3PHDA

Crystal structure of human hdac6 in complex with ubiquitin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Histone deacetylase 6
publication title Protein Aggregates Are Recruited to Aggresome by Histone Deacetylase 6 via Unanchored Ubiquitin C Termini.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3phdA00
2JRJA 2MUMA 3U5PA 4IC2A 1FBVA 2E6SA 1WEQA 4AUQB 1X4IA 2KGIA 4LK9A 4B7YC 3PURA 2MNZA 2YSJA 4FIPA 3T7LA 3DPLR 2LGVA 2HYED 1E4UA 5D1LB 5KH9A 5TBNA 2EODA 2YW8A 4YABA 1JM7A 2CSYA 3MHHA 1LDKC 2KWOA 4S3OB 4MSXA 5FB0A 3L1XA 4N3WA 2KYUA 4V3LC 1FP0A 4ZDTA 5LKZA 2VPBA 3O34A 1WEOA 3U5MA 4P5OB 3SOUA 3RTRB 2ECGA 2RI7A 1WILA 5J3XA 4WZ3B 3HCSA 1U6GB 4MVTA 2L0BA 4YADA 5C11A 4N4FA 4YATA 3KV5A 4YC9A 3M63A 2ECVA 4F52B 4QF2A 2UZGA 2YT5A 5AIUA 5B77A 2KWKA 2M3HA 2KREA 3T6RA 1Z60A 2VJFA 2C2VS 2CT2A 4BBQA 4YAXA 3ZPV1 4L58A 2M1RA 2HDPA 2EGPA 2LGLA 2JMIA 3QZVA 1JM7B 3ZNIA 4I7CA 4CA1A 4PPEA 4A49A 2LGKA 3KV6A 4QF3A 3N9QA 4FK5A 2LN0A 2D8SA 4YBSA 5B8DA 1WEWA 3U5OA 4ZUXU 1BORA 4NN2A 2K16A 1N87A 1IYMA 5H1UA 2AN6A 2FUUA 5G0FA 3PHDA 4FO9A 1X4JA 2KGGA 2KU3A 3M99A 5FEYA 2K17A 2ZETC 2NAAA 1WGMA 4C9ZA 1ZBDB 3FL2A 3PUQA 2F6JA 5AITA 2VPGA 2G45A 2VJFB 4LADB 5TABA 2FSAA 2Y1MA 2H0DB 2MNYA 2YHNA 4W4UA 1VFYA 1Z6UA 2M6MA 3MHSA 2YU4A 3LRQA 4LJNA 1WE9A 5JG6A 2KWJA 2L5UA 3ZVZB 3LQHA 2M85A 2CKLA 4I7BA 3RPGB 3C6WA 4CCGX 1WEEA 4FJCA 4A4BA 3N9LA 5LCWB 4AYCA 4YBMA 2K4DA 5D1KB 4WZ0A 1VYXA 4TKPB 2YHOA 4S3OC 1LDJB 4R8PK 4ZQLA 3O35A 2MA6A 2VPEA 2ECTA 3LQJA 4UP0A 3SOXA 3ASLA 1MM2A 1MM3A 4XI1A 2KE1A 2KWNA 2XB1A 3HCTA 5FB1A 2VJEA 1RMDA 1WEMA 2IDAA 4R2YA 2CKLB 2LGGA 3O37A 5B75A 4GNEA 2QIZA 5LKTA 2KR4A 4AYCB 3M62A 2VPDA 3ZVYA 3ZPVE 2LQ6A 2E6RA 2C2LA 2L43A 3GV4A 2MT5A 3SOWA 5DKAA 2F6NA 2PNXA 1XWHA 2QJ0A 4UI9B 1WESA 5I3LA 1WEVA 4R7EA 3DQVR 2KFTA 1CHCA 3O33A 1T1HA 2QICA 3N9PA 3U5NA 2OXQC 1VD4A 2MIQA 3O36A 2MD8C 4LKAA 2MA5A 3I2DA 2ECIA 2VJEB 1JOCA 3O7AA 3N9NA 2MD7B 2G6QA 3O70A 4GNDA 5KH3A 2PUYA 3EB6A 4IC3A 1HYIA 5LKXA 5KH7A 2YQMA 2VNFA 4O64A 4A0CD 2YREA 2YSMA 4PTBA 2YUCA 4LLBA 4GB0A 1X4UA 2FUIA 2BAYA 3IHPA 3C5KA 2LDRA 3KQIA 3N9OA 4L7XA 3RPGC 5TDRA 3L11A 3N9MA 5B78A 3HTKC 3KNVA 3EB5A 2ECWA 5H1TA 2K1JA 5B76A 4I7DA 1WFKA 5EYAF 2JMDA 2LXHC 4BHWA 2ECJA 2XEUA 4WZ2A 5DINA 4V3KC 3VK6A 2LV9A 5FERA 2Y43A 1K2FA 1HYJA 2KIZA 3GL6A 4WA6A 2LXPC 5TDWA 4AVXA 5H1VA 2RSDA 3HCUA 2L75A 3NG2A 4X3GA 2I50A 4GNFA 4AP4A 2JMJA 2F42A 2H0DA 4GNGA 5G04B 3ZTGA 2G43A 2YURA 5G05B 1WENA 2EA6A 1G25A 1WEPA 4Q6FA 2YQLA 5TRBA 3LQIA 1WIMA 2CSZA 2LRIC 3L1ZB 2DX8A 3ZYQA 2Y1NA 5D1MB 2L80A 4YBTA 5LKUA 2YYRA 2ECNA 5H9MA 1WEUA 1V87A 4A4CA 1Z2QA 4B86C 2VP7A 5C13A 1DVPA 4UP5A 3V43A 1F62A 3SHBA 5B79A
