3PHDA

Crystal structure of human hdac6 in complex with ubiquitin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase 6
publication title Protein Aggregates Are Recruited to Aggresome by Histone Deacetylase 6 via Unanchored Ubiquitin C Termini.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3phdA00
4LJNA 1X4IA 1WEEA 3PURA 4C9ZA 4GNEA 2KFTA 2BAYA 4IC3A 3QZVA 1FP0A 2QJ0A 1BORA 2C2LA 2LXPC 5G04B 4AUQB 2QIZA 1K2FA 2ECIA 2KIZA 1U6GB 3M62A 2YUCA 5TDWA 2C2VS 3O33A 2KYUA 4L58A 3O36A 2F6NA 2JRJA 2KGGA 5KH9A 2CT2A 4V3KC 1CHCA 5B79A 2LGVA 2LGLA 3L1ZB 3O7AA 3LRQA 3MHSA 1WILA 4FIPA 1N87A 5D1MB 1HYJA 4IC2A 4FJCA 2KE1A 3N9MA 2KWJA 3N9OA 4YBMA 1IYMA 4TKPB 3O35A 2VPDA 4B86C 1RMDA 4I7BA 2FSAA 1MM3A 2LRIC 3N9NA 2MUMA 2FUIA 4WZ3B 2ECVA 4MSXA 2KWNA 4R7EA 4ZQLA 2MD7B 1WEVA 3MHHA 2L5UA 4F52B 2CKLB 2YHNA 3PHDA 5B78A 3M63A 4CA1A 5FEYA 2YHOA 4R8PK 3LQIA 5B8DA 2KGIA 2YREA 3RPGB 4O64A 2AN6A 2XEUA 3HCSA 2RI7A 1WGMA 4YAXA 3ZYQA 2YQLA 3KV6A 5KH7A 5LKXA 2JMJA 4BBQA 1X4JA 3EB6A 4XI1A 2CSYA 2KWKA 2VJEB 4A49A 2YU4A 2L80A 1JOCA 3GV4A 3LQJA 5B77A 2LQ6A 2YSJA 1V87A 4B7YC 1T1HA 1Z2QA 5TRBA 2VJFB 1WENA 2D8SA 3GL6A 2EGPA 1WEOA 1XWHA 2HDPA 3L1XA 3ASLA 2E6SA 5DKAA 2NAAA 2VJEA 2H0DB 2KU3A 5TDRA 5KH3A 2PNXA 3LQHA 4FK5A 2ECGA 4AYCA 3RTRB 2EA6A 2DX8A 2L0BA 2MT5A 4YC9A 2G45A 2I50A 4S3OC 1DVPA 3KNVA 4FO9A 4R2YA 1X4UA 3O70A 3FL2A 5LCWB 2K17A 4WZ0A 4A4CA 4WA6A 2H0DA 3HTKC 2YW8A 3O34A 4MVTA 1ZBDB 3ZVYA 5FB0A 3U5NA 5J3XA 1MM2A 4Q6FA 4WZ2A 2HYED 2VPGA 2MNZA 3U5PA 3KQIA 3SHBA 1Z60A 2VPEA 2YT5A 4P5OB 2G6QA 3L11A 5D1KB 4QF3A 5LKUA 2K1JA 5TBNA 5LKTA 2YYRA 1VD4A 4A0CD 4NN2A 3SOXA 2KR4A 5C11A 4BHWA 4I7CA 2XB1A 1WEWA 3N9QA 2JMDA 5B76A 3N9PA 2YQMA 1JM7B 5H1VA 3ZTGA 1Z6UA 2CKLA 4QF2A 4LK9A 5H1UA 2VP7A 4LADB 2MNYA 2M1RA 2IDAA 4LKAA 4PPEA 2LGGA 5B75A 2LXHC 4GNDA 2ECNA 4PTBA 3V43A 2OXQC 1HYIA 3M99A 5H1TA 4W4UA 4UI9B 2ECJA 4N4FA 5JG6A 1LDJB 5I3LA 5DINA 1E4UA 5G05B 2ECWA 2MIQA 5G0FA 4YADA 5FB1A 1FBVA 4GNGA 2JMIA 4AVXA 2KWOA 2LN0A 2M85A 3ZVZB 2VPBA 