA 4TKPB 4IC3A 2MD8C 5C11A 2YHOA 2H0DB 2PNXA 1Z60A 3L11A 2E6SA 4LADB 5DINA 4LKAA 2MNYA 5EYAF 2YYRA 2KE1A 2YHNA 3PHDA 2YURA 4GB0A 5D1LB 2YREA 2CT2A 3N9QA 1WEUA 4QF2A 2NAAA 3O35A 5DKAA 5KH7A 1XWHA 2YU4A 2MUMA 2H0DA 3MHHA 2YQLA 1WFKA 4YADA 1G25A 2FSAA 4YBMA 3N9LA 1HYJA 3I2DA 4C9ZA 2FUUA 4AP4A 4F52B 2KWNA 2M85A 3LQIA 4UP5A 3O33A 1JM7A 2LRIC 4P5OB 2LQ6A 3RTRB 2VNFA 1WEEA 2KWOA 4R8PK 5H1VA 2Y1NA 4IC2A 3V43A 3N9MA 2LN0A 2YW8A 1Z6UA 5B76A 4GNDA 2YT5A 5AITA 1LDKC 2UZGA 3ZPV1 2M6MA 2K16A 3M62A 4A0CD 5FB1A 3ZVYA 2EA6A 4FO9A 4A4CA 2M3HA 4YBTA 3U5MA 3C6WA 3EB5A 1F62A 2QICA 1LDJB 4MSXA 2LDRA 3L1XA 3PUQA 4YBSA 2KU3A 5AIUA 3DQVR 2RI7A 1MM3A 5LKTA 2LXPC 2MNZA 4R7EA 3SOUA 4CA1A 2JMIA 3KNVA 4UP0A 3U5PA 3RPGC 3VK6A 2DX8A 2ECTA 5JG6A 1U6GB 2KIZA 2ECNA 2IDAA 5C13A 3LQJA 4ZUXU 4I7CA 4BHWA 5G05B 5B77A 5B75A 2CKLB 4B7YC 2KWJA 2QJ0A 1X4UA 2KYUA 4BBQA 2E6RA 4PTBA 1CHCA 4LJNA 4AYCB 4LK9A 2KFTA 1WEQA 3GV4A 5TDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGI A;  2EOD A;  4WZ3 B;  1MM2 A;  5G04 B;  3RPG B;  1E4U A;  2LGG A;  2MA6 A;  2VJF B;  1WEM A;  3DPL R;  4N3W A;  3ZVZ B;  2VJF A;  2YUC A;  2ECW A;  4AYC A;  3NG2 A;  2VP7 A;  4GNF A;  4N4F A;  4YAX A;  3T7L A;  2VPD A;  2CSZ A;  2I50 A;  2K4D A;  4S3O C;  2F6N A;  4YC9 A;  5LKZ A;  3HCT A;  1HYI A;  5TRB A;  2G6Q A;  3HTK C;  1VYX A;  5H1U A;  1X4J A;  4FJC A;  5TBN A;  5J3X A;  1WES A;  5B8D A;  2G43 A;  3QZV A;  4O64 A;  1JM7 B;  3N9O A;  3O34 A;  3SOW A;  2HDP A;  4QF3 A;  1K2F A;  3FL2 A;  4XI1 A;  5FER A;  2MD7 B;  5TDW A;  2L0B A;  4PPE A;  2ECI A;  2KGG A;  2K17 A;  4W4U A;  2C2V S;  4I7B A;  2LGK A;  2YQM A;  3HCU A;  2F6J A;  3ZNI A;  3EB6 A;  4AUQ B;  1WGM A;  5B78 A;  2MIQ A;  1FBV A;  1WEN A;  4V3L C;  2VPG A;  4WA6 A;  4L58 A;  2JMD A;  4WZ2 A;  5H1T A;  4FK5 A;  3SOX A;  1V87 A;  2JMJ A;  1WE9 A;  3M63 A;  3L1Z B;  2ECJ A;  2F42 A;  4YAB A;  1DVP A;  5FEY A;  5LKX A;  2ZET C;  4Q6F A;  3O70 A;  3ZPV E;  2CSY A;  1IYM A;  4A49 A;  3O36 A;  1X4I A;  4UI9 B;  3C5K A;  2K1J A;  