chains in the Genus database with same CATH superfamily
2JRJA 2MUMA 3U5PA 4IC2A 1FBVA 2E6SA 1WEQA 2JM3A 4AUQB 1X4IA 2KGIA 4LK9A 3FM8C 3PURA 4B7YC 2MNZA 2YSJA 2DJAA 4QQ4A 4FIPA 3T7LA 3FAOA 3DPLR 2M13A 2LGVA 2HYED 1E4UA 5D1LB 5KH9A 5TBNA 2EODA 2YW8A 4YABA 1JM7A 2B0OE 2CSYA 2FD4A 3MHHA 1LDKC 2CRWA 2KWOA 4S3OB 4MSXA 5FB0A 3L1XA 4N3WA 3LDYA 2KYUA 4V3LC 1FP0A 2JUNA 4ZDTA 3JUEA 5LKZA 2VPBA 3O34A 2MKEA 5SVIA 1WEOA 3LVRE 3DDTA 3U5MA 4P5OB 3SOUA 2ECGA 2RI7A 5J3XA 1WILA 3RTRB 4WZ3B 3HCSA 1U6GB 4MVTA 2L0BA 4YADA 3O47A 5C11A 4N4FA 3FJUB 4YATA 3KV5A 4YC9A 3FANA 3M63A 3PLWA 2ECVA 4F52B 3H7HA 4QF2A 2UZGA 2YT5A 2LAUA 5AIUA 5B77A 2KWKA 2M3HA 2KREA 3T6RA 1Z60A 2VJFA 2C2VS 2XP0A 2CT2A 4BBQA 4YAXA 3ZPV1 1DCQA 4L58A 3KDEC 2M1RA 2HDPA 2EGPA 2LGLA 2JMIA 3QZVA 1JM7B 3ZNIA 4I7CA 4CA1A 4PPEA 4A49A 2LGKA 3KV6A 4QF3A 3N9QA 4FK5A 2LN0A 2D8SA 4YBSA 5B8DA 2P57A 1WEWA 3U5OA 5SVIB 4ZUXU 1BORA 4NN2A 2K16A 1N87A 2EXUA 1IYMA 5H1UA 2AN6A 2FUUA 5G0FA 3PHDA 4FO9A 1X4JA 2KGGA 2KU3A 3M99A 2IQJA 5FEYA 5SVXA 2K17A 2ZETC 2NAAA 1WGMA 4C9ZA 1ZBDB 3FL2A 3PUQA 5SVYA 2KKYA 2F6JA 5AITA 2VPGA 2G45A 2VJFB 4LADB 5TABA 2FSAA 2Y1MA 2H0DB 2MNYA 2YHNA 4W4UA 1VFYA 1Z6UA 2M6MA 3MHSA 2YU4A 3LRQA 4LJNA 1WE9A 5JG6A 2KWJA 2DSMA 2L5UA 3ZVZB 3LQHA 2M85A 2CKLA 4I7BA 3RPGB 3C6WA 2YVRA 4CCGX 1WEEA 4FJCA 4A4BA 3N9LA 5LCWB 4AYCA 4YBMA 2K4DA 5D1KB 4WZ0A 1VYXA 4TKPB 2YHOA 4S3OC 1LDJB 1MBMA 4R8PK 4ZQLA 3O35A 2MA6A 2OWAA 2L7PA 2VPEA 3Q1DA 2ECTA 3LQJA 4UP0A 3SOXA 3ASLA 1MM2A 1MM3A 4XI1A 2KE1A 2KWNA 2XB1A 3HCTA 4Z0OA 5FB1A 2VJEA 1RMDA 1WEMA 2IDAA 2CRRA 4R2YA 2CKLB 2LGGA 3O37A 3M7KA 5B75A 4GNEA 2QIZA 5LKTA 2KR4A 4AYCB 3M62A 4F1PA 2VPDA 3ZVYA 3ZPVE 2LQ6A 2E6RA 2C2LA 2L43A 3GV4A 2FFWA 2MT5A 3SOWA 5DKAA 2F6NA 2PNXA 1XWHA 2QJ0A 2D8UA 4UI9B 1WESA 5I3LA 1WEVA 4R7EA 3DQVR 2KFTA 1CHCA 3O33A 1T1HA 2QICA 3N9PA 3U5NA 2OXQC 1VD4A 4OGCA 2MIQA 3O36A 2MD8C 4LKAA 3MDBC 2MA5A 3I2DA 2ECIA 2VJEB 1JOCA 3O7AA 3N9NA 2MD7B 2CONA 2G6QA 3O70A 4GNDA 5KH3A 2PUYA 3EB6A 4IC3A 2RR4A 5LKXA 1HYIA 5KH7A 3DWDA 2YQMA 2VNFA 2XOYA 4O64A 4A0CD 2YREA 2YSMA 4PTBA 2YUCA 4LLBA 4GB0A 1X4UA 2FUIA 2BAYA 3IHPA 3C5KA 2LDRA 