2VJEA

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
b'LNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
publication title Structure of the MDM2/MDMX RING domain heterodimer reveals dimerization is required for their ubiquitylation in trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 12
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjeA00
3SHBA 5B76A 2ECVA 4AYCA 4UP0A 1Z2QA 2ECJA 4A4CA 4YC9A 2ECWA 3HCUA 2ZETC 3ZPVE 2PNXA 5C13A 3I2DA 2VJEB 2CKLB 4YBTA 1MM2A 4S3OB 3IHPA 3O37A 2LV9A 1JM7A 3KV5A 4PTBA 4R8PK 1F62A 5B77A 2YREA 4N4FA 5KH7A 1BORA 2VPGA 4S3OC 3M63A 2H0DA 1G25A 3RTRB 5TBNA 1WEQA 2YU4A 2LXHC 2XB1A 2NAAA 3N9NA 1X4JA 3V43A 2M85A 3N9MA 2VJFB 1T1HA 4PPEA 1WE9A 3PURA 2MA6A 2F42A 1FBVA 4L7XA 1WEPA 3U5NA 2M1RA 5H1UA 1E4UA 4P5OB 4V3LC 4IC2A 2D8SA 4B7YC 5B78A 5I3LA 4BBQA 5B75A 1LDJB 2YSJA 4GNEA 1ZBDB 4A4BA 3C5KA 2ECTA 3LRQA 2I50A 3VK6A 3M62A 2YSMA 4GNDA 3ZPV1 4FIPA 4UP5A 3QZVA 4I7CA 1DVPA 3N9PA 3O36A 3T7LA 4L58A 2MA5A 1FP0A 3DQVR 4YBSA 2K16A 1VD4A 5D1KB 4WZ0A 4V3KC 2G6QA 1X4UA 3GL6A 4ZDTA 3SOXA 2JMDA 4NN2A 2UZGA 5LKTA 1WEOA 5TABA 2LGLA 2QICA 4ZUXU 2HDPA 4IC3A 2LGVA 3U5PA 2QJ0A 3LQHA 4YAXA 2MNZA 3U5MA 4MVTA 2MIQA 3DPLR 3ZTGA 4F52B 4UI9B 5FERA 3U5OA 2K4DA 2M6MA 2FSAA 4R2YA 2VPBA 5D1MB 2LRIC 4GNGA 3O35A 5G05B 4AUQB 2KR4A 3N9QA 5JG6A 5LKUA 1WEWA 2KGGA 5KH3A 2KWOA 4FJCA 3ASLA 5LCWB 3FL2A 2L0BA 4AYCB 5LKXA 2PUYA 2MNYA 4I7BA 3L11A 4YATA 2YYRA 1VFYA 5TRBA 4C9ZA 2KWNA 5H9MA 4A0CD 2KWJA 3O70A 4W4UA 2VP7A 3RPGB 1JM7B 5C11A 3L1ZB 3PHDA 4WZ3B 1Z60A 2H0DB 2YQLA 3HCSA 3RPGC 4YABA 2LGGA 2JRJA 2L43A 2BAYA 3EB5A 2C2VS 1WEMA 3MHSA 4GB0A 4CA1A 2EODA 4FO9A 1X4IA 2KWKA 2KGIA 1MM3A 1WENA 5TDWA 3L1XA 2IDAA 3SOUA 4N3WA 3SOWA 5EYAF 1VYXA 3KNVA 3HTKC 2Y1MA 5J3XA 4YADA 2FUIA 4GNFA 1WILA 2KIZA 3ZNIA 5B79A 4LADB 2VJEA 4TKPB 2CKLA 2E6RA 4O64A 1Z6UA 2YUCA 1U6GB 3KV6A 3NG2A 3EB6A 1CHCA 2L5UA 3GV4A 3N9LA 2ECNA 2L80A 3O33A 2KYUA 3T6RA 3ZYQA 4B86C 4WA6A 2HYED 2Y43A 5DKAA 5D1LB 5H1VA 2LGKA 2XEUA 1K2FA 1N87A 2C2LA 2AN6A 4X3GA 2LXPC 2KREA 2KE1A 2VNFA 2VJFA 1RMDA 1WFKA 2CT2A 2CSZA 2RI7A 3O34A 1WEUA 2LQ6A 3HCTA 2K1JA 1IYMA 3LQJA 4LLBA 4BHWA 4LJNA 4QF3A 3LQIA 1WEVA 1WEEA 2L75A 3N9OA 3O7AA 5FB0A 5FEYA 4YBMA 2F6NA 2K17A 1WGMA 4QF2A 2G43A 2E6SA 2VPDA 2YHOA 5TDRA 5H1TA 1LDKC 2YW8A 2YQMA 4MSXA 2YHNA 4ZQLA 3PUQA 4I7DA 5G0FA 2KU3A 3MHHA 2EGPA 5DINA 3ZVZB 1WESA 5KH9A 2G45A 4AP4A 3M99A 3KQIA 2VPEA 1WIMA 2OXQC 2KFTA 2MUMA 3ZVYA 4R7EA 4Q6FA 2QIZA 2RSDA 4XI1A 2LN0A 4WZ2A 2DX8A 2CSYA 1JOCA 2ECGA 4AVXA 5FB1A 5AIUA 2M3HA 1XWHA 4FK5A 2EA6A 2JMIA 2MD7B 2MD8C 4CCGX 2YURA 2MT5A 2JMJA 5B8DA 3C6WA 4LK9A 2ECIA 4LKAA 2F6JA 2FUUA 5LKZA 2LDRA 5G04B 1HYIA 1HYJA 2Y1NA 4A49A 2YT5A 5AITA 1V87A
chains in the Genus database with same CATH superfamily
4Z0RA 3SHBA 5B76A 2ECVA 4AYCA 2XOZA 4UP0A 1Z2QA 3LVQE 2ECJA 2KKYA 4A4CA 4YC9A 2ECWA 3HCUA 2ZETC 3ZPVE 3KDEC 3LDYA 2PNXA 5C13A 3I2DA 2VJEB 2CKLB 4YBTA 1MM2A 4S3OB 3IHPA 3O37A 2LV9A 1JM7A 3KV5A 4PTBA 4R8PK 1F62A 5B77A 2YREA 4N4FA 5KH7A 1BORA 2VPGA 4S3OC 2CRWA 3M63A 2H0DA 1G25A 3RTRB 5TBNA 1WEQA 4OGEA 2YU4A 2LXHC 2XB1A 2NAAA 3N9NA 1X4JA 3V43A 2E61A 2M85A 3N9MA 2VJFB 1T1HA 4PPEA 1WE9A 3PURA 2MA6A 2EXUA 2L7PA 2CSVA 2F42A 1FBVA 4L7XA 4OGCA 1WEPA 3U5NA 2M1RA 5H1UA 1DCQA 1E4UA 4P5OB 4V3LC 2OWAA 2IQJA 4IC2A 2D8SA 2LAUA 4B7YC 5B78A 5I3LA 4BBQA 5B75A 1LDJB 2YSJA 5SVXA 3FEHA 4GNEA 3SUBA 1ZBDB 3DDTA 3LJUX 4A4BA 4Z0OA 3C5KA 2ECTA 4F1PA 2FD4A 3LRQA 2I50A 3VK6A 3M62A 2YSMA 4GNDA 5SVYA 3ZPV1 4FIPA 4UP5A 3QZVA 4I7CA 1DVPA 3N9PA 3O36A 3T7LA 4L58A 2MA5A 1FP0A 3DQVR 4YBSA 2K16A 1VD4A 5D1KB 4WZ0A 4V3KC 2G6QA 1X4UA 3GL6A 4ZDTA 3SOXA 2XOYA 2JMDA 4NN2A 2UZGA 5K3QA 5LKTA 1WEOA 5TABA 2LGLA 2QICA 4ZUXU 2HDPA 4IC3A 2LGVA 3U5PA 2QJ0A 3LQHA 4YAXA 2MNZA 3U5MA 4MVTA 2MIQA 3DPLR 3ZTGA 4F52B 4UI9B 5FERA 3U5OA 2K4DA 2XOCA 2M6MA 2FSAA 4R2YA 2VPBA 5D1MB 2LRIC 4GNGA 2JM3A 3O35A 5G05B 2YVRA 4AUQB 2KR4A 3N9QA 5JG6A 5LKUA 1WEWA 3E2DA 2KGGA 5KH3A 2KWOA 4FJCA 3ASLA 5LCWB 3FL2A 2L0BA 5SVIA 4AYCB 4H9DA 3LVRE 2DSMA 5LKXA 2PUYA 2MNYA 4I7BA 3L11A 4YATA 2YYRA 1VFYA 5TRBA 4C9ZA 2KWNA 5H9MA 4A0CD 2RR4A 2KWJA 4O62A 3O70A 4W4UA 2VP7A 3RPGB 1JM7B 5C11A 3L1ZB 3PHDA 4WZ3B 1Z60A 2H0DB 2YQLA 3HCSA 3RPGC 4YABA 2DJAA 2LGGA 2JRJA 2L43A 2BAYA 3EB5A 2C2VS 1WEMA 3MHSA 3DWDA 4GB0A 4CA1A 2EODA 4FO9A 1X4IA 5SVIB 2KWKA 2KGIA 1MM3A 1WENA 5TDWA 3L1XA 2IDAA 3SOUA 4N3WA 3SOWA 2M13A 5EYAF 1VYXA 2D8UA 3KNVA 3PLWA 3HTKC 2Y1MA 5J3XA 4YADA 2FUIA 4GNFA 1WILA 1MBMA 2KIZA 3ZNIA 5B79A 2EGMA 4LADB 3FAOA 2CONA 2VJEA 4TKPB 2CKLA 2E6RA 4O64A 1Z6UA 2YUCA 1U6GB 3KV6A 3NG2A 3O47A 3EB6A 1CHCA 2L5UA 3GV4A 3N9LA 2ECNA 2L80A 3O33A 2KYUA 3T6RA 3ZYQA 4B86C 4WA6A 2HYED 2Y43A 5DKAA 5D1LB 5H1VA 2LGKA 2XEUA 1K2FA 1N87A 2C2LA 2AN6A 4X3GA 2LXPC 2KREA 3FJUB 2KE1A 2VNFA 2VJFA 1RMDA 1WFKA 2CT2A 2CSZA 2RI7A 3O34A 1WEUA 