2YSM A;  3T6R A;  3M99 A;  3O37 A;  2G45 A;  5H9M A;  2KRE A;  2Y43 A;  4FIP A;  2HYE D;  2KWK A;  2OXQ C;  2PUY A;  2VJE B;  4S3O B;  5I3L A;  3N9P A;  2L75 A;  4V3K C;  1WEW A;  1FP0 A;  4YAT A;  2D8S A;  3LRQ A;  4R2Y A;  2VPB A;  2CKL A;  4ZDT A;  1T1H A;  2ECV A;  1VFY A;  4MVT A;  2LGV A;  3U5N A;  1BOR A;  4NN2 A;  4B86 C;  4LLB A;  2MA5 A;  5KH3 A;  2VPE A;  1WEV A;  5B79 A;  2M1R A;  2Y1M A;  3U5O A;  4WZ0 A;  2AN6 A;  2EGP A;  1VD4 A;  2FUI A;  4I7D A;  1WEP A;  3GL6 A;  5LKU A;  1RMD A;  4L7X A;  2JRJ A;  3MHS A;  4GNG A;  2LV9 A;  3HCS A;  1Z2Q A;  3O7A A;  2C2L A;  2BAY A;  5D1M B;  4CCG X;  1N87 A;  2XEU A;  3ZTG A;  5D1K B;  2LGL A;  4ZQL A;  1ZBD B;  2L5U A;  2KR4 A;  2QIZ A;  4AVX A;  5KH9 A;  1WEO A;  2YSJ A;  1JOC A;  2VJE A;  2RSD A;  1WIM A;  5G0F A;  5TAB A;  5LCW B;  3IHP A;  3KV6 A;  3KV5 A;  3LQH A;  3N9N A;  2L80 A;  2XB1 A;  3ZYQ A;  1WIL A;  3SHB A;  4A4B A;  2L43 A;  2LXH C;  3ASL A;  5FB0 A;  3KQI A;  3PUR A;  2MT5 A;  4GNE A;  4X3G A;  2ECG A;  4TKP B;  4IC3 A;  2MD8 C;  5C11 A;  2YHO A;  2H0D B;  2PNX A;  1Z60 A;  3L11 A;  2E6S A;  4LAD B;  5DIN A;  4LKA A;  2MNY A;  5EYA F;  2YYR A;  2KE1 A;  2YHN A;  3PHD A;  2YUR A;  4GB0 A;  5D1L B;  2YRE A;  2CT2 A;  3N9Q A;  1WEU A;  4QF2 A;  2NAA A;  3O35 A;  5DKA A;  5KH7 A;  1XWH A;  2YU4 A;  2MUM A;  2H0D A;  3MHH A;  2YQL A;  1WFK A;  4YAD A;  1G25 A;  2FSA A;  4YBM A;  3N9L A;  1HYJ A;  3I2D A;  4C9Z A;  2FUU A;  4AP4 A;  4F52 B;  2KWN A;  2M85 A;  3LQI A;  4UP5 A;  3O33 A;  1JM7 A;  2LRI C;  4P5O B;  2LQ6 A;  3RTR B;  2VNF A;  1WEE A;  2KWO A;  4R8P K;  5H1V A;  2Y1N A;  4IC2 A;  3V43 A;  3N9M A;  2LN0 A;  2YW8 A;  1Z6U A;  5B76 A;  4GND A;  2YT5 A;  5AIT A;  1LDK C;  2UZG A;  3ZPV 1;  2M6M A;  2K16 A;  3M62 A;  4A0C D;  5FB1 A;  3ZVY A;  2EA6 A;  4FO9 A;  4A4C A;  2M3H A;  4YBT A;  3U5M A;  3C6W A;  3EB5 A;  1F62 A;  2QIC A;  1LDJ B;  4MSX A;  2LDR A;  3L1X A;  3PUQ A;  4YBS A;  2KU3 A;  5AIU A;  3DQV R;  2RI7 A;  1MM3 A;  5LKT A;  2LXP C;  2MNZ A;  4R7E A;  3SOU A;  4CA1 A;  2JMI A;  3KNV A;  4UP0 A;  3U5P A;  3RPG C;  3VK6 A;  2DX8 A;  2ECT A;  5JG6 A;  1U6G B;  2KIZ A;  2ECN A;  2IDA A;  5C13 A;  3LQJ A;  4ZUX U;  4I7C A;  4BHW A;  5G05 B;  5B77 A;  5B75 A;  2CKL B;  4B7Y C;  2KWJ A;  2QJ0 A;  1X4U A;  2KYU A;  4BBQ A;  2E6R A;  4PTB A;  1CHC A;  4LJN A;  4AYC B;  4LK9 A;  2KFT A;  1WEQ A;  3GV4 A;  5TDR A; 
#chains in the Genus database with same CATH topology
 2KGI A;  2EOD A;  4WZ3 B;  1MM2 A;  5G04 B;  2B0O E;  3RPG B;  1E4U A;  2LGG A;  2MA6 A;  2VJF B;  1WEM A;  3DPL R;  2FD4 A;  4N3W A;  3ZVZ B;  2VJF A;  2YUC A;  2ECW A;  4AYC A;  3NG2 A;  2VP7 A;  4GNF A;  4N4F A;  4YAX A;  3T7L A;  2VPD A;  2CSZ A;  2I50 A;  2K4D A;  4S3O C;  2F6N A;  4YC9 A;  5LKZ A;  3HCT A;  1HYI A;  5TRB A;  2G6Q A;  3HTK C;  1VYX A;  5H1U A;  1X4J A;  4H9D A;  3FJU B;  4FJC A;  5TBN A;  5J3X A;  1WES A;  5B8D A;  2G43 A;  3QZV A;  4O64 A;  1JM7 B;  3N9O A;  3O34 A;  3SOW A;  2EGM A;  2HDP A;  4QF3 A;  1K2F A;  3FL2 A;  3SUB A;  4XI1 A;  5FER A;  2XOZ A;  3LVQ E;  2MD7 B;  5TDW A;  3LJU X;  2L0B A;  4PPE A;  2ECI A;  2P57 A;  2KGG A;  2K17 A;  4W4U A;  2C2V S;  4I7B A;  2LGK A;  2YQM A;  3HCU A;  5SVY A;  2F6J A;  3ZNI A;  3EB6 A;  4AUQ B;  1DCQ A;  2LAU A;  1WGM A;  5B78 A;  2MIQ A;  2FFW A;  4OGE A;  3FAO A;  1FBV A;  1WEN A;  4V3L C;  2VPG A;  4WA6 A;  4L58 A;  2JMD A;  4Z0O A;  4WZ2 A;  5H1T A;  4FK5 A;  2DJA A;  3SOX A;  3FEH A;  1V87 A;  3E2D A;  2JMJ A;  1WE9 A;  3M63 A;  3L1Z B;  2XP0 A;  2ECJ A;  2F42 A;  4YAB A;  1DVP A;  5FEY A;  5LKX A;  2ZET C;  4Q6F A;  4OGC A;  3O70 A;  3ZPV E;  2CSY A;  4Z0R A;  1IYM A;  4A49 A;  3O36 A;  1X4I A;  2CON A;  5SVI A;  4UI9 B;  3C5K A;  3H7H A;  2K1J A;  2YSM A;  3T6R A;  3M99 A;  3O37 A;  2G45 A;  5H9M A;  2KRE A;  2Y43 A;  4FIP A;  2HYE D;  2KWK A;  2OXQ C;  2PUY A;  2VJE B;  4O62 A;  1MBM A;  4S3O B;  5I3L A;  3N9P A;  2L75 A;  4V3K C;  1WEW A;  1FP0 A;  4YAT A;  2D8S A;  3LRQ A;  4R2Y A;  2VPB A;  2CKL A;  4ZDT A;  1T1H A;  2ECV A;  1VFY A;  4MVT A;  2XOY A;  2LGV A;  3U5N A;  1BOR A;  4NN2 A;  4B86 C;  3FAN A;  3O47 A;  4LLB A;  3JUE A;  2MA5 A;  5KH3 A;  2VPE A;  1WEV A;  5B79 A;  2XOC A;  2M1R A;  2Y1M A;  3U5O A;  4WZ0 A;  2AN6 A;  2EGP A;  1VD4 A;  2FUI A;  4I7D A;  1WEP A;  3MDB C;  3GL6 A;  5LKU A;  1RMD A;  4L7X A;  2JRJ A;  3MHS A;  4GNG A;  2DSM A;  2LV9 A;  3HCS A;  1Z2Q A;  2JM3 A;  5SVX A;  3O7A A;  2C2L A;  2BAY A;  5D1M B;  4CCG X;  1N87 A;  2XEU A;  3ZTG A;  5D1K B;  2LGL A;  4ZQL A;  1ZBD B;  2L5U A;  2KR4 A;  2QIZ A;  4AVX A;  5KH9 A;  4QQ4 A;  1WEO A;  2YSJ A;  1JOC A;  2VJE A;  2RSD A;  1WIM A;  5G0F A;  5TAB A;  2D8U A;  5LCW B;  3IHP A;  3KV6 A;  3KV5 A;  3LQH A;  3N9N A;  3T9K A;  2L80 A;  5K3Q A;  2XB1 A;  3ZYQ A;  1WIL A;  3Q1D A;  3SHB A;  4A4B A;  2L43 A;  2LXH C;  3ASL A;  5FB0 A;  2E61 A;  3KQI A;  3PUR A;  2MT5 A;  4GNE A;  4X3G A;  2ECG A;  4TKP B;  4IC3 A;  2MD8 C;  5C11 A;  3DDT A;  2CRW A;  2YHO A;  2H0D B;  2PNX A;  1Z60 A;  3L11 A;  2E6S A;  4LAD B;  5DIN A;  4F1P A;  4LKA A;  2MNY A;  2MKE A;  2IQJ A;  5EYA F;  2YYR A;  2OWA A;  2KE1 A;  2YHN A;  3PHD A;  2YUR A;  4GB0 A;  5D1L B;  2YRE A;  2CT2 A;  3N9Q A;  1WEU A;  4QF2 A;  2NAA A;  3O35 A;  5DKA A;  5KH7 A;  1XWH A;  2YU4 A;  2MUM A;  2KKX A;  2H0D A;  3MHH A;  2YQL A;  1WFK A;  4YAD A;  3M7K A;  1G25 A;  2YVR A;  2FSA A;  4YBM A;  3N9L A;  1HYJ A;  3I2D A;  2KKY A;  4C9Z A;  2FUU A;  4AP4 A;  4F52 B;  2KWN A;  2M85 A;  2CRR A;  2JUN A;  3LQI A;  3O33 A;  4UP5 A;  1JM7 A;  2LRI C;  4P5O B;  2CSV A;  3KDE C;  3PLW A;  2LQ6 A;  3RTR B;  2VNF A;  1WEE A;  2KWO A;  4R8P K;  5H1V A;  2Y1N A;  4IC2 A;  2RR4 A;  3V43 A;  3N9M A;  2LN0 A;  2YW8 A;  1Z6U A;  5B76 A;  3LDY A;  4GND A;  2YT5 A;  5AIT A;  1LDK C;  2UZG A;  3ZPV 1;  2M6M A;  2K16 A;  3M62 A;  4A0C D;  5FB1 A;  3ZVY A;  2EA6 A;  4FO9 A;  4A4C A;  2M3H A;  3DWD A;  3LVR E;  4YBT A;  3U5M A;  3C6W A;  3EB5 A;  1F62 A;  2QIC A;  1LDJ B;  4MSX A;  2LDR A;  2M13 A;  3L1X A;  3PUQ A;  4YBS A;  2KU3 A;  5AIU