3KQIA 3N9OA 4L7XA 3RPGC 5TDRA 2CSVA 3L11A 3N9MA 5B78A 3HTKC 3KNVA 5K3QA 2E61A 3EB5A 2ECWA 5H1TA 2K1JA 2KKXA 5B76A 2XOCA 4I7DA 1WFKA 3SUBA 4OGEA 5EYAF 2JMDA 2LXHC 3T9KA 2ECJA 4BHWA 2XEUA 4WZ2A 5DINA 4V3KC 3VK6A 2LV9A 5FERA 2Y43A 1K2FA 1HYJA 2KIZA 3GL6A 3LJUX 4WA6A 2LXPC 5TDWA 4AVXA 5H1VA 2RSDA 3HCUA 2L75A 3NG2A 4X3GA 2I50A 4GNFA 4AP4A 2JMJA 2F42A 2H0DA 4GNGA 5G04B 3ZTGA 2G43A 2YURA 4O62A 5G05B 1WENA 2EA6A 1G25A 1WEPA 4Q6FA 2YQLA 5TRBA 3LQIA 1WIMA 2CSZA 2LRIC 3FEHA 3L1ZB 2DX8A 3ZYQA 3E2DA 2Y1NA 5D1MB 2L80A 4YBTA 4H9DA 5LKUA 2YYRA 2ECNA 5H9MA 1WEUA 1V87A 4A4CA 4Z0RA 1Z2QA 2XOZA 4B86C 2VP7A 5C13A 3LVQE 1DVPA 4UP5A 3V43A 1F62A 2EGMA 3SHBA 5B79A
chains in the Genus database with same CATH topology
2JRJA 2MUMA 3U5PA 4IC2A 1FBVA 2E6SA 1WEQA 4AUQB 1X4IA 2KGIA 4LK9A 4B7YC 3PURA 2MNZA 2YSJA 4FIPA 3T7LA 3DPLR 2LGVA 2HYED 1E4UA 5D1LB 5KH9A 5TBNA 2EODA 2YW8A 4YABA 1JM7A 2CSYA 3MHHA 1LDKC 2KWOA 4S3OB 4MSXA 5FB0A 3L1XA 4N3WA 2KYUA 4V3LC 1FP0A 4ZDTA 5LKZA 2VPBA 3O34A 1WEOA 3U5MA 4P5OB 3SOUA 3RTRB 2ECGA 2RI7A 1WILA 5J3XA 4WZ3B 3HCSA 1U6GB 4MVTA 2L0BA 4YADA 5C11A 4N4FA 4YATA 3KV5A 4YC9A 3M63A 2ECVA 4F52B 4QF2A 2UZGA 2YT5A 5AIUA 5B77A 2KWKA 2M3HA 2KREA 3T6RA 1Z60A 2VJFA 2C2VS 2CT2A 4BBQA 4YAXA 3ZPV1 4L58A 2M1RA 2HDPA 2EGPA 2LGLA 2JMIA 3QZVA 1JM7B 3ZNIA 4I7CA 4CA1A 4PPEA 4A49A 2LGKA 3KV6A 4QF3A 3N9QA 4FK5A 2LN0A 2D8SA 4YBSA 5B8DA 1WEWA 3U5OA 4ZUXU 1BORA 4NN2A 2K16A 1N87A 1IYMA 5H1UA 2AN6A 2FUUA 5G0FA 3PHDA 4FO9A 1X4JA 2KGGA 2KU3A 3M99A 5FEYA 2K17A 2ZETC 2NAAA 1WGMA 4C9ZA 1ZBDB 3FL2A 3PUQA 2F6JA 5AITA 2VPGA 2G45A 2VJFB 4LADB 5TABA 2FSAA 2Y1MA 2H0DB 2MNYA 2YHNA 4W4UA 1VFYA 1Z6UA 2M6MA 3MHSA 2YU4A 3LRQA 4LJNA 1WE9A 5JG6A 2KWJA 2L5UA 3ZVZB 3LQHA 2M85A 2CKLA 4I7BA 3RPGB 3C6WA 4CCGX 1WEEA 4FJCA 4A4BA 3N9LA 5LCWB 4AYCA 4YBMA 2K4DA 5D1KB 4WZ0A 1VYXA 4TKPB 2YHOA 4S3OC 1LDJB 4R8PK 4ZQLA 3O35A 2MA6A 2VPEA 2ECTA 3LQJA 4UP0A 3SOXA 3ASLA 1MM2A 1MM3A 4XI1A 2KE1A 2KWNA 2XB1A 3HCTA 5FB1A 2VJEA 1RMDA 1WEMA 2IDAA 4R2YA 2CKLB 2LGGA 3O37A 5B75A 4GNEA 2QIZA 5LKTA 2KR4A 4AYCB 3M62A 2VPDA 3ZVYA 3ZPVE 2LQ6A 2E6RA 2C2LA 2L43A 3GV4A 2MT5A 3SOWA 5DKAA 2F6NA 2PNXA 1XWHA 2QJ0A 4UI9B 1WESA 5I3LA 1WEVA 4R7EA 3DQVR 2KFTA 1CHCA 3O33A 1T1HA 2QICA 3N9PA 3U5NA 2OXQC 1VD4A 2MIQA 3O36A 2MD8C 4LKAA 2MA5A 3I2DA 2ECIA 2VJEB 1JOCA 3O7AA 3N9NA 2MD7B 2G6QA 3O70A 4GNDA 5KH3A 2PUYA 3EB6A 4IC3A 1HYIA 5LKXA 5KH7A 2YQMA 