2LQ6A 3HCTA 2K1JA 1IYMA 2P57A 3LQJA 4QQ4A 4LLBA 4BHWA 4LJNA 4QF3A 2XP0A 3LQIA 1WEVA 1WEEA 2L75A 3N9OA 3O7AA 5FB0A 5FEYA 2B0OE 2MKEA 4YBMA 2F6NA 2K17A 1WGMA 4QF2A 2G43A 2E6SA 2VPDA 2YHOA 5TDRA 5H1TA 1LDKC 3H7HA 2YW8A 2JUNA 2YQMA 3T9KA 4MSXA 3Q1DA 2KKXA 2YHNA 4ZQLA 3JUEA 3PUQA 4I7DA 5G0FA 2KU3A 3MHHA 2EGPA 5DINA 3ZVZB 1WESA 5KH9A 2G45A 2CRRA 4AP4A 3FANA 3M99A 3KQIA 2VPEA 1WIMA 2OXQC 2KFTA 2MUMA 3ZVYA 4R7EA 4Q6FA 2QIZA 2RSDA 4XI1A 2LN0A 4WZ2A 2DX8A 2CSYA 1JOCA 2ECGA 4AVXA 3M7KA 5FB1A 5AIUA 2M3HA 1XWHA 2FFWA 4FK5A 2EA6A 2JMIA 2MD7B 2MD8C 3MDBC 4CCGX 2YURA 2MT5A 2JMJA 5B8DA 3C6WA 4LK9A 2ECIA 4LKAA 2F6JA 2FUUA 5LKZA 2LDRA 5G04B 3FM8C 1HYIA 1HYJA 2Y1NA 4A49A 2YT5A 5AITA 1V87A
chains in the Genus database with same CATH topology
3SHBA 5B76A 2ECVA 4AYCA 4UP0A 1Z2QA 2ECJA 4A4CA 4YC9A 2ECWA 3HCUA 2ZETC 3ZPVE 2PNXA 5C13A 3I2DA 2VJEB 2CKLB 4YBTA 1MM2A 4S3OB 3IHPA 3O37A 2LV9A 1JM7A 3KV5A 4PTBA 4R8PK 1F62A 5B77A 2YREA 4N4FA 5KH7A 1BORA 2VPGA 4S3OC 3M63A 2H0DA 1G25A 3RTRB 5TBNA 1WEQA 2YU4A 2LXHC 2XB1A 2NAAA 3N9NA 1X4JA 3V43A 2M85A 3N9MA 2VJFB 1T1HA 4PPEA 1WE9A 3PURA 2MA6A 2F42A 1FBVA 4L7XA 1WEPA 3U5NA 2M1RA 5H1UA 1E4UA 4P5OB 4V3LC 4IC2A 2D8SA 4B7YC 5B78A 5I3LA 4BBQA 5B75A 1LDJB 2YSJA 4GNEA 1ZBDB 4A4BA 3C5KA 2ECTA 3LRQA 2I50A 3VK6A 3M62A 2YSMA 4GNDA 3ZPV1 4FIPA 4UP5A 3QZVA 4I7CA 1DVPA 3N9PA 3O36A 3T7LA 4L58A 2MA5A 1FP0A 3DQVR 4YBSA 2K16A 1VD4A 5D1KB 4WZ0A 4V3KC 2G6QA 1X4UA 3GL6A 4ZDTA 3SOXA 2JMDA 4NN2A 2UZGA 5LKTA 1WEOA 5TABA 2LGLA 2QICA 4ZUXU 2HDPA 4IC3A 2LGVA 3U5PA 2QJ0A 3LQHA 4YAXA 2MNZA 3U5MA 4MVTA 2MIQA 3DPLR 3ZTGA 4F52B 4UI9B 5FERA 3U5OA 2K4DA 2M6MA 2FSAA 4R2YA 2VPBA 5D1MB 2LRIC 4GNGA 3O35A 5G05B 4AUQB 2KR4A 3N9QA 5JG6A 5LKUA 1WEWA 2KGGA 5KH3A 2KWOA 4FJCA 3ASLA 5LCWB 3FL2A 2L0BA 4AYCB 5LKXA 2PUYA 2MNYA 4I7BA 3L11A 4YATA 2YYRA 1VFYA 5TRBA 4C9ZA 2KWNA 5H9MA 4A0CD 2KWJA 3O70A 4W4UA 2VP7A 3RPGB 1JM7B 5C11A 3L1ZB 3PHDA 4WZ3B 1Z60A 2H0DB 2YQLA 3HCSA 3RPGC 4YABA 2LGGA 2JRJA 2L43A 2BAYA 3EB5A 2C2VS 1WEMA 3MHSA 4GB0A 4CA1A 2EODA 4FO9A 1X4IA 2KWKA 2KGIA 1MM3A 1WENA 5TDWA 3L1XA 2IDAA 3SOUA 4N3WA 3SOWA 5EYAF 1VYXA 3KNVA 3HTKC 2Y1MA 5J3XA 4YADA 2FUIA 4GNFA 1WILA 2KIZA 3ZNIA 5B79A 4LADB 2VJEA 4TKPB 2CKLA 2E6RA 4O64A 1Z6UA 2YUCA 1U6GB 3KV6A 3NG2A 3EB6A 1CHCA 2L5UA 3GV4A 3N9LA 2ECNA 2L80A 3O33A 2KYUA 3T6RA 3ZYQA 4B86C 4WA6A 2HYED 2Y43A 5DKAA 5D1LB 5H1VA 2LGKA 2XEUA 1K2FA 1N87A 2C2LA 