2VJEA

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
LNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
publication title Structure of the MDM2/MDMX RING domain heterodimer reveals dimerization is required for their ubiquitylation in trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 12
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjeA00
1VD4A 5B75A 1X4IA 2YT5A 5C11A 2ECVA 1LDKC 5D1LB 4C9ZA 2KU3A 3C6WA 3DPLR 3O7AA 4ZDTA 5EYAF 4LLBA 1WEVA 4PPEA 3HCSA 2YHOA 5JG6A 4UP0A 1FP0A 5DKAA 1X4JA 2MT5A 4X3GA 4QF2A 2XEUA 4GNGA 2KR4A 1DVPA 2VJEB 4AYCB 3KV5A 1BORA 5LCWB 2YSMA 1Z2QA 4YBTA 5B8DA 1MM3A 1G25A 2K17A 2LRIC 5G04B 4YATA 2KFTA 5G0FA 5I3LA 3U5NA 3SOXA 2QICA 2VPBA 4R2YA 2VNFA 1T1HA 5H1UA 1U6GB 1F62A 5B79A 2G45A 3EB5A 2KREA 3LQIA 3RPGC 2YU4A 1HYIA 3ZPVE 2YURA 5TBNA 4BBQA 2DX8A 2XB1A 2YHNA 2VJFA 2KWJA 2G6QA 2L75A 1WE9A 3EB6A 4WZ3B 3SHBA 2UZGA 2ECGA 4QF3A 2MD8C 2F6NA 3V43A 5B77A 1WEQA 5LKXA 4YC9A 3HCTA 2JRJA 1Z60A 3HTKC 4R8PK 5D1MB 2L0BA 2ZETC 2KWOA 2CSZA 3ZNIA 2PUYA 5FEYA 1WEMA 4FO9A 4ZQLA 4Q6FA 3SOWA 4A4CA 2KGGA 3RPGB 2LGVA 5AITA 1WESA 2F42A 1WEEA 3M99A 2EODA 2MIQA 2YREA 2VPEA 1X4UA 1VYXA 2CKLA 3KV6A 1XWHA 1LDJB 2YW8A 5DINA 4A0CD 2KGIA 4V3KC 2VPDA 5H1TA 2CSYA 4O64A 1HYJA 4I7CA 3RTRB 3ASLA 3O70A 3N9PA 1ZBDB 3VK6A 2KE1A 3O33A 4IC2A 2M1RA 2LN0A 1RMDA 1Z6UA 2VJFB 3L1XA 4P5OB 2H0DA 2OXQC 4N3WA 5FB0A 5FB1A 2LV9A 4FIPA 2LDRA 5G05B 3MHSA 2L80A 2BAYA 2YQLA 3C5KA 4A49A 2YUCA 2NAAA 2VPGA 2Y1NA 3FL2A 2RSDA 3LQJA 3KNVA 2Y43A 4PTBA 1WGMA 3O36A 4S3OC 5B78A 1JM7B 5TRBA 1VFYA 4W4UA 3PHDA 2M85A 4AP4A 4F52B 2KYUA 5TDRA 5H9MA 2PNXA 3M62A 4YABA 2QIZA 1WEOA 2JMIA 5LKZA 2EA6A 1N87A 1CHCA 2YYRA 3N9NA 2ECIA 2E6SA 2MA5A 1MM2A 5D1KB 3U5MA 5KH7A 4GNEA 2LGKA 3M63A 3LRQA 3ZTGA 3O34A 3ZPV1 2K4DA 2VJEA 4AYCA 4YBMA 4WZ2A 5FERA 2K16A 2FUIA 4LK9A 2ECNA 3IHPA 4XI1A 3ZVYA 5C13A 2MUMA 2LXHC 3ZYQA 4AUQB 4FJCA 2LQ6A 4S3OB 4TKPB 1V87A 2YSJA 4L7XA 2VP7A 2F6JA 3N9MA 3T6RA 4AVXA 4B86C 4R7EA 2EGPA 4CCGX 2G43A 3U5OA 4I7DA 2MNZA 2QJ0A 5J3XA 4YADA 2MA6A 4YAXA 2JMJA 4IC3A 3T7LA 4MSXA 3DQVR 2AN6A 2KWKA 4YBSA 3O35A 3SOUA 5H1VA 2IDAA 3O37A 3L11A 4LKAA 2I50A 5AIUA 1IYMA 4L58A 3QZVA 2RI7A 2ECWA 2D8SA 2LGLA 2C2VS 5TABA 4BHWA 2JMDA 4B7YC 2KIZA 4GB0A 2YQMA 2L5UA 4UI9B 4A4BA 1WFKA 4ZUXU 3ZVZB 2FSAA 3LQHA 3PURA 2ECJA 5LKTA 5TDWA 2FUUA 4NN2A 1K2FA 3GL6A 1WEUA 2CT2A 5LKUA 1WENA 3U5PA 3N9LA 2M3HA 4I7BA 2LGGA 3HCUA 2M6MA 2CKLB 3NG2A 5KH3A 5B76A 3GV4A 3N9QA 4LADB 2KWNA 3MHHA 2MNYA 2K1JA 3N9OA 1WEWA 4CA1A 1FBVA 4LJNA 1WILA 3I2DA 2HDPA 4WZ0A 4WA6A 2MD7B 4FK5A 2ECTA 3KQIA 3L1ZB 2C2LA 1WEPA 2H0DB 4UP5A 1E4UA 2L43A 4V3LC 4N4FA 4GNFA 1WIMA 2LXPC 5KH9A 2Y1MA 1JOCA 1JM7A 2E6RA 4MVTA 2HYED 3PUQA 4GNDA