2VNFA 4O64A 4A0CD 2YREA 2YSMA 4PTBA 2YUCA 4LLBA 4GB0A 1X4UA 2FUIA 2BAYA 3IHPA 3C5KA 2LDRA 3KQIA 3N9OA 4L7XA 3RPGC 5TDRA 3L11A 3N9MA 5B78A 3HTKC 3KNVA 3EB5A 2ECWA 5H1TA 2K1JA 5B76A 4I7DA 1WFKA 5EYAF 2JMDA 2LXHC 4BHWA 2ECJA 2XEUA 4WZ2A 5DINA 4V3KC 3VK6A 2LV9A 5FERA 2Y43A 1K2FA 1HYJA 2KIZA 3GL6A 4WA6A 2LXPC 5TDWA 4AVXA 5H1VA 2RSDA 3HCUA 2L75A 3NG2A 4X3GA 2I50A 4GNFA 4AP4A 2JMJA 2F42A 2H0DA 4GNGA 5G04B 3ZTGA 2G43A 2YURA 5G05B 1WENA 2EA6A 1G25A 1WEPA 4Q6FA 2YQLA 5TRBA 3LQIA 1WIMA 2CSZA 2LRIC 3L1ZB 2DX8A 3ZYQA 2Y1NA 5D1MB 2L80A 4YBTA 5LKUA 2YYRA 2ECNA 5H9MA 1WEUA 1V87A 4A4CA 1Z2QA 4B86C 2VP7A 5C13A 1DVPA 4UP5A 3V43A 1F62A 3SHBA 5B79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRJ A;  2MUM A;  3U5P A;  4IC2 A;  1FBV A;  2E6S A;  1WEQ A;  4AUQ B;  1X4I A;  2KGI A;  4LK9 A;  4B7Y C;  3PUR A;  2MNZ A;  2YSJ A;  4FIP A;  3T7L A;  3DPL R;  2LGV A;  2HYE D;  1E4U A;  5D1L B;  5KH9 A;  5TBN A;  2EOD A;  2YW8 A;  4YAB A;  1JM7 A;  2CSY A;  3MHH A;  1LDK C;  2KWO A;  4S3O B;  4MSX A;  5FB0 A;  3L1X A;  4N3W A;  2KYU A;  4V3L C;  1FP0 A;  4ZDT A;  5LKZ A;  2VPB A;  3O34 A;  1WEO A;  3U5M A;  4P5O B;  3SOU A;  3RTR B;  2ECG A;  2RI7 A;  1WIL A;  5J3X A;  4WZ3 B;  3HCS A;  1U6G B;  4MVT A;  2L0B A;  4YAD A;  5C11 A;  4N4F A;  4YAT A;  3KV5 A;  4YC9 A;  3M63 A;  2ECV A;  4F52 B;  4QF2 A;  2UZG A;  2YT5 A;  5AIU A;  5B77 A;  2KWK A;  2M3H A;  2KRE A;  3T6R A;  1Z60 A;  2VJF A;  2C2V S;  2CT2 A;  4BBQ A;  4YAX A;  3ZPV 1;  4L58 A;  2M1R A;  2HDP A;  2EGP A;  2LGL A;  2JMI A;  3QZV A;  1JM7 B;  3ZNI A;  4I7C A;  4CA1 A;  4PPE A;  4A49 A;  2LGK A;  3KV6 A;  4QF3 A;  3N9Q A;  4FK5 A;  2LN0 A;  2D8S A;  4YBS A;  5B8D A;  1WEW A;  3U5O A;  4ZUX U;  1BOR A;  4NN2 A;  2K16 A;  1N87 A;  1IYM A;  5H1U A;  2AN6 A;  2FUU A;  5G0F A;  3PHD A;  4FO9 A;  1X4J A;  2KGG A;  2KU3 A;  3M99 A;  5FEY A;  2K17 A;  2ZET C;  2NAA A;  1WGM A;  4C9Z A;  1ZBD B;  3FL2 A;  3PUQ A;  2F6J A;  5AIT A;  2VPG A;  2G45 A;  2VJF B;  4LAD B;  5TAB A;  2FSA A;  2Y1M A;  2H0D B;  2MNY A;  2YHN A;  4W4U A;  1VFY A;  1Z6U A;  2M6M A;  3MHS A;  2YU4 A;  3LRQ A;  4LJN A;  1WE9 A;  5JG6 A;  2KWJ A;  2L5U A;  3ZVZ B;  3LQH A;  2M85 A;  2CKL A;  4I7B A;  3RPG B;  3C6W A;  4CCG X;  1WEE A;  4FJC A;  4A4B A;  3N9L A;  5LCW B;  4AYC A;  4YBM A;  2K4D A;  5D1K B;  4WZ0 A;  1VYX A;  4TKP B;  2YHO A;  4S3O C;  1LDJ B;  4R8P K;  4ZQL A;  3O35 A;  2MA6 A;  2VPE A;  2ECT A;  3LQJ A;  4UP0 A;  3SOX A;  3ASL A;  1MM2 A;  1MM3 A;  4XI1 A;  2KE1 A;  2KWN A;  2XB1 A;  3HCT A;  5FB1 A;  2VJE A;  1RMD A;  1WEM A;  2IDA A;  4R2Y A;  2CKL B;  2LGG A;  3O37 A;  5B75 A;  4GNE A;  2QIZ A;  5LKT A;  2KR4 A;  4AYC B;  3M62 A;  2VPD A;  3ZVY A;  3ZPV E;  2LQ6 A;  2E6R A;  2C2L A;  2L43 A;  3GV4 A;  2MT5 A;  3SOW A;  5DKA A;  2F6N A;  2PNX A;  1XWH A;  2QJ0 A;  4UI9 B;  1WES A;  5I3L A;  1WEV A;  4R7E A;  3DQV R;  2KFT A;  1CHC A;  3O33 A;  1T1H A;  2QIC A;  3N9P A;  3U5N A;  2OXQ C;  1VD4 A;  2MIQ A;  3O36 A;  2MD8 C;  4LKA A;  2MA5 A;  3I2D A;  2ECI A;  2VJE B;  1JOC A;  3O7A A;  3N9N A;  2MD7 B;  2G6Q A;  3O70 A;  4GND A;  5KH3 A;  2PUY A;  3EB6 A;  4IC3 A;  1HYI A;  5LKX A;  5KH7 A;  2YQM A;  2VNF A;  4O64 A;  4A0C D;  2YRE A;  2YSM A;  4PTB A;  2YUC A;  4LLB A;  4GB0 A;  1X4U A;  2FUI A;  2BAY A;  3IHP A;  3C5K A;  2LDR A;  3KQI A;  3N9O A;  4L7X A;  3RPG C;  5TDR A;  3L11 A;  3N9M A;  5B78 A;  3HTK C;  3KNV A;  3EB5 A;  2ECW A;  5H1T A;  2K1J A;  5B76 A;  4I7D A;  1WFK A;  5EYA F;  2JMD A;  2LXH C;  4BHW A;  2ECJ A;  2XEU A;  4WZ2 A;  5DIN A;  4V3K C;  3VK6 A;  2LV9 A;  5FER A;  2Y43 A;  1K2F A;  1HYJ A;  2KIZ A;  3GL6 A;  4WA6 A;  2LXP C;  5TDW A;  4AVX A;  5H1V A;  2RSD A;  3HCU A;  2L75 A;  3NG2 A;  4X3G A;  2I50 A;  4GNF A;  4AP4 A;  2JMJ A;  2F42 A;  2H0D A;  4GNG A;  5G04 B;  3ZTG A;  2G43 A;  2YUR A;  5G05 B;  1WEN A;  2EA6 A;  1G25 A;  1WEP A;  4Q6F A;  2YQL A;  5TRB A;  3LQI A;  1WIM A;  2CSZ A;  2LRI C;  3L1Z B;  2DX8 A;  3ZYQ A;  2Y1N A;  5D1M B;  2L80 A;  4YBT A;  5LKU A;  2YYR A;  2ECN A;  5H9M A;  1WEU A;  1V87 A;  4A4C A;  1Z2Q A;  4B86 C;  2VP7 A;  5C13 A;  1DVP A;  4UP5 A;  3V43 A;  1F62 A;  3SHB A;  5B79 A; 
#chains in the Genus database with same CATH topology
 2JRJ A;  2MUM A;  3U5P A;  4IC2 A;  1FBV A;  2E6S A;  1WEQ A;  2JM3 A;  4AUQ B;  1X4I A;  2KGI A;  4LK9 A;  3FM8 C;  3PUR A;  4B7Y C;  2MNZ A;  2YSJ A;  2DJA A;  4QQ4 A;  4FIP A;  3T7L A;  3FAO A;  3DPL R;  2M13 A;  2LGV A;  2HYE D;  1E4U A;  5D1L B;  5KH9 A;  5TBN A;  2EOD A;  2YW8 A;  4YAB A;  1JM7 A;  2B0O E;  2CSY A;  2FD4 A;  3MHH A;  1LDK C;  2CRW A;  2KWO A;  4S3O B;  4MSX A;  5FB0 A;  3L1X A;  4N3W A;  3LDY A;  2KYU A;  4V3L C;  1FP0 A;  2JUN A;  4ZDT A;  3JUE A;  5LKZ A;  2VPB A;  3O34 A;  2MKE