2AN6A 4X3GA 2LXPC 2KREA 2KE1A 2VNFA 2VJFA 1RMDA 1WFKA 2CT2A 2CSZA 2RI7A 3O34A 1WEUA 2LQ6A 3HCTA 2K1JA 1IYMA 3LQJA 4LLBA 4BHWA 4LJNA 4QF3A 3LQIA 1WEVA 1WEEA 2L75A 3N9OA 3O7AA 5FB0A 5FEYA 4YBMA 2F6NA 2K17A 1WGMA 4QF2A 2G43A 2E6SA 2VPDA 2YHOA 5TDRA 5H1TA 1LDKC 2YW8A 2YQMA 4MSXA 2YHNA 4ZQLA 3PUQA 4I7DA 5G0FA 2KU3A 3MHHA 2EGPA 5DINA 3ZVZB 1WESA 5KH9A 2G45A 4AP4A 3M99A 3KQIA 2VPEA 1WIMA 2OXQC 2KFTA 2MUMA 3ZVYA 4R7EA 4Q6FA 2QIZA 2RSDA 4XI1A 2LN0A 4WZ2A 2DX8A 2CSYA 1JOCA 2ECGA 4AVXA 5FB1A 5AIUA 2M3HA 1XWHA 4FK5A 2EA6A 2JMIA 2MD7B 2MD8C 4CCGX 2YURA 2MT5A 2JMJA 5B8DA 3C6WA 4LK9A 2ECIA 4LKAA 2F6JA 2FUUA 5LKZA 2LDRA 5G04B 1HYIA 1HYJA 2Y1NA 4A49A 2YT5A 5AITA 1V87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHB A;  5B76 A;  2ECV A;  4AYC A;  4UP0 A;  1Z2Q A;  2ECJ A;  4A4C A;  4YC9 A;  2ECW A;  3HCU A;  2ZET C;  3ZPV E;  2PNX A;  5C13 A;  3I2D A;  2VJE B;  2CKL B;  4YBT A;  1MM2 A;  4S3O B;  3IHP A;  3O37 A;  2LV9 A;  1JM7 A;  3KV5 A;  4PTB A;  4R8P K;  1F62 A;  5B77 A;  2YRE A;  4N4F A;  5KH7 A;  1BOR A;  2VPG A;  4S3O C;  3M63 A;  2H0D A;  1G25 A;  3RTR B;  5TBN A;  1WEQ A;  2YU4 A;  2LXH C;  2XB1 A;  2NAA A;  3N9N A;  1X4J A;  3V43 A;  2M85 A;  3N9M A;  2VJF B;  1T1H A;  4PPE A;  1WE9 A;  3PUR A;  2MA6 A;  2F42 A;  1FBV A;  4L7X A;  1WEP A;  3U5N A;  2M1R A;  5H1U A;  1E4U A;  4P5O B;  4V3L C;  4IC2 A;  2D8S A;  4B7Y C;  5B78 A;  5I3L A;  4BBQ A;  5B75 A;  1LDJ B;  2YSJ A;  4GNE A;  1ZBD B;  4A4B A;  3C5K A;  2ECT A;  3LRQ A;  2I50 A;  3VK6 A;  3M62 A;  2YSM A;  4GND A;  3ZPV 1;  4FIP A;  4UP5 A;  3QZV A;  4I7C A;  1DVP A;  3N9P A;  3O36 A;  3T7L A;  4L58 A;  2MA5 A;  1FP0 A;  3DQV R;  4YBS A;  2K16 A;  1VD4 A;  5D1K B;  4WZ0 A;  4V3K C;  2G6Q A;  1X4U A;  3GL6 A;  4ZDT A;  3SOX A;  2JMD A;  4NN2 A;  2UZG A;  5LKT A;  1WEO A;  5TAB A;  2LGL A;  2QIC A;  4ZUX U;  2HDP A;  4IC3 A;  2LGV A;  3U5P A;  2QJ0 A;  3LQH A;  4YAX A;  2MNZ A;  3U5M A;  4MVT A;  2MIQ A;  3DPL R;  3ZTG A;  4F52 B;  4UI9 B;  5FER A;  3U5O A;  2K4D A;  2M6M A;  2FSA A;  4R2Y A;  2VPB A;  5D1M B;  2LRI C;  4GNG A;  3O35 A;  5G05 B;  4AUQ B;  2KR4 A;  3N9Q A;  5JG6 A;  5LKU A;  1WEW A;  2KGG A;  5KH3 A;  2KWO A;  4FJC A;  3ASL A;  5LCW B;  3FL2 A;  2L0B A;  4AYC B;  5LKX A;  2PUY A;  2MNY A;  4I7B A;  3L11 A;  4YAT A;  2YYR A;  1VFY A;  5TRB A;  4C9Z A;  2KWN A;  5H9M A;  4A0C D;  2KWJ A;  3O70 A;  4W4U A;  2VP7 A;  3RPG B;  1JM7 B;  5C11 A;  3L1Z B;  3PHD A;  4WZ3 B;  1Z60 A;  2H0D B;  2YQL A;  3HCS A;  3RPG C;  4YAB A;  2LGG A;  2JRJ A;  2L43 A;  2BAY A;  3EB5 A;  2C2V S;  1WEM A;  3MHS A;  4GB0 A;  4CA1 A;  2EOD A;  4FO9 A;  1X4I A;  2KWK A;  2KGI A;  1MM3 A;  1WEN A;  5TDW A;  3L1X A;  2IDA A;  3SOU A;  4N3W A;  3SOW A;  5EYA F;  1VYX A;  3KNV A;  3HTK C;  2Y1M A;  5J3X A;  4YAD A;  2FUI A;  4GNF A;  1WIL A;  2KIZ A;  3ZNI A;  5B79 A;  4LAD B;  2VJE A;  4TKP B;  2CKL A;  2E6R A;  4O64 A;  1Z6U A;  2YUC A;  1U6G B;  3KV6 A;  3NG2 A;  3EB6 A;  1CHC A;  2L5U A;  3GV4 A;  3N9L A;  2ECN A;  2L80 A;  3O33 A;  2KYU A;  3T6R A;  3ZYQ A;  4B86 C;  4WA6 A;  2HYE D;  2Y43 A;  5DKA A;  5D1L B;  5H1V A;  2LGK A;  2XEU A;  1K2F A;  1N87 A;  2C2L A;  2AN6 A;  4X3G A;  2LXP C;  2KRE A;  2KE1 A;  2VNF A;  2VJF A;  1RMD A;  1WFK A;  2CT2 A;  2CSZ A;  2RI7 A;  3O34 A;  1WEU A;  2LQ6 A;  3HCT A;  2K1J A;  1IYM A;  3LQJ A;  4LLB A;  4BHW A;  4LJN A;  4QF3 A;  3LQI A;  1WEV A;  1WEE A;  2L75 A;  3N9O A;  3O7A A;  5FB0 A;  5FEY A;  4YBM A;  2F6N A;  2K17 A;  1WGM A;  4QF2 A;  2G43 A;  2E6S A;  2VPD A;  2YHO A;  5TDR A;  5H1T A;  1LDK C;  2YW8 A;  2YQM A;  4MSX A;  2YHN A;  4ZQL A;  3PUQ A;  4I7D A;  5G0F A;  2KU3 A;  3MHH A;  2EGP A;  5DIN A;  3ZVZ B;  1WES A;  5KH9 A;  2G45 A;  4AP4 A;  3M99 A;  3KQI A;  2VPE A;  1WIM A;  2OXQ C;  2KFT A;  2MUM A;  3ZVY A;  4R7E A;  4Q6F A;  2QIZ A;  2RSD A;  4XI1 A;  2LN0 A;  4WZ2 A;  2DX8 A;  2CSY A;  1JOC A;  2ECG A;  4AVX A;  5FB1 A;  5AIU A;  2M3H A;  1XWH A;  4FK5 A;  2EA6 A;  2JMI A;  2MD7 B;  2MD8 C;  4CCG X;  2YUR A;  2MT5 A;  2JMJ A;  5B8D A;  3C6W A;  4LK9 A;  2ECI A;  4LKA A;  2F6J A;  2FUU A;  5LKZ A;  2LDR A;  5G04 B;  1HYI A;  1HYJ A;  2Y1N A;  4A49 A;  2YT5 A;  5AIT A;  1V87 A; 
#chains in the Genus database with same CATH topology
 4Z0R A;  3SHB A;  5B76 A;  2ECV A;  4AYC A;  2XOZ A;  4UP0 A;  1Z2Q A;  3LVQ E;  2ECJ A;  2KKY A;  4A4C A;  4YC9 A;  2ECW A;  3HCU A;  2ZET C;  3ZPV E;  3KDE C;  3LDY A;  2PNX A;  5C13 A;  3I2D A;  2VJE B;  2CKL B;  4YBT A;  1MM2 A;  4S3O B;  3IHP A;  3O37 A;  2LV9 A;  1JM7 A;  3KV5 A;  4PTB A;  4R8P K;  1F62 A;  5B77 A;  2YRE A;  4N4F A;  5KH7 A;  1BOR A;  2VPG A;  4S3O C;  2CRW A;  3M63 A;  2H0D A;  1G25 A;  3RTR B;  5TBN A;  1WEQ A;  4OGE A;  2YU4 A;  2LXH C;  2XB1 A;  2NAA A;  3N9N