2VJFA 2LDRA 3NG2A 5D1LB 1VFYA 2MD8C 2K4DA 2L75A 3O37A 5C13A 1WEQA 3VK6A 3RPGC 3SOUA 5H9MA 2Y43A 3ZPV1 3IHPA 4UP0A 4LLBA 5AITA 2MA5A 3KV5A 2EODA 3ZPVE 2E6RA 1VYXA 1LDKC 3U5OA 4GB0A 2PUYA 4L7XA 4V3LC 1WEUA 2UZGA 2KREA 4ZUXU 2F42A 3EB5A 3ZNIA 1WE9A 4YBSA 2LV9A 2L43A 2YSMA 1F62A 4YBTA 3DQVR 5TABA 5LKZA 2G43A 4X3GA 2M3HA 2MA6A 2ZETC 4S3OB 3T7LA 2Y1MA 4N3WA 1WFKA 3C5KA 1WESA 3SOWA 4YATA 3N9LA 2CSZA 3HCTA 2Y1NA 3DPLR 1WEMA 4UP5A 5AIUA 3I2DA 4GNFA 3U5MA 4A4BA 2F6JA 3HCUA 2K16A 2QICA 2YURA 3PUQA 5EYAF 2FUUA 1WIMA 3T6RA 2ECTA 4YABA 4CCGX 1JM7A 2LGKA 2VNFA 1G25A 2M6MA 4ZDTA 1WEPA 3C6WA 4AP4A 5FERA 4AYCB 2RSDA 4I7DA
chains in the Genus database with same CATH superfamily
4LJNA 1X4IA 1WEEA 3PURA 4C9ZA 2CONA 4GNEA 2KFTA 2BAYA 3LVQE 2M13A 4IC3A 3QZVA 1FP0A 2QJ0A 1BORA 2C2LA 2LXPC 5G04B 4AUQB 3KDEC 1MBMA 2QIZA 1K2FA 2XOCA 4OGEA 2ECIA 2KIZA 1U6GB 3M62A 2YUCA 5TDWA 2C2VS 2CSVA 3O33A 2KYUA 4L58A 3O36A 2F6NA 2E61A 2JRJA 2KGGA 5KH9A 2CT2A 4V3KC 1CHCA 5B79A 2LGVA 2LGLA 3L1ZB 3O7AA 5SVYA 3LRQA 3MHSA 1WILA 4FIPA 1N87A 3E2DA 5D1MB 1HYJA 4IC2A 4FJCA 2KE1A 3N9MA 2KWJA 3N9OA 3SUBA 2CRWA 4YBMA 1IYMA 4TKPB 3O35A 2VPDA 4B86C 1RMDA 4I7BA 2FSAA 1MM3A 2LRIC 3N9NA 2MUMA 2FUIA 4WZ3B 2ECVA 4MSXA 2KWNA 4R7EA 4ZQLA 2MD7B 1WEVA 3MHHA 2L5UA 4F52B 2CKLB 2D8UA 2YHNA 3PHDA 5B78A 3M63A 4CA1A 3LDYA 3FANA 5FEYA 2YHOA 4R8PK 3LQIA 5B8DA 2KGIA 2YREA 3RPGB 4O64A 2LAUA 3O47A 2AN6A 2XEUA 2DJAA 3HCSA 2RI7A 1WGMA 4YAXA 3ZYQA 2YQLA 3KV6A 5KH7A 5LKXA 2CRRA 2JMJA 4BBQA 1X4JA 3EB6A 4XI1A 2CSYA 2KWKA 2VJEB 3LVRE 4A49A 2YU4A 2L80A 1JOCA 3GV4A 3LQJA 5B77A 2LQ6A 2YSJA 1V87A 4B7YC 1T1HA 1Z2QA 5TRBA 2VJFB 1WENA 2D8SA 3GL6A 2P57A 2EGPA 1WEOA 3DWDA 1XWHA 2HDPA 3L1XA 3ASLA 2E6SA 5DKAA 2NAAA 2VJEA 2H0DB 2KU3A 5TDRA 5KH3A 2PNXA 3LQHA 3T9KA 4FK5A 2ECGA 4AYCA 3RTRB 2EA6A 1DCQA 2DX8A 4QQ4A 2L0BA 5K3QA 2MT5A 4YC9A 2G45A 2I50A 4S3OC 1DVPA 2JM3A 3LJUX 3KNVA 4FO9A 4R2YA 1X4UA 3O70A 3MDBC 3FL2A 3M7KA 5LCWB 2K17A 4WZ0A 4A4CA 4WA6A 2H0DA 3HTKC 2YW8A 3H7HA 3O34A 4MVTA 1ZBDB 