A;  5SVI A;  1WEO A;  3LVR E;  3DDT A;  3U5M A;  4P5O B;  3SOU A;  2ECG A;  2RI7 A;  5J3X A;  1WIL A;  3RTR B;  4WZ3 B;  3HCS A;  1U6G B;  4MVT A;  2L0B A;  4YAD A;  3O47 A;  5C11 A;  4N4F A;  3FJU B;  4YAT A;  3KV5 A;  4YC9 A;  3FAN A;  3M63 A;  3PLW A;  2ECV A;  4F52 B;  3H7H A;  4QF2 A;  2UZG A;  2YT5 A;  2LAU A;  5AIU A;  5B77 A;  2KWK A;  2M3H A;  2KRE A;  3T6R A;  1Z60 A;  2VJF A;  2C2V S;  2XP0 A;  2CT2 A;  4BBQ A;  4YAX A;  3ZPV 1;  1DCQ A;  4L58 A;  3KDE C;  2M1R A;  2HDP A;  2EGP A;  2LGL A;  2JMI A;  3QZV A;  1JM7 B;  3ZNI A;  4I7C A;  4CA1 A;  4PPE A;  4A49 A;  2LGK A;  3KV6 A;  4QF3 A;  3N9Q A;  4FK5 A;  2LN0 A;  2D8S A;  4YBS A;  5B8D A;  2P57 A;  1WEW A;  3U5O A;  5SVI B;  4ZUX U;  1BOR A;  4NN2 A;  2K16 A;  1N87 A;  2EXU A;  1IYM A;  5H1U A;  2AN6 A;  2FUU A;  5G0F A;  3PHD A;  4FO9 A;  1X4J A;  2KGG A;  2KU3 A;  3M99 A;  2IQJ A;  5FEY A;  5SVX A;  2K17 A;  2ZET C;  2NAA A;  1WGM A;  4C9Z A;  1ZBD B;  3FL2 A;  3PUQ A;  5SVY A;  2KKY A;  2F6J A;  5AIT A;  2VPG A;  2G45 A;  2VJF B;  4LAD B;  5TAB A;  2FSA A;  2Y1M A;  2H0D B;  2MNY A;  2YHN A;  4W4U A;  1VFY A;  1Z6U A;  2M6M A;  3MHS A;  2YU4 A;  3LRQ A;  4LJN A;  1WE9 A;  5JG6 A;  2KWJ A;  2DSM A;  2L5U A;  3ZVZ B;  3LQH A;  2M85 A;  2CKL A;  4I7B A;  3RPG B;  3C6W A;  2YVR A;  4CCG X;  1WEE A;  4FJC A;  4A4B A;  3N9L A;  5LCW B;  4AYC A;  4YBM A;  2K4D A;  5D1K B;  4WZ0 A;  1VYX A;  4TKP B;  2YHO A;  4S3O C;  1LDJ B;  1MBM A;  4R8P K;  4ZQL A;  3O35 A;  2MA6 A;  2OWA A;  2L7P A;  2VPE A;  3Q1D A;  2ECT A;  3LQJ A;  4UP0 A;  3SOX A;  3ASL A;  1MM2 A;  1MM3 A;  4XI1 A;  2KE1 A;  2KWN A;  2XB1 A;  3HCT A;  4Z0O A;  5FB1 A;  2VJE A;  1RMD A;  1WEM A;  2IDA A;  2CRR A;  4R2Y A;  2CKL B;  2LGG A;  3O37 A;  3M7K A;  5B75 A;  4GNE A;  2QIZ A;  5LKT A;  2KR4 A;  4AYC B;  3M62 A;  4F1P A;  2VPD A;  3ZVY A;  3ZPV E;  2LQ6 A;  2E6R A;  2C2L A;  2L43 A;  3GV4 A;  2FFW A;  2MT5 A;  3SOW A;  5DKA A;  2F6N A;  2PNX A;  1XWH A;  2QJ0 A;  2D8U A;  4UI9 B;  1WES A;  5I3L A;  1WEV A;  4R7E A;  3DQV R;  2KFT A;  1CHC A;  3O33 A;  1T1H A;  2QIC A;  3N9P A;  3U5N A;  2OXQ C;  1VD4 A;  4OGC A;  2MIQ A;  3O36 A;  2MD8 C;  4LKA A;  3MDB C;  2MA5 A;  3I2D A;  2ECI A;  2VJE B;  1JOC A;  3O7A A;  3N9N A;  2MD7 B;  2CON A;  2G6Q A;  3O70 A;  4GND A;  5KH3 A;  2PUY A;  3EB6 A;  4IC3 A;  2RR4 A;  5LKX A;  1HYI A;  