A;  3DQV R;  2L7P A;  2RI7 A;  1MM3 A;  5LKT A;  2LXP C;  2MNZ A;  4R7E A;  3SOU A;  4CA1 A;  2JMI A;  3KNV A;  4UP0 A;  3U5P A;  3RPG C;  3VK6 A;  2DX8 A;  2ECT A;  5JG6 A;  1U6G B;  2KIZ A;  2ECN A;  2IDA A;  5C13 A;  3LQJ A;  4ZUX U;  4I7C A;  5SVI B;  4BHW A;  5G05 B;  5B77 A;  5B75 A;  2CKL B;  4B7Y C;  2KWJ A;  2QJ0 A;  1X4U A;  2KYU A;  3FM8 C;  4BBQ A;  2E6R A;  4PTB A;  1CHC A;  2EXU A;  4LJN A;  4AYC B;  4LK9 A;  2KFT A;  1WEQ A;  3GV4 A;  5TDR A; 
#chains in the Genus database with same CATH homology
 2KGI A;  2EOD A;  4WZ3 B;  1MM2 A;  5G04 B;  3RPG B;  1E4U A;  2LGG A;  2MA6 A;  2VJF B;  1WEM A;  3DPL R;  4N3W A;  3ZVZ B;  2VJF A;  2YUC A;  2ECW A;  4AYC A;  3NG2 A;  2VP7 A;  4GNF A;  4N4F A;  4YAX A;  3T7L A;  2VPD A;  2CSZ A;  2I50 A;  2K4D A;  4S3O C;  2F6N A;  4YC9 A;  5LKZ A;  3HCT A;  1HYI A;  5TRB A;  2G6Q A;  3HTK C;  1VYX A;  5H1U A;  1X4J A;  4FJC A;  5TBN A;  5J3X A;  1WES A;  5B8D A;  2G43 A;  3QZV A;  4O64 A;  1JM7 B;  3N9O A;  3O34 A;  3SOW A;  2HDP A;  4QF3 A;  1K2F A;  3FL2 A;  4XI1 A;  5FER A;  2MD7 B;  5TDW A;  2L0B A;  4PPE A;  2ECI A;  2KGG A;  2K17 A;  4W4U A;  2C2V S;  4I7B A;  2LGK A;  2YQM A;  3HCU A;  2F6J A;  3ZNI A;  3EB6 A;  4AUQ B;  1WGM A;  5B78 A;  2MIQ A;  1FBV A;  1WEN A;  4V3L C;  2VPG A;  4WA6 A;  4L58 A;  2JMD A;  4WZ2 A;  5H1T A;  4FK5 A;  3SOX A;  1V87 A;  2JMJ A;  1WE9 A;  3M63 A;  3L1Z B;  2ECJ A;  2F42 A;  4YAB A;  1DVP A;  5FEY A;  5LKX A;  2ZET C;  4Q6F A;  3O70 A;  3ZPV E;  2CSY A;  1IYM A;  4A49 A;  3O36 A;  1X4I A;  4UI9 B;  3C5K A;  2K1J A;  2YSM A;  3T6R A;  3M99 A;  3O37 A;  2G45 A;  5H9M A;  2KRE A;  2Y43 A;  4FIP A;  2HYE D;  2KWK A;  2OXQ C;  2PUY A;  2VJE B;  4S3O B;  5I3L A;  3N9P A;  2L75 A;  4V3K C;  1WEW A;  1FP0 A;  4YAT A;  2D8S A;  3LRQ A;  4R2Y A;  2VPB A;  2CKL A;  4ZDT A;  1T1H A;  2ECV A;  1VFY A;  4MVT A;  2LGV A;  3U5N A;  1BOR A;  4NN2 A;  4B86 C;  4LLB A;  2MA5 A;  5KH3 A;  2VPE A;  1WEV A;  5B79 A;  2M1R A;  2Y1M A;  3U5O A;  4WZ0 A;  2AN6 