chains in the Genus database with same CATH superfamily
3PLWA 1VD4A 5B75A 1X4IA 2YT5A 5C11A 2ECVA 1LDKC 5D1LB 4C9ZA 2EGMA 2KU3A 3C6WA 3DPLR 3O7AA 4ZDTA 5EYAF 4LLBA 1WEVA 2FD4A 4PPEA 3HCSA 3LVRE 2YHOA 5JG6A 4UP0A 1FP0A 5DKAA 3LVQE 1X4JA 2MT5A 4X3GA 4QF2A 2XEUA 2KKXA 4GNGA 2KR4A 1DVPA 2VJEB 4AYCB 3DWDA 3KV5A 1BORA 5LCWB 2YSMA 1Z2QA 4YBTA 5B8DA 1MM3A 1G25A 2K17A 2LRIC 5G04B 4YATA 2KFTA 5G0FA 2MKEA 5I3LA 2XOYA 3U5NA 3SOXA 2QICA 2VPBA 4R2YA 2VNFA 1T1HA 5H1UA 1U6GB 1F62A 5B79A 2L7PA 2G45A 3EB5A 2KREA 3LQIA 3RPGC 2YU4A 4F1PA 4QQ4A 1HYIA 3ZPVE 2YURA 2M13A 3FM8C 5TBNA 4BBQA 2DX8A 2IQJA 2XB1A 2YHNA 2VJFA 2KWJA 2G6QA 4Z0RA 2L75A 1WE9A 3EB6A 4WZ3B 3SHBA 2UZGA 2ECGA 4QF3A 2MD8C 2CONA 2F6NA 3V43A 5B77A 1WEQA 5LKXA 4YC9A 3HCTA 2JRJA 1Z60A 3HTKC 4R8PK 2LAUA 5D1MB 2L0BA 2ZETC 2KWOA 5SVIB 2CSZA 3ZNIA 4H9DA 2PUYA 5FEYA 1WEMA 2KKYA 2XOCA 4FO9A 2XOZA 4ZQLA 4Q6FA 3SOWA 2P57A 4A4CA 2KGGA 3RPGB 2LGVA 5AITA 3JUEA 1WESA 3LDYA 2F42A 1WEEA 3M99A 2EODA 2MIQA 2YREA 2VPEA 1X4UA 1VYXA 2CKLA 3KV6A 1XWHA 3FANA 3E2DA 1LDJB 2YW8A 5DINA 4A0CD 2KGIA 4V3KC 2VPDA 5H1TA 2CSYA 4O64A 1HYJA 4I7CA 3RTRB 4O62A 3ASLA 3O70A 3N9PA 1ZBDB 3VK6A 2KE1A 3O33A 4IC2A 2M1RA 2LN0A 1RMDA 1Z6UA 2VJFB 3L1XA 4P5OB 2H0DA 3SUBA 2OXQC 4N3WA 5FB0A 4OGEA 5FB1A 2LV9A 4FIPA 2LDRA 5G05B 3MHSA 2L80A 3O47A 2BAYA 2YQLA 3C5KA 4A49A 2YUCA 2NAAA 2VPGA 3FAOA 2Y1NA 3FL2A 2RSDA 3LQJA 3KNVA 2Y43A 4PTBA 1WGMA 3O36A 4S3OC 5B78A 1JM7B 5TRBA 1VFYA 4W4UA 3PHDA 2M85A 4AP4A 2CRRA 4F52B 2KYUA 5TDRA 5H9MA 2PNXA 3M62A 4YABA 2QIZA 2FFWA 2CRWA 1WEOA 2JMIA 5LKZA 2EA6A 1N87A 1CHCA 2YYRA 3N9NA 2YVRA 2ECIA 2E6SA 2MA5A 1MM2A 5D1KB 3U5MA 5KH7A 4GNEA 2LGKA 3M63A 3LRQA 3ZTGA 3O34A 3ZPV1 2K4DA 2VJEA 4AYCA 4YBMA 4WZ2A 3DDTA 3MDBC 5FERA 2K16A 2RR4A 2FUIA 4LK9A 3FJUB 2ECNA 3IHPA 4XI1A 2E61A 2CSVA 2EXUA 3ZVYA 5C13A 2DSMA 2MUMA 2LXHC 2B0OE 3ZYQA 4AUQB 4FJCA 2LQ6A 4S3OB 4TKPB 1V87A 2JM3A 2YSJA 4L7XA 2VP7A 2F6JA 3N9MA 3T6RA 4AVXA 4B86C 4R7EA 2EGPA 4Z0OA 4CCGX 2D8UA 2G43A 3U5OA 4I7DA 2MNZA 2QJ0A 5J3XA 4YADA 2MA6A 4YAXA 2JMJA 4IC3A 3T7LA 4MSXA 3DQVR 2AN6A 2KWKA 4YBSA 3O35A 4OGCA 