3ZVYA 5FB0A 3U5NA 2YVRA 2FFWA 5J3XA 2XOYA 1MM2A 4Q6FA 4WZ2A 2OWAA 2HYED 2VPGA 2MNZA 3U5PA 3KQIA 3SHBA 3JUEA 1Z60A 2VPEA 2YT5A 4P5OB 2G6QA 3L11A 5D1KB 4QF3A 5LKUA 2K1JA 3DDTA 5TBNA 5LKTA 2YYRA 1VD4A 2MKEA 4A0CD 4NN2A 3SOXA 2KR4A 5C11A 4BHWA 4I7CA 2XB1A 1WEWA 3N9QA 2JMDA 5B76A 3N9PA 2YQMA 1JM7B 5H1VA 3ZTGA 2XOZA 1Z6UA 2CKLA 4QF2A 4LK9A 5H1UA 2VP7A 4LADB 2MNYA 2M1RA 2IDAA 4LKAA 5SVIB 3PLWA 2KKYA 4PPEA 2IQJA 2LGGA 4F1PA 5B75A 2LXHC 4GNDA 2ECNA 4PTBA 3V43A 2OXQC 1HYIA 3M99A 5H1TA 4W4UA 4UI9B 2ECJA 4N4FA 5JG6A 1LDJB 5I3LA 5DINA 1E4UA 5G05B 2ECWA 2RR4A 2MIQA 5G0FA 4YADA 5FB1A 1FBVA 3FJUB 4GNGA 2JMIA 4AVXA 2L7PA 2KWOA 2LN0A 2M85A 3ZVZB 2VPBA 2VJFA 2LDRA 3NG2A 5D1LB 1VFYA 2MD8C 4O62A 2EXUA 2K4DA 2KKXA 2L75A 3O37A 5C13A 1WEQA 3VK6A 3RPGC 3FAOA 2DSMA 3Q1DA 2XP0A 3SOUA 5H9MA 2Y43A 3ZPV1 3IHPA 4UP0A 4LLBA 5AITA 2MA5A 3KV5A 2EODA 3ZPVE 2E6RA 1VYXA 1LDKC 3U5OA 4GB0A 2PUYA 4L7XA 4V3LC 1WEUA 2UZGA 2KREA 4ZUXU 2F42A 3EB5A 3ZNIA 1WE9A 4YBSA 2LV9A 4H9DA 2L43A 2YSMA 1F62A 4YBTA 3DQVR 5TABA 5LKZA 2G43A 4X3GA 2M3HA 4Z0RA 2MA6A 2ZETC 4S3OB 3T7LA 2Y1MA 4N3WA 4Z0OA 1WFKA 3C5KA 1WESA 2EGMA 3SOWA 4YATA 3N9LA 2CSZA 3HCTA 2Y1NA 3DPLR 1WEMA 3FEHA 2FD4A 4UP5A 5AIUA 3I2DA 4GNFA 2B0OE 3U5MA 4A4BA 2F6JA 3HCUA 2K16A 2QICA 2YURA 3PUQA 2JUNA 4OGCA 5EYAF 2FUUA 1WIMA 3T6RA 2ECTA 4YABA 4CCGX 1JM7A 2LGKA 2VNFA 3FM8C 1G25A 2M6MA 4ZDTA 1WEPA 3C6WA 4AP4A 5SVXA 5FERA 4AYCB 2RSDA 4I7DA 5SVIA
chains in the Genus database with same CATH topology
4LJNA 1X4IA 1WEEA 3PURA 4C9ZA 4GNEA 2KFTA 2BAYA 4IC3A 3QZVA 1FP0A 2QJ0A 1BORA 2C2LA 2LXPC 5G04B 4AUQB 2QIZA 1K2FA 2ECIA 2KIZA 1U6GB 3M62A 2YUCA 5TDWA 2C2VS 3O33A 2KYUA 4L58A 3O36A 2F6NA 2JRJA 2KGGA 5KH9A 2CT2A 4V3KC 1CHCA 5B79A 2LGVA 2LGLA 3L1ZB 3O7AA 3LRQA 3MHSA 1WILA 4FIPA 1N87A 5D1MB 1HYJA 4IC2A 4FJCA 2KE1A 3N9MA 2KWJA 3N9OA 4YBMA 1IYMA 4TKPB 3O35A 2VPDA 4B86C 1RMDA 4I7BA 2FSAA 1MM3A 2LRIC 3N9NA 2MUMA 2FUIA 4WZ3B 2ECVA 4MSXA 2KWNA 4R7EA 4ZQLA 2MD7B 1WEVA 3MHHA 2L5UA 4F52B 2CKLB 2YHNA 3PHDA 5B78A 