A;  1X4J A;  3V43 A;  2E61 A;  2M85 A;  3N9M A;  2VJF B;  1T1H A;  4PPE A;  1WE9 A;  3PUR A;  2MA6 A;  2EXU A;  2L7P A;  2CSV A;  2F42 A;  1FBV A;  4L7X A;  4OGC A;  1WEP A;  3U5N A;  2M1R A;  5H1U A;  1DCQ A;  1E4U A;  4P5O B;  4V3L C;  2OWA A;  2IQJ A;  4IC2 A;  2D8S A;  2LAU A;  4B7Y C;  5B78 A;  5I3L A;  4BBQ A;  5B75 A;  1LDJ B;  2YSJ A;  5SVX A;  3FEH A;  4GNE A;  3SUB A;  1ZBD B;  3DDT A;  3LJU X;  4A4B A;  4Z0O A;  3C5K A;  2ECT A;  4F1P A;  2FD4 A;  3LRQ A;  2I50 A;  3VK6 A;  3M62 A;  2YSM A;  4GND A;  5SVY A;  3ZPV 1;  4FIP A;  4UP5 A;  3QZV A;  4I7C A;  1DVP A;  3N9P A;  3O36 A;  3T7L A;  4L58 A;  2MA5 A;  1FP0 A;  3DQV R;  4YBS A;  2K16 A;  1VD4 A;  5D1K B;  4WZ0 A;  4V3K C;  2G6Q A;  1X4U A;  3GL6 A;  4ZDT A;  3SOX A;  2XOY A;  2JMD A;  4NN2 A;  2UZG A;  5K3Q A;  5LKT A;  1WEO A;  5TAB A;  2LGL A;  2QIC A;  4ZUX U;  2HDP A;  4IC3 A;  2LGV A;  3U5P A;  2QJ0 A;  3LQH A;  4YAX A;  2MNZ A;  3U5M A;  4MVT A;  2MIQ A;  3DPL R;  3ZTG A;  4F52 B;  4UI9 B;  5FER A;  3U5O A;  2K4D A;  2XOC A;  2M6M A;  2FSA A;  4R2Y A;  2VPB A;  5D1M B;  2LRI C;  4GNG A;  2JM3 A;  3O35 A;  5G05 B;  2YVR A;  4AUQ B;  2KR4 A;  3N9Q A;  5JG6 A;  5LKU A;  1WEW A;  3E2D A;  2KGG A;  5KH3 A;  2KWO A;  4FJC A;  3ASL A;  5LCW B;  3FL2 A;  2L0B A;  5SVI A;  4AYC B;  4H9D A;  3LVR E;  2DSM A;  5LKX A;  2PUY A;  2MNY A;  4I7B A;  3L11 A;  4YAT A;  2YYR A;  1VFY A;  5TRB A;  4C9Z A;  2KWN A;  5H9M A;  4A0C D;  2RR4 A;  2KWJ A;  4O62 A;  3O70 A;  4W4U A;  2VP7 A;  3RPG B;  1JM7 B;  5C11 A;  3L1Z B;  3PHD A;  4WZ3 B;  1Z60 A;  2H0D B;  2YQL A;  3HCS A;  3RPG C;  4YAB A;  2DJA A;  2LGG A;  2JRJ A;  2L43 A;  2BAY A;  3EB5 A;  2C2V S;  1WEM A;  3MHS A;  3DWD A;  4GB0 A;  4CA1 A;  2EOD A;  4FO9 A;  1X4I A;  5SVI B;  2KWK A;  2KGI A;  1MM3 A;  1WEN A;  5TDW A;  3L1X A;  2IDA A;  3SOU A;  4N3W A;  3SOW A;  2M13 A;  5EYA F;  1VYX A;  2D8U A;  3KNV A;  3PLW A;  3HTK C;  2Y1M A;  5J3X A;  4YAD A;  2FUI A;  4GNF A;  1WIL A;  1MBM A;  2KIZ A;  3ZNI A;  5B79 A;  2EGM A;  4LAD B;  3FAO A;  2CON A;  2VJE A;  4TKP B;  2CKL A;  2E6R A;  4O64 A;  1Z6U A;  2YUC A;  1U6G B;  3KV6 A;  3NG2 A;  3O47 A;  3EB6 A;  1CHC A;  2L5U A;  3GV4 A;  3N9L A;  2ECN A;  2L80 A;  3O33 A;  2KYU A;  3T6R A;  3ZYQ A;  4B86 C;  4WA6 A;  2HYE D;  2Y43 A;  5DKA A;  5D1L B;  5H1V A;  2LGK A;  2XEU A;  1K2F A;  1N87 A;  2C2L A;  