3SOUA 5H1VA 2IDAA 3O37A 3L11A 4LKAA 1MBMA 2I50A 2OWAA 5SVIA 5AIUA 1IYMA 3H7HA 2JUNA 4L58A 3QZVA 2RI7A 2ECWA 2D8SA 2LGLA 2C2VS 3KDEC 5TABA 4BHWA 2JMDA 4B7YC 2KIZA 4GB0A 5SVYA 2YQMA 2L5UA 4UI9B 4A4BA 1WFKA 4ZUXU 3ZVZB 2FSAA 3Q1DA 2DJAA 3LQHA 3PURA 2ECJA 3FEHA 5LKTA 5TDWA 2FUUA 4NN2A 1K2FA 3GL6A 1WEUA 2CT2A 5LKUA 5K3QA 1WENA 3U5PA 3N9LA 2M3HA 4I7BA 5SVXA 2LGGA 3HCUA 2M6MA 2CKLB 3T9KA 3NG2A 5KH3A 5B76A 3GV4A 3N9QA 4LADB 2KWNA 3MHHA 2MNYA 2K1JA 3N9OA 1WEWA 4CA1A 1FBVA 4LJNA 3LJUX 1WILA 3I2DA 2HDPA 4WZ0A 3M7KA 4WA6A 2MD7B 4FK5A 2XP0A 2ECTA 3KQIA 3L1ZB 2C2LA 1WEPA 2H0DB 4UP5A 1E4UA 2L43A 4V3LC 4N4FA 4GNFA 1WIMA 2LXPC 5KH9A 2Y1MA 1JOCA 1JM7A 1DCQA 2E6RA 4MVTA 2HYED 3PUQA 4GNDA
chains in the Genus database with same CATH topology
1VD4A 5B75A 1X4IA 2YT5A 5C11A 2ECVA 1LDKC 5D1LB 4C9ZA 2KU3A 3C6WA 3DPLR 3O7AA 4ZDTA 5EYAF 4LLBA 1WEVA 4PPEA 3HCSA 2YHOA 5JG6A 4UP0A 1FP0A 5DKAA 1X4JA 2MT5A 4X3GA 4QF2A 2XEUA 4GNGA 2KR4A 1DVPA 2VJEB 4AYCB 3KV5A 1BORA 5LCWB 2YSMA 1Z2QA 4YBTA 5B8DA 1MM3A 1G25A 2K17A 2LRIC 5G04B 4YATA 2KFTA 5G0FA 5I3LA 3U5NA 3SOXA 2QICA 2VPBA 4R2YA 2VNFA 1T1HA 5H1UA 1U6GB 1F62A 5B79A 2G45A 3EB5A 2KREA 3LQIA 3RPGC 2YU4A 1HYIA 3ZPVE 2YURA 5TBNA 4BBQA 2DX8A 2XB1A 2YHNA 2VJFA 2KWJA 2G6QA 2L75A 1WE9A 3EB6A 4WZ3B 3SHBA 2UZGA 2ECGA 4QF3A 2MD8C 2F6NA 3V43A 5B77A 1WEQA 5LKXA 4YC9A 3HCTA 2JRJA 1Z60A 3HTKC 4R8PK 5D1MB 2L0BA 2ZETC 2KWOA 2CSZA 3ZNIA 2PUYA 5FEYA 1WEMA 4FO9A 4ZQLA 4Q6FA 3SOWA 4A4CA 2KGGA 3RPGB 2LGVA 5AITA 1WESA 2F42A 1WEEA 3M99A 2EODA 2MIQA 2YREA 2VPEA 1X4UA 1VYXA 2CKLA 3KV6A 1XWHA 1LDJB 2YW8A 5DINA 4A0CD 2KGIA 4V3KC 2VPDA 5H1TA 2CSYA 4O64A 1HYJA 4I7CA 3RTRB 3ASLA 3O70A 3N9PA 1ZBDB 3VK6A 2KE1A 3O33A 4IC2A 2M1RA 2LN0A 1RMDA 1Z6UA 2VJFB 3L1XA 4P5OB 2H0DA 2OXQC 4N3WA 5FB0A 5FB1A 2LV9A 4FIPA 2LDRA 5G05B 3MHSA 2L80A 2BAYA 2YQLA 3C5KA 4A49A 2YUCA 2NAAA 2VPGA 2Y1NA 3FL2A 2RSDA 3LQJA 3KNVA 2Y43A 4PTBA 1WGMA 3O36A 4S3OC 5B78A 1JM7B 5TRBA 1VFYA 4W4UA 3PHDA 2M85A 4AP4A 4F52B 2KYUA 5TDRA 5H9MA 2PNXA 3M62A 4YABA 2QIZA 1WEOA 2JMIA 5LKZA 2EA6A 1N87A 1CHCA 2YYRA 3N9NA 2ECIA 2E6SA 2MA5A 1MM2A 5D1KB 3U5MA 5KH7A 4GNEA 2LGKA 3M63A 3LRQA 3ZTGA 3O34A 3ZPV1 2K4DA 2VJEA 4AYCA 4YBMA 4WZ2A 5FERA 2K16A 2FUIA 4LK9A 2ECNA 3IHPA 4XI1A 3ZVYA 5C13A 2MUMA 2LXHC 3ZYQA 4AUQB 4FJCA 2LQ6A 4S3OB 4TKPB 1V87A 2YSJA 4L7XA 2VP7A 2F6JA 3N9MA 3T6RA 4AVXA 4B86C 4R7EA 2EGPA 4CCGX 2G43A 3U5OA 4I7DA 2MNZA 