5KH7 A;  3DWD A;  2YQM A;  2VNF A;  2XOY A;  4O64 A;  4A0C D;  2YRE A;  2YSM A;  4PTB A;  2YUC A;  4LLB A;  4GB0 A;  1X4U A;  2FUI A;  2BAY A;  3IHP A;  3C5K A;  2LDR A;  3KQI A;  3N9O A;  4L7X A;  3RPG C;  5TDR A;  2CSV A;  3L11 A;  3N9M A;  5B78 A;  3HTK C;  3KNV A;  5K3Q A;  2E61 A;  3EB5 A;  2ECW A;  5H1T A;  2K1J A;  2KKX A;  5B76 A;  2XOC A;  4I7D A;  1WFK A;  3SUB A;  4OGE A;  5EYA F;  2JMD A;  2LXH C;  3T9K A;  2ECJ A;  4BHW A;  2XEU A;  4WZ2 A;  5DIN A;  4V3K C;  3VK6 A;  2LV9 A;  5FER A;  2Y43 A;  1K2F A;  1HYJ A;  2KIZ A;  3GL6 A;  3LJU X;  4WA6 A;  2LXP C;  5TDW A;  4AVX A;  5H1V A;  2RSD A;  3HCU A;  2L75 A;  3NG2 A;  4X3G A;  2I50 A;  4GNF A;  4AP4 A;  2JMJ A;  2F42 A;  2H0D A;  4GNG A;  5G04 B;  3ZTG A;  2G43 A;  2YUR A;  4O62 A;  5G05 B;  1WEN A;  2EA6 A;  1G25 A;  1WEP A;  4Q6F A;  2YQL A;  5TRB A;  3LQI A;  1WIM A;  2CSZ A;  2LRI C;  3FEH A;  3L1Z B;  2DX8 A;  3ZYQ A;  3E2D A;  2Y1N A;  5D1M B;  2L80 A;  4YBT A;  4H9D A;  5LKU A;  2YYR A;  2ECN A;  5H9M A;  1WEU A;  1V87 A;  4A4C A;  4Z0R A;  1Z2Q A;  2XOZ A;  4B86 C;  2VP7 A;  5C13 A;  3LVQ E;  1DVP A;  4UP5 A;  3V43 A;  1F62 A;  2EGM A;  3SHB A;  5B79 A; 
#chains in the Genus database with same CATH homology
 2JRJ A;  2MUM A;  3U5P A;  4IC2 A;  1FBV A;  2E6S A;  1WEQ A;  4AUQ B;  1X4I A;  2KGI A;  4LK9 A;  4B7Y C;  3PUR A;  2MNZ A;  2YSJ A;  4FIP A;  3T7L A;  3DPL R;  2LGV A;  2HYE D;  1E4U A;  5D1L B;  5KH9 A;  5TBN A;  2EOD A;  2YW8 A;  4YAB A;  1JM7 A;  2CSY A;  3MHH A;  1LDK C;  2KWO A;  4S3O B;  4MSX A;  5FB0 A;  3L1X A;  4N3W A;  2KYU A;  4V3L C;  1FP0 A;  4ZDT A;  5LKZ A;  2VPB A;  3O34 A;  1WEO A;  3U5M A;  4P5O B;  3SOU A;  3RTR B;  2ECG A;  2RI7 A;  1WIL A;  5J3X A;  4WZ3 B;  3HCS A;  1U6G B;  4MVT A;  2L0B A;  4YAD A;  5C11 A;  4N4F A;  4YAT A;  3KV5 A;  4YC9 A;  3M63 A;  2ECV A;  4F52 B;  4QF2 A;  2UZG A;  2YT5 A;  5AIU A;  5B77 A;  2KWK A;  2M3H A;  2KRE A;  3T6R A;  1Z60 A;  2VJF A;  2C2V S;  2CT2 A;  4BBQ A;  4YAX A;  3ZPV 1;  4L58 A;  2M1R A;  2HDP A;  2EGP A;  2LGL A;  2JMI A;  3QZV A;  1JM7 B;  3ZNI A;  4I7C A;  4CA1 A;  4PPE A;  4A49 A;  2LGK A;  3KV6 A;  4QF3 A;  3N9Q A;  4FK5 A;  2LN0 A;  2D8S A;  4YBS A;  5B8D A;  1WEW A;  3U5O A;  4ZUX U;  1BOR A;  4NN2 A;  2K16 A;  1N87 A;  1IYM A;  5H1U A;  2AN6 A;  2FUU A;  5G0F A;  3PHD A;  4FO9 A;  1X4J A;  2KGG A;  2KU3 A;  3M99 A;  5FEY A;  2K17 A;  2ZET C;  2NAA A;  1WGM A;  4C9Z A;  1ZBD B;  3FL2 A;  3PUQ A;  2F6J A;  5AIT A;  2VPG A;  2G45 A;  2VJF B;  4LAD B;  5TAB A;  2FSA A;  2Y1M A;  2H0D B;  2MNY A;  2YHN A;  4W4U A;  1VFY A;  1Z6U A;  2M6M A;  3MHS A;  2YU4 A;  3LRQ A;  4LJN A;  1WE9 A;  5JG6 A;  2KWJ A;  2L5U A;  3ZVZ B;  3LQH A;  2M85 A;  2CKL A;  4I7B A;  3RPG B;  3C6W A;  4CCG X;  1WEE A;  4FJC A;  4A4B A;  3N9L A;  5LCW B;  4AYC A;  4YBM A;  2K4D A;  5D1K B;  4WZ0 A;  1VYX A;  4TKP B;  2YHO A;  4S3O C;  1LDJ B;  4R8P K;  4ZQL A;  3O35 A;  2MA6 A;  2VPE A;  2ECT A;  3LQJ A;  4UP0 A;  3SOX A;  3ASL A;  1MM2 A;  1MM3 A;  4XI1 A;  2KE1 A;  2KWN A;  2XB1 A;  3HCT A;  5FB1 A;  2VJE A;  1RMD A;  1WEM A;  2IDA A;  4R2Y A;  2CKL B;  2LGG A;  3O37 A;  5B75 A;  4GNE A;  2QIZ A;  5LKT A;  2KR4 A;  4AYC B;  3M62 A;  2VPD A;  3ZVY A;  3ZPV E;  2LQ6 A;  2E6R A;  2C2L A;  2L43 A;  3GV4 A;  2MT5 A;  3SOW A;  5DKA A;  2F6N A;  2PNX A;  1XWH A;  2QJ0 A;  4UI9 B;  1WES A;  5I3L A;  1WEV A;  4R7E A;  3DQV R;  2KFT A;  1CHC A;  3O33 A;  1T1H A;  2QIC A;  3N9P A;  3U5N A;  2OXQ C;  1VD4 A;  2MIQ A;  3O36 A;  2MD8 C;  4LKA A;  2MA5 A;  3I2D A;  2ECI A;  2VJE B;  1JOC A;  3O7A A;  3N9N A;  2MD7 B;  2G6Q A;  3O70 A;  4GND A;  5KH3 A;  2PUY A;  3EB6 A;  4IC3 A;  1HYI A;  5LKX A;  5KH7 A;  2YQM A;  2VNF A;  4O64 A;  4A0C D;  2YRE A;  2YSM A;  4PTB A;  2YUC A;  4LLB A;  4GB0 A;  1X4U A;  2FUI A;  2BAY A;  3IHP A;  3C5K A;  2LDR A;  3KQI A;  3N9O A;  4L7X A;  3RPG C;  5TDR A;  3L11 A;  3N9M A;  5B78 A;  3HTK C;  3KNV A;  3EB5 A;  2ECW A;  5H1T A;  2K1J A;  5B76 A;  4I7D A;  1WFK A;  5EYA F;  2JMD A;  2LXH C;  4BHW A;  2ECJ A;  2XEU A;  4WZ2 A;  5DIN A;  4V3K C;  3VK6 A;  2LV9 A;  5FER A;  2Y43 A;  1K2F A;  1HYJ A;  2KIZ A;  3GL6 A;  4WA6 A;  2LXP C;  5TDW A;  4AVX A;  5H1V A;  2RSD A;  3HCU A;  2L75 A;  3NG2 A;  4X3G A;  2I50 A;  4GNF A;  4AP4 A;  2JMJ A;  2F42 A;  2H0D A;  4GNG A;  5G04 B;  3ZTG A;  2G43 A;  2YUR A;  5G05 B;  1WEN A;  2EA6 A;  1G25 A;  1WEP A;  4Q6F A;  2YQL A;  5TRB A;  3LQI A;  1WIM A;  2CSZ A;  2LRI C;  3L1Z B;  2DX8 A;  3ZYQ A;  2Y1N A;  5D1M B;  2L80 A;  4YBT A;  5LKU A;  2YYR A;  2ECN A;  5H9M A;  1WEU A;  1V87 A;  4A4C A;  1Z2Q A;  4B86 C;  2VP7 A;  5C13 A;  1DVP A;  4UP5 A;  3V43 A;  1F62 A;  3SHB A;  5B79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...