2AN6 A;  4X3G A;  2LXP C;  2KRE A;  3FJU B;  2KE1 A;  2VNF A;  2VJF A;  1RMD A;  1WFK A;  2CT2 A;  2CSZ A;  2RI7 A;  3O34 A;  1WEU A;  2LQ6 A;  3HCT A;  2K1J A;  1IYM A;  2P57 A;  3LQJ A;  4QQ4 A;  4LLB A;  4BHW A;  4LJN A;  4QF3 A;  2XP0 A;  3LQI A;  1WEV A;  1WEE A;  2L75 A;  3N9O A;  3O7A A;  5FB0 A;  5FEY A;  2B0O E;  2MKE A;  4YBM A;  2F6N A;  2K17 A;  1WGM A;  4QF2 A;  2G43 A;  2E6S A;  2VPD A;  2YHO A;  5TDR A;  5H1T A;  1LDK C;  3H7H A;  2YW8 A;  2JUN A;  2YQM A;  3T9K A;  4MSX A;  3Q1D A;  2KKX A;  2YHN A;  4ZQL A;  3JUE A;  3PUQ A;  4I7D A;  5G0F A;  2KU3 A;  3MHH A;  2EGP A;  5DIN A;  3ZVZ B;  1WES A;  5KH9 A;  2G45 A;  2CRR A;  4AP4 A;  3FAN A;  3M99 A;  3KQI A;  2VPE A;  1WIM A;  2OXQ C;  2KFT A;  2MUM A;  3ZVY A;  4R7E A;  4Q6F A;  2QIZ A;  2RSD A;  4XI1 A;  2LN0 A;  4WZ2 A;  2DX8 A;  2CSY A;  1JOC A;  2ECG A;  4AVX A;  3M7K A;  5FB1 A;  5AIU A;  2M3H A;  1XWH A;  2FFW A;  4FK5 A;  2EA6 A;  2JMI A;  2MD7 B;  2MD8 C;  3MDB C;  4CCG X;  2YUR A;  2MT5 A;  2JMJ A;  5B8D A;  3C6W A;  4LK9 A;  2ECI A;  4LKA A;  2F6J A;  2FUU A;  5LKZ A;  2LDR A;  5G04 B;  3FM8 C;  1HYI A;  1HYJ A;  2Y1N A;  4A49 A;  2YT5 A;  5AIT A;  1V87 A; 
#chains in the Genus database with same CATH homology
 3SHB A;  5B76 A;  2ECV A;  4AYC A;  4UP0 A;  1Z2Q A;  2ECJ A;  4A4C A;  4YC9 A;  2ECW A;  3HCU A;  2ZET C;  3ZPV E;  2PNX A;  5C13 A;  3I2D A;  2VJE B;  2CKL B;  4YBT A;  1MM2 A;  4S3O B;  3IHP A;  3O37 A;  2LV9 A;  1JM7 A;  3KV5 A;  4PTB A;  4R8P K;  1F62 A;  5B77 A;  2YRE A;  4N4F A;  5KH7 A;  1BOR A;  2VPG A;  4S3O C;  3M63 A;  2H0D A;  1G25 A;  3RTR B;  5TBN A;  1WEQ A;  2YU4 A;  2LXH C;  2XB1 A;  2NAA A;  3N9N A;  1X4J A;  3V43 A;  2M85 A;  3N9M A;  2VJF B;  1T1H A;  4PPE A;  1WE9 A;  3PUR A;  2MA6 A;  2F42 A;  1FBV A;  4L7X A;  1WEP A;  3U5N A;  2M1R A;  5H1U A;  1E4U A;  4P5O B;  4V3L C;  4IC2 A;  2D8S A;  4B7Y C;  5B78 A;  5I3L A;  4BBQ A;  5B75 A;  1LDJ B;  2YSJ A;  4GNE A;  1ZBD B;  4A4B A;  3C5K A;  2ECT A;  3LRQ A;  2I50 A;  3VK6 A;  3M62 A;  2YSM A;  4GND A;  3ZPV 1;  4FIP A;  4UP5 A;  3QZV A;  4I7C A;  1DVP A;  3N9P A;  3O36 A;  3T7L A;  4L58 A;  2MA5 A;  1FP0 A;  3DQV R;  4YBS A;  2K16 A;  1VD4 A;  5D1K B;  4WZ0 A;  4V3K C;  2G6Q A;  1X4U A;  3GL6 A;  4ZDT A;  3SOX A;  2JMD A;  4NN2 A;  2UZG A;  5LKT A;  1WEO A;  5TAB A;  2LGL A;  2QIC A;  4ZUX U;  2HDP A;  4IC3 