2QJ0A 5J3XA 4YADA 2MA6A 4YAXA 2JMJA 4IC3A 3T7LA 4MSXA 3DQVR 2AN6A 2KWKA 4YBSA 3O35A 3SOUA 5H1VA 2IDAA 3O37A 3L11A 4LKAA 2I50A 5AIUA 1IYMA 4L58A 3QZVA 2RI7A 2ECWA 2D8SA 2LGLA 2C2VS 5TABA 4BHWA 2JMDA 4B7YC 2KIZA 4GB0A 2YQMA 2L5UA 4UI9B 4A4BA 1WFKA 4ZUXU 3ZVZB 2FSAA 3LQHA 3PURA 2ECJA 5LKTA 5TDWA 2FUUA 4NN2A 1K2FA 3GL6A 1WEUA 2CT2A 5LKUA 1WENA 3U5PA 3N9LA 2M3HA 4I7BA 2LGGA 3HCUA 2M6MA 2CKLB 3NG2A 5KH3A 5B76A 3GV4A 3N9QA 4LADB 2KWNA 3MHHA 2MNYA 2K1JA 3N9OA 1WEWA 4CA1A 1FBVA 4LJNA 1WILA 3I2DA 2HDPA 4WZ0A 4WA6A 2MD7B 4FK5A 2ECTA 3KQIA 3L1ZB 2C2LA 1WEPA 2H0DB 4UP5A 1E4UA 2L43A 4V3LC 4N4FA 4GNFA 1WIMA 2LXPC 5KH9A 2Y1MA 1JOCA 1JM7A 2E6RA 4MVTA 2HYED 3PUQA 4GNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VD4 A;  5B75 A;  1X4I A;  2YT5 A;  5C11 A;  2ECV A;  1LDK C;  5D1L B;  4C9Z A;  2KU3 A;  3C6W A;  3DPL R;  3O7A A;  4ZDT A;  5EYA F;  4LLB A;  1WEV A;  4PPE A;  3HCS A;  2YHO A;  5JG6 A;  4UP0 A;  1FP0 A;  5DKA A;  1X4J A;  2MT5 A;  4X3G A;  4QF2 A;  2XEU A;  4GNG A;  2KR4 A;  1DVP A;  2VJE B;  4AYC B;  3KV5 A;  1BOR A;  5LCW B;  2YSM A;  1Z2Q A;  4YBT A;  5B8D A;  1MM3 A;  1G25 A;  2K17 A;  2LRI C;  5G04 B;  4YAT A;  2KFT A;  5G0F A;  5I3L A;  3U5N A;  3SOX A;  2QIC A;  2VPB A;  4R2Y A;  2VNF A;  1T1H A;  5H1U A;  1U6G B;  1F62 A;  5B79 A;  2G45 A;  3EB5 A;  2KRE A;  3LQI A;  3RPG C;  2YU4 A;  1HYI A;  3ZPV E;  2YUR A;  5TBN A;  4BBQ A;  2DX8 A;  2XB1 A;  2YHN A;  2VJF A;  2KWJ A;  2G6Q A;  2L75 A;  1WE9 A;  3EB6 A;  4WZ3 B;  3SHB A;  2UZG A;  2ECG A;  4QF3 A;  2MD8 C;  2F6N A;  3V43 A;  5B77 A;  1WEQ A;  5LKX A;  4YC9 A;  3HCT A;  2JRJ A;  1Z60 A;  3HTK C;  4R8P K;  5D1M B;  2L0B A;  2ZET C;  2KWO A;  2CSZ A;  3ZNI A;  2PUY A;  5FEY A;  1WEM A;  4FO9 A;  4ZQL A;  4Q6F A;  3SOW A;  4A4C A;  2KGG A;  3RPG B;  2LGV A;  5AIT A;  1WES A;  2F42 A;  1WEE A;  3M99 A;  2EOD A;  2MIQ A;  2YRE A;  2VPE A;  1X4U A;  1VYX A;  2CKL A;  3KV6 A;  1XWH A;  1LDJ B;  2YW8 A;  5DIN A;  4A0C D;  2KGI A;  4V3K C;  2VPD A;  5H1T A;  2CSY A;  4O64 A;  1HYJ A;  4I7C A;  3RTR B;  3ASL A;  3O70 A;  3N9P A;  1ZBD B;  3VK6 A;  2KE1 A;  3O33 A;  4IC2 A;  2M1R A;  2LN0 A;  1RMD A;  1Z6U A;  2VJF B;  3L1X A;  4P5O B;  2H0D A;  2OXQ C;  4N3W A;  5FB0 A;  5FB1 A;  2LV9 A;  4FIP A;  2LDR A;  5G05 B;  3MHS A;  2L80 A;  2BAY A;  2YQL A;  3C5K A;  4A49 A;  2YUC A;  2NAA A;  2VPG A;  2Y1N A;  3FL2 