A;  2EGP A;  1VD4 A;  2FUI A;  4I7D A;  1WEP A;  3GL6 A;  5LKU A;  1RMD A;  4L7X A;  2JRJ A;  3MHS A;  4GNG A;  2LV9 A;  3HCS A;  1Z2Q A;  3O7A A;  2C2L A;  2BAY A;  5D1M B;  4CCG X;  1N87 A;  2XEU A;  3ZTG A;  5D1K B;  2LGL A;  4ZQL A;  1ZBD B;  2L5U A;  2KR4 A;  2QIZ A;  4AVX A;  5KH9 A;  1WEO A;  2YSJ A;  1JOC A;  2VJE A;  2RSD A;  1WIM A;  5G0F A;  5TAB A;  5LCW B;  3IHP A;  3KV6 A;  3KV5 A;  3LQH A;  3N9N A;  2L80 A;  2XB1 A;  3ZYQ A;  1WIL A;  3SHB A;  4A4B A;  2L43 A;  2LXH C;  3ASL A;  5FB0 A;  3KQI A;  3PUR A;  2MT5 A;  4GNE A;  4X3G A;  2ECG A;  4TKP B;  4IC3 A;  2MD8 C;  5C11 A;  2YHO A;  2H0D B;  2PNX A;  1Z60 A;  3L11 A;  2E6S A;  4LAD B;  5DIN A;  4LKA A;  2MNY A;  5EYA F;  2YYR A;  2KE1 A;  2YHN A;  3PHD A;  2YUR A;  4GB0 A;  5D1L B;  2YRE A;  2CT2 A;  3N9Q A;  1WEU A;  4QF2 A;  2NAA A;  3O35 A;  5DKA A;  5KH7 A;  1XWH A;  2YU4 A;  2MUM A;  2H0D A;  3MHH A;  2YQL A;  1WFK A;  4YAD A;  1G25 A;  2FSA A;  4YBM A;  3N9L A;  1HYJ A;  3I2D A;  4C9Z A;  2FUU A;  4AP4 A;  4F52 B;  2KWN A;  2M85 A;  3LQI A;  4UP5 A;  3O33 A;  1JM7 A;  2LRI C;  4P5O B;  2LQ6 A;  3RTR B;  2VNF A;  1WEE A;  2KWO A;  4R8P K;  5H1V A;  2Y1N A;  4IC2 A;  3V43 A;  3N9M A;  2LN0 A;  2YW8 A;  1Z6U A;  5B76 A;  4GND A;  2YT5 A;  5AIT A;  1LDK C;  2UZG A;  3ZPV 1;  2M6M A;  2K16 A;  3M62 A;  4A0C D;  5FB1 A;  3ZVY A;  2EA6 A;  4FO9 A;  4A4C A;  2M3H A;  4YBT A;  3U5M A;  3C6W A;  3EB5 A;  1F62 A;  2QIC A;  1LDJ B;  4MSX A;  2LDR A;  3L1X A;  3PUQ A;  4YBS A;  2KU3 A;  5AIU A;  3DQV R;  2RI7 A;  1MM3 A;  5LKT A;  2LXP C;  2MNZ A;  4R7E A;  3SOU A;  4CA1 A;  2JMI A;  3KNV A;  4UP0 A;  3U5P A;  3RPG C;  3VK6 A;  2DX8 A;  2ECT A;  5JG6 A;  1U6G B;  2KIZ A;  2ECN A;  2IDA A;  5C13 A;  3LQJ A;  4ZUX U;  4I7C A;  4BHW A;  5G05 B;  5B77 A;  5B75 A;  2CKL B;  4B7Y C;  2KWJ A;  2QJ0 A;  1X4U A;  2KYU A;  4BBQ A;  2E6R A;  4PTB A;  1CHC A;  4LJN A;  4AYC B;  4LK9 A;  2KFT A;  1WEQ A;  3GV4 A;  5TDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...