A;  2LGV A;  3U5P A;  2QJ0 A;  3LQH A;  4YAX A;  2MNZ A;  3U5M A;  4MVT A;  2MIQ A;  3DPL R;  3ZTG A;  4F52 B;  4UI9 B;  5FER A;  3U5O A;  2K4D A;  2M6M A;  2FSA A;  4R2Y A;  2VPB A;  5D1M B;  2LRI C;  4GNG A;  3O35 A;  5G05 B;  4AUQ B;  2KR4 A;  3N9Q A;  5JG6 A;  5LKU A;  1WEW A;  2KGG A;  5KH3 A;  2KWO A;  4FJC A;  3ASL A;  5LCW B;  3FL2 A;  2L0B A;  4AYC B;  5LKX A;  2PUY A;  2MNY A;  4I7B A;  3L11 A;  4YAT A;  2YYR A;  1VFY A;  5TRB A;  4C9Z A;  2KWN A;  5H9M A;  4A0C D;  2KWJ A;  3O70 A;  4W4U A;  2VP7 A;  3RPG B;  1JM7 B;  5C11 A;  3L1Z B;  3PHD A;  4WZ3 B;  1Z60 A;  2H0D B;  2YQL A;  3HCS A;  3RPG C;  4YAB A;  2LGG A;  2JRJ A;  2L43 A;  2BAY A;  3EB5 A;  2C2V S;  1WEM A;  3MHS A;  4GB0 A;  4CA1 A;  2EOD A;  4FO9 A;  1X4I A;  2KWK A;  2KGI A;  1MM3 A;  1WEN A;  5TDW A;  3L1X A;  2IDA A;  3SOU A;  4N3W A;  3SOW A;  5EYA F;  1VYX A;  3KNV A;  3HTK C;  2Y1M A;  5J3X A;  4YAD A;  2FUI A;  4GNF A;  1WIL A;  2KIZ A;  3ZNI A;  5B79 A;  4LAD B;  2VJE A;  4TKP B;  2CKL A;  2E6R A;  4O64 A;  1Z6U A;  2YUC A;  1U6G B;  3KV6 A;  3NG2 A;  3EB6 A;  1CHC A;  2L5U A;  3GV4 A;  3N9L A;  2ECN A;  2L80 A;  3O33 A;  2KYU A;  3T6R A;  3ZYQ A;  4B86 C;  4WA6 A;  2HYE D;  2Y43 A;  5DKA A;  5D1L B;  5H1V A;  2LGK A;  2XEU A;  1K2F A;  1N87 A;  2C2L A;  2AN6 A;  4X3G A;  2LXP C;  2KRE A;  2KE1 A;  2VNF A;  2VJF A;  1RMD A;  1WFK A;  2CT2 A;  2CSZ A;  2RI7 A;  3O34 A;  1WEU A;  2LQ6 A;  3HCT A;  2K1J A;  1IYM A;  3LQJ A;  4LLB A;  4BHW A;  4LJN A;  4QF3 A;  3LQI A;  1WEV A;  1WEE A;  2L75 A;  3N9O A;  3O7A A;  5FB0 A;  5FEY A;  4YBM A;  2F6N A;  2K17 A;  1WGM A;  4QF2 A;  2G43 A;  2E6S A;  2VPD A;  2YHO A;  5TDR A;  5H1T A;  1LDK C;  2YW8 A;  2YQM A;  4MSX A;  2YHN A;  4ZQL A;  3PUQ A;  4I7D A;  5G0F A;  2KU3 A;  3MHH A;  2EGP A;  5DIN A;  3ZVZ B;  1WES A;  5KH9 A;  2G45 A;  4AP4 A;  3M99 A;  3KQI A;  2VPE A;  1WIM A;  2OXQ C;  2KFT A;  2MUM A;  3ZVY A;  4R7E A;  4Q6F A;  2QIZ A;  2RSD A;  4XI1 A;  2LN0 A;  4WZ2 A;  2DX8 A;  2CSY A;  1JOC A;  2ECG A;  4AVX A;  5FB1 A;  5AIU A;  2M3H A;  1XWH A;  4FK5 A;  2EA6 A;  2JMI A;  2MD7 B;  2MD8 C;  4CCG X;  2YUR A;  2MT5 A;  2JMJ A;  5B8D A;  3C6W A;  4LK9 A;  2ECI A;  4LKA A;  2F6J A;  2FUU A;  5LKZ A;  2LDR A;  5G04 B;  1HYI A;  1HYJ A;  2Y1N A;  4A49 A;  2YT5 A;  5AIT A;  1V87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...