A;  2RSD A;  3LQJ A;  3KNV A;  2Y43 A;  4PTB A;  1WGM A;  3O36 A;  4S3O C;  5B78 A;  1JM7 B;  5TRB A;  1VFY A;  4W4U A;  3PHD A;  2M85 A;  4AP4 A;  4F52 B;  2KYU A;  5TDR A;  5H9M A;  2PNX A;  3M62 A;  4YAB A;  2QIZ A;  1WEO A;  2JMI A;  5LKZ A;  2EA6 A;  1N87 A;  1CHC A;  2YYR A;  3N9N A;  2ECI A;  2E6S A;  2MA5 A;  1MM2 A;  5D1K B;  3U5M A;  5KH7 A;  4GNE A;  2LGK A;  3M63 A;  3LRQ A;  3ZTG A;  3O34 A;  3ZPV 1;  2K4D A;  2VJE A;  4AYC A;  4YBM A;  4WZ2 A;  5FER A;  2K16 A;  2FUI A;  4LK9 A;  2ECN A;  3IHP A;  4XI1 A;  3ZVY A;  5C13 A;  2MUM A;  2LXH C;  3ZYQ A;  4AUQ B;  4FJC A;  2LQ6 A;  4S3O B;  4TKP B;  1V87 A;  2YSJ A;  4L7X A;  2VP7 A;  2F6J A;  3N9M A;  3T6R A;  4AVX A;  4B86 C;  4R7E A;  2EGP A;  4CCG X;  2G43 A;  3U5O A;  4I7D A;  2MNZ A;  2QJ0 A;  5J3X A;  4YAD A;  2MA6 A;  4YAX A;  2JMJ A;  4IC3 A;  3T7L A;  4MSX A;  3DQV R;  2AN6 A;  2KWK A;  4YBS A;  3O35 A;  3SOU A;  5H1V A;  2IDA A;  3O37 A;  3L11 A;  4LKA A;  2I50 A;  5AIU A;  1IYM A;  4L58 A;  3QZV A;  2RI7 A;  2ECW A;  2D8S A;  2LGL A;  2C2V S;  5TAB A;  4BHW A;  2JMD A;  4B7Y C;  2KIZ A;  4GB0 A;  2YQM A;  2L5U A;  4UI9 B;  4A4B A;  1WFK A;  4ZUX U;  3ZVZ B;  2FSA A;  3LQH A;  3PUR A;  2ECJ A;  5LKT A;  5TDW A;  2FUU A;  4NN2 A;  1K2F A;  3GL6 A;  1WEU A;  2CT2 A;  5LKU A;  1WEN A;  3U5P A;  3N9L A;  2M3H A;  4I7B A;  2LGG A;  3HCU A;  2M6M A;  2CKL B;  3NG2 A;  5KH3 A;  5B76 A;  3GV4 A;  3N9Q A;  4LAD B;  2KWN A;  3MHH A;  2MNY A;  2K1J A;  3N9O A;  1WEW A;  4CA1 A;  1FBV A;  4LJN A;  1WIL A;  3I2D A;  2HDP A;  4WZ0 A;  4WA6 A;  2MD7 B;  4FK5 A;  2ECT A;  3KQI A;  3L1Z B;  2C2L A;  1WEP A;  2H0D B;  4UP5 A;  1E4U A;  2L43 A;  4V3L C;  4N4F A;  4GNF A;  1WIM A;  2LXP C;  5KH9 A;  2Y1M A;  1JOC A;  1JM7 A;  2E6R A;  4MVT A;  2HYE D;  3PUQ A;  4GND A; 
#chains in the Genus database with same CATH topology
 3PLW A;  1VD4 A;  5B75 A;  1X4I A;  2YT5 A;  5C11 A;  2ECV A;  1LDK C;  5D1L B;  4C9Z A;  2EGM A;  2KU3 A;  3C6W A;  3DPL R;  3O7A A;  4ZDT A;  5EYA F;  4LLB A;  1WEV A;  2FD4 A;  4PPE A;  3HCS A;  3LVR E;  2YHO A;  5JG6 A;  4UP0 A;  1FP0 A;  5DKA A;  3LVQ E;  1X4J A;  2MT5 A;  4X3G A;  4QF2 A;  2XEU A;  2KKX A;  4GNG A;  2KR4 A;  1DVP A;  2VJE B;  4AYC B;  3DWD A;  3KV5 A;  1BOR A;  5LCW B;  2YSM A;  1Z2Q A;  4YBT A;  5B8D A;  1MM3 A;  1G25 A;  2K17 A;  2LRI C;  5G04 B;  4YAT A;  2KFT A;  5G0F A;  2MKE A;  5I3L A;  2XOY A;  3U5N A;  3SOX A;  2QIC A;  2VPB A;  4R2Y A;  2VNF A;  1T1H A;  5H1U A;  1U6G B;  1F62 A;  5B79 A;  2L7P A;  2G45 A;  3EB5 A;  2KRE A;  3LQI A;  3RPG C;  2YU4 A;  4F1P A;  4QQ4 A;  1HYI A;  3ZPV E;  2YUR A;  2M13 A;  3FM8 C;  5TBN A;  4BBQ A;  2DX8 A;  2IQJ A;  2XB1 A;  2YHN A;  2VJF A;  2KWJ A;  2G6Q A;  4Z0R A;  2L75 A;  1WE9 A;  3EB6 A;  4WZ3 B;  3SHB A;  2UZG A;  2ECG A;  4QF3 A;  2MD8 C;  2CON A;  2F6N A;  3V43 A;  5B77 A;  1WEQ A;  5LKX A;  4YC9 A;  3HCT A;  2JRJ A;  1Z60 A;  3HTK C;  4R8P K;  2LAU A;  5D1M B;  2L0B A;  2ZET C;  2KWO A;  5SVI B;  2CSZ A;  3ZNI A;  4H9D A;  2PUY A;  5FEY A;  1WEM A;  2KKY A;  2XOC A;  4FO9 A;  2XOZ A;  4ZQL A;  4Q6F A;  3SOW A;  2P57 A;  4A4C A;  2KGG A;  3RPG B;  2LGV A;  5AIT A;  3JUE A;  1WES A;  3LDY A;  2F42 A;  1WEE A;  3M99 A;  2EOD A;  2MIQ A;  2YRE A;  2VPE A;  1X4U A;  1VYX A;  2CKL A;  3KV6 A;  1XWH A;  3FAN A;  3E2D A;  1LDJ B;  2YW8 A;  5DIN A;  4A0C D;  2KGI A;  4V3K C;  2VPD A;  5H1T A;  2CSY A;  4O64 A;  1HYJ A;  4I7C A;  3RTR B;  4O62 A;  3ASL A;  3O70 A;  3N9P A;  1ZBD B;  3VK6 A;  2KE1 A;  3O33 A;  4IC2 A;  2M1R A;  2LN0 A;  1RMD A;  1Z6U A;  2VJF B;  3L1X A;  4P5O B;  2H0D A;  3SUB A;  2OXQ C;  4N3W A;  5FB0 A;  4OGE A;  5FB1 A;  2LV9 A;  4FIP A;  2LDR A;  5G05 B;  3MHS A;  2L80 A;  3O47 A;  2BAY A;  2YQL A;  3C5K A;  4A49 A;  2YUC A;  2NAA A;  2VPG A;  3FAO A;  2Y1N A;  3FL2 A;  2RSD A;  3LQJ A;  3KNV A;  2Y43 A;  4PTB A;  1WGM A;  3O36 A;  4S3O C;  5B78 A;  1JM7 B;  5TRB A;  1VFY A;  4W4U A;  3PHD A;  2M85 A;  4AP4 A;  2CRR A;  4F52 B;  2KYU A;  5TDR A;  5H9M A;  2PNX A;  3M62 A;  4YAB A;  2QIZ A;  2FFW A;  2CRW A;  1WEO A;  2JMI A;  5LKZ A;  2EA6 A;  1N87 A;  1CHC A;  2YYR A;  3N9N A;  2YVR A;  2ECI A;  2E6S A;  2MA5 A;  1MM2 A;  5D1K B;  3U5M A;  5KH7 A;  4GNE A;  2LGK A;  3M63 A;  3LRQ A;  3ZTG A;  3O34 A;  3ZPV 1;  2K4D A;  2VJE A;  4AYC A;  4YBM A;  4WZ2 A;  3DDT A;  3MDB C;  5FER A;  2K16 A;  2RR4 A;  2FUI A;  4LK9 A;  3FJU B;  2ECN A;  3IHP A;  4XI1 A;  2E61 A;  2CSV A;  2EXU A;  3ZVY A;  5C13 A;  2DSM A;  2MUM A;  2LXH C;  2B0O E;  3ZYQ A;  4AUQ B;  4FJC A;  2LQ6 A;  4S3O B;  4TKP B;  1V87 A;  2JM3 A;  2YSJ A;  4L7X A;  2VP7 A;  2F6J A;  3N9M A;  3T6R A;  4AVX A;  4B86 C;  4R7E A;  2EGP A;  4Z0O A;  4CCG X;  2D8U A;  2G43 A;  3U5O A;  4I7D A;  2MNZ A;  2QJ0 A;  5J3X A;  4YAD A;  2MA6 A;  4YAX A;  2JMJ A;  4IC3 A;  3T7L A;  4MSX A;  3DQV R;  2AN6 A;  2KWK A;  4YBS A;  3O35 A;  4OGC A;  3SOU A;  5H1V A;  2IDA A;  3O37 A;  3L11 A;  4LKA A;  1MBM A;  2I50 A;  2OWA A;  5SVI A;  5AIU A;  1IYM A;  3H7H A;  2JUN A;  4L58 A;  3QZV A;  2RI7 A;  2ECW A;  2D8S A;  2LGL A;  2C2V S;  3KDE C;  5TAB A;  4BHW A;  2JMD A;  4B7Y C;  2KIZ A;  4GB0 A;  5SVY A;  2YQM A;  2L5U A;  4UI9 B;  4A4B A;  1WFK A;  4ZUX U;  3ZVZ B;  2FSA A;  3Q1D A;  2DJA A;  3LQH A;  3PUR A;  2ECJ A;  3FEH A;  5LKT A;  5TDW A;  2FUU A;  4NN2 A;  1K2F A;  3GL6 A;  1WEU A;  2CT2 A;  5LKU A;  5K3Q A;  1WEN A;  3U5P A;  3N9L A;  2M3H A;  4I7B A;  5SVX A;  2LGG A;  3HCU A;  2M6M A;  2CKL B;  3T9K A;  3NG2 A;  5KH3 A;  5B76 A;  3GV4 A;  3N9Q A;  4LAD B;  2KWN A;  3MHH A;  2MNY A;  2K1J A;  3N9O A;  1WEW A;  4CA1 A;  1FBV A;  4LJN A;  3LJU X;  1WIL A;  3I2D A;  2HDP A;  4WZ0 A;  3M7K A;  4WA6 A;  2MD7 B;  4FK5 A;  2XP0 A;  2ECT A;  3KQI A;  3L1Z B;  2C2L A;  1WEP A;  2H0D B;  4UP5 A;  1E4U A;  2L43 A;  4V3L C;  4N4F A;  4GNF A;  1WIM A;  2LXP C;  5KH9 A;  2Y1M A;  1JOC A;  1JM7 A;  1DCQ A;  2E6R A;  4MVT A;  2HYE D;  3PUQ A;  4GND A; 
#chains in the Genus database with same CATH homology
 1VD4 A;  5B75 A;  1X4I A;  2YT5 A;  5C11 A;  2ECV A;  1LDK C;  5D1L B;  4C9Z A;  2KU3 A;  3C6W A;  3DPL R;  3O7A A;  4ZDT A;  5EYA F;  4LLB A;  1WEV A;  4PPE A;  3HCS A;  2YHO A;  5JG6 A;  4UP0 A;  1FP0 A;  5DKA A;  1X4J A;  2MT5 A;  4X3G A;  4QF2 A;  2XEU A;  4GNG A;  2KR4 A;  1DVP A;  2VJE B;  4AYC B;  3KV5 A;  1BOR A;  5LCW B;  2YSM A;  1Z2Q A;  4YBT A;  5B8D A;  1MM3 A;  1G25 A;  2K17 A;  2LRI C;  5G04 B;  4YAT A;  2KFT A;  5G0F A;  5I3L A;  3U5N A;  3SOX A;  2QIC A;  2VPB A;  4R2Y A;  2VNF A;  1T1H A;  5H1U A;  1U6G B;  1F62 A;  5B79 A;  2G45 A;  3EB5 A;  2KRE A;  3LQI A;  3RPG C;  2YU4 A;  1HYI A;  3ZPV E;  2YUR A;  5TBN A;  4BBQ A;  2DX8 A;  2XB1 A;  2YHN A;  2VJF A;  2KWJ A;  2G6Q A;  2L75 A;  1WE9 A;  3EB6 A;  4WZ3 B;  3SHB A;  2UZG A;  2ECG A;  4QF3 A;  2MD8 C;  2F6N A;  3V43 A;  5B77 A;  1WEQ A;  5LKX A;  4YC9 A;  3HCT A;  2JRJ A;  1Z60 A;  3HTK C;  4R8P K;  5D1M B;  2L0B A;  2ZET C;  2KWO A;  2CSZ A;  3ZNI A;  2PUY A;  5FEY A;  1WEM A;  4FO9 A;  4ZQL A;  4Q6F A;  3SOW A;  4A4C A;  2KGG A;  3RPG B;  2LGV A;  5AIT A;  1WES A;  2F42 A;  1WEE A;  3M99 A;  2EOD A;  2MIQ A;  2YRE A;  2VPE A;  1X4U A;  1VYX A;  2CKL A;  3KV6 A;  1XWH A;  1LDJ B;  2YW8 A;  5DIN A;  4A0C D;  2KGI A;  4V3K C;  2VPD A;  5H1T A;  2CSY A;  4O64 A;  1HYJ A;  4I7C A;  3RTR B;  3ASL A;  3O70 A;  3N9P A;  1ZBD B;  3VK6 A;  2KE1 A;  3O33 A;  4IC2 A;  2M1R A;  2LN0 A;  1RMD A;  1Z6U A;  2VJF B;  3L1X A;  4P5O B;  2H0D A;  2OXQ C;  4N3W A;  5FB0 A;  5FB1 A;  2LV9 A;  4FIP A;  2LDR A;  5G05 B;  3MHS A;  2L80 A;  2BAY A;  2YQL A;  3C5K A;  4A49 A;  2YUC A;  2NAA A;  2VPG A;  2Y1N A;  3FL2 A;  2RSD A;  3LQJ A;  3KNV A;  2Y43 A;  4PTB A;  1WGM A;  3O36 A;  4S3O C;  5B78 A;  1JM7 B;  5TRB A;  1VFY A;  4W4U A;  3PHD A;  2M85 A;  4AP4 A;  4F52 B;  2KYU A;  5TDR A;  5H9M A;  2PNX A;  3M62 A;  4YAB A;  2QIZ A;  1WEO A;  2JMI A;  5LKZ A;  2EA6 A;  1N87 A;  1CHC A;  2YYR A;  3N9N A;  2ECI A;  2E6S A;  2MA5 A;  1MM2 A;  5D1K B;  3U5M A;  5KH7 A;  4GNE A;  2LGK A;  3M63 A;  3LRQ A;  3ZTG A;  3O34 A;  3ZPV 1;  2K4D A;  2VJE A;  4AYC A;  4YBM A;  4WZ2 A;  5FER A;  2K16 A;  2FUI A;  4LK9 A;  2ECN A;  3IHP A;  4XI1 A;  3ZVY A;  5C13 A;  2MUM A;  2LXH C;  3ZYQ A;  4AUQ B;  4FJC A;  2LQ6 A;  4S3O B;  4TKP B;  1V87 A;  2YSJ A;  4L7X A;  2VP7 A;  2F6J A;  3N9M A;  3T6R A;  4AVX A;  4B86 C;  4R7E A;  2EGP A;  4CCG X;  2G43 A;  3U5O A;  4I7D A;  2MNZ A;  2QJ0 A;  5J3X A;  4YAD A;  2MA6 A;  4YAX A;  2JMJ A;  4IC3 A;  3T7L A;  4MSX A;  3DQV R;  2AN6 A;  2KWK A;  4YBS A;  3O35 A;  3SOU A;  5H1V A;  2IDA A;  3O37 A;  3L11 A;  4LKA A;  2I50 A;  5AIU A;  1IYM A;  4L58 A;  3QZV A;  2RI7 A;  2ECW A;  2D8S A;  2LGL A;  2C2V S;  5TAB A;  4BHW A;  2JMD A;  4B7Y C;  2KIZ A;  4GB0 A;  2YQM A;  2L5U A;  4UI9 B;  4A4B A;  1WFK A;  4ZUX U;  3ZVZ B;  2FSA A;  3LQH A;  3PUR A;  2ECJ A;  5LKT A;  5TDW A;  2FUU A;  4NN2 A;  1K2F A;  3GL6 A;  1WEU A;  2CT2 A;  5LKU A;  1WEN A;  3U5P A;  3N9L A;  2M3H A;  4I7B A;  2LGG A;  3HCU A;  2M6M A;  2CKL B;  3NG2 A;  5KH3 A;  5B76 A;  3GV4 A;  3N9Q A;  4LAD B;  2KWN A;  3MHH A;  2MNY A;  2K1J A;  3N9O A;  1WEW A;  4CA1 A;  1FBV A;  4LJN A;  1WIL A;  3I2D A;  2HDP A;  4WZ0 A;  4WA6 A;  2MD7 B;  4FK5 A;  2ECT A;  3KQI A;  3L1Z B;  2C2L A;  1WEP A;  2H0D B;  4UP5 A;  1E4U A;  2L43 A;  4V3L C;  4N4F A;  4GNF A;  1WIM A;  2LXP C;  5KH9 A;  2Y1M A;  1JOC A;  1JM7 A;  2E6R A;  4MVT A;  2HYE D;  3PUQ A;  4GND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...