3M63A 4CA1A 5FEYA 2YHOA 4R8PK 3LQIA 5B8DA 2KGIA 2YREA 3RPGB 4O64A 2AN6A 2XEUA 3HCSA 2RI7A 1WGMA 4YAXA 3ZYQA 2YQLA 3KV6A 5KH7A 5LKXA 2JMJA 4BBQA 1X4JA 3EB6A 4XI1A 2CSYA 2KWKA 2VJEB 4A49A 2YU4A 2L80A 1JOCA 3GV4A 3LQJA 5B77A 2LQ6A 2YSJA 1V87A 4B7YC 1T1HA 1Z2QA 5TRBA 2VJFB 1WENA 2D8SA 3GL6A 2EGPA 1WEOA 1XWHA 2HDPA 3L1XA 3ASLA 2E6SA 5DKAA 2NAAA 2VJEA 2H0DB 2KU3A 5TDRA 5KH3A 2PNXA 3LQHA 4FK5A 2ECGA 4AYCA 3RTRB 2EA6A 2DX8A 2L0BA 2MT5A 4YC9A 2G45A 2I50A 4S3OC 1DVPA 3KNVA 4FO9A 4R2YA 1X4UA 3O70A 3FL2A 5LCWB 2K17A 4WZ0A 4A4CA 4WA6A 2H0DA 3HTKC 2YW8A 3O34A 4MVTA 1ZBDB 3ZVYA 5FB0A 3U5NA 5J3XA 1MM2A 4Q6FA 4WZ2A 2HYED 2VPGA 2MNZA 3U5PA 3KQIA 3SHBA 1Z60A 2VPEA 2YT5A 4P5OB 2G6QA 3L11A 5D1KB 4QF3A 5LKUA 2K1JA 5TBNA 5LKTA 2YYRA 1VD4A 4A0CD 4NN2A 3SOXA 2KR4A 5C11A 4BHWA 4I7CA 2XB1A 1WEWA 3N9QA 2JMDA 5B76A 3N9PA 2YQMA 1JM7B 5H1VA 3ZTGA 1Z6UA 2CKLA 4QF2A 4LK9A 5H1UA 2VP7A 4LADB 2MNYA 2M1RA 2IDAA 4LKAA 4PPEA 2LGGA 5B75A 2LXHC 4GNDA 2ECNA 4PTBA 3V43A 2OXQC 1HYIA 3M99A 5H1TA 4W4UA 4UI9B 2ECJA 4N4FA 5JG6A 1LDJB 5I3LA 5DINA 1E4UA 5G05B 2ECWA 2MIQA 5G0FA 4YADA 5FB1A 1FBVA 4GNGA 2JMIA 4AVXA 2KWOA 2LN0A 2M85A 3ZVZB 2VPBA 2VJFA 2LDRA 3NG2A 5D1LB 1VFYA 2MD8C 2K4DA 2L75A 3O37A 5C13A 1WEQA 3VK6A 3RPGC 3SOUA 5H9MA 2Y43A 3ZPV1 3IHPA 4UP0A 4LLBA 5AITA 2MA5A 3KV5A 2EODA 3ZPVE 2E6RA 1VYXA 1LDKC 3U5OA 4GB0A 2PUYA 4L7XA 4V3LC 1WEUA 2UZGA 2KREA 4ZUXU 2F42A 3EB5A 3ZNIA 1WE9A 4YBSA 2LV9A 2L43A 2YSMA 1F62A 4YBTA 3DQVR 5TABA 5LKZA 2G43A 4X3GA 2M3HA 2MA6A 2ZETC 4S3OB 3T7LA 2Y1MA 4N3WA 1WFKA 3C5KA 1WESA 3SOWA 4YATA 3N9LA 2CSZA 3HCTA 2Y1NA 3DPLR 1WEMA 4UP5A 5AIUA 3I2DA 4GNFA 3U5MA 4A4BA 2F6JA 3HCUA 2K16A 2QICA 2YURA 3PUQA 5EYAF 2FUUA 1WIMA 3T6RA 2ECTA 4YABA 4CCGX 1JM7A 2LGKA 2VNFA 1G25A 2M6MA 4ZDTA 1WEPA 3C6WA 4AP4A 5FERA 4AYCB 2RSDA 4I7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJN A;  1X4I A;  1WEE A;  3PUR A;  4C9Z A;  4GNE A;  2KFT A;  2BAY A;  4IC3 A;  3QZV A;  1FP0 A;  2QJ0 A;  1BOR A;  2C2L A;  2LXP C;  5G04 B;  4AUQ B;  2QIZ A;  1K2F A;  2ECI A;  2KIZ A;  1U6G B;  3M62 A;  2YUC A;  5TDW A;  2C2V S;  3O33 A;  2KYU A;  4L58 A;  3O36 A;  2F6N A;  2JRJ A;  2KGG A;  5KH9 A;  2CT2 A;  4V3K C;  1CHC A;  5B79 A;  2LGV A;  2LGL A;  3L1Z B;  3O7A A;  3LRQ A;  3MHS A;  1WIL A;  4FIP A;  1N87 A;  5D1M B;  1HYJ A;  4IC2 A;  4FJC A;  2KE1 A;  3N9M A;  2KWJ A;  3N9O A;  4YBM A;  1IYM A;  4TKP B;  3O35 A;  2VPD A;  4B86 C;  1RMD A;  4I7B A;  2FSA A;  1MM3 A;  2LRI C;  3N9N A;  2MUM A;  2FUI A;  4WZ3 B;  2ECV A;  4MSX A;  2KWN A;  4R7E A;  4ZQL A;  2MD7 B;  1WEV A;  3MHH A;  2L5U A;  4F52 B;  2CKL B;  2YHN A;  3PHD A;  5B78 A;  3M63 A;  4CA1 A;  5FEY A;  2YHO A;  4R8P K;  3LQI A;  5B8D A;  2KGI A;  2YRE A;  3RPG B;  4O64 A;  2AN6 A;  2XEU A;  3HCS A;  2RI7 A;  1WGM A;  4YAX A;  3ZYQ A;  2YQL A;  3KV6 A;  5KH7 A;  5LKX A;  2JMJ A;  4BBQ A;  1X4J A;  3EB6 A;  4XI1 A;  2CSY A;  2KWK A;  2VJE B;  4A49 A;  2YU4 A;  2L80 A;  1JOC A;  3GV4 A;  3LQJ A;  5B77 A;  2LQ6 A;  2YSJ A;  1V87 A;  4B7Y C;  1T1H A;  1Z2Q A;  5TRB A;  2VJF B;  1WEN A;  2D8S A;  3GL6 A;  2EGP A;  1WEO A;  1XWH A;  2HDP A;  3L1X A;  3ASL A;  2E6S A;  5DKA A;  2NAA A;  2VJE A;  2H0D B;  2KU3 A;  5TDR A;  5KH3 A;  2PNX A;  3LQH A;  4FK5 A;  2ECG A;  4AYC A;  3RTR B;  2EA6 A;  2DX8 A;  2L0B A;  2MT5 A;  4YC9 A;  2G45 A;  2I50 A;  4S3O C;  1DVP A;  3KNV A;  4FO9 A;  4R2Y A;  1X4U A;  3O70 A;  3FL2 A;  5LCW B;  2K17 A;  4WZ0 A;  4A4C A;  4WA6 A;  2H0D A;  3HTK C;  2YW8 A;  3O34 A;  4MVT A;  1ZBD B;  3ZVY A;  5FB0 A;  3U5N A;  5J3X A;  1MM2 A;  4Q6F A;  4WZ2 A;  2HYE D;  2VPG A;  2MNZ A;  3U5P A;  3KQI A;  3SHB A;  1Z60 A;  2VPE A;  2YT5 A;  4P5O B;  2G6Q A;  3L11 A;  5D1K B;  4QF3 A;  5LKU A;  2K1J A;  5TBN A;  5LKT A;  2YYR A;  1VD4 A;  4A0C D;  4NN2 A;  3SOX A;  2KR4 A;  5C11 A;  4BHW A;  4I7C A;  2XB1 A;  1WEW A;  3N9Q A;  2JMD A;  5B76 A;  3N9P A;  2YQM A;  1JM7 B;  5H1V A;  3ZTG A;  1Z6U A;  2CKL A;  4QF2 A;  4LK9 A;  5H1U A;  2VP7 A;  4LAD B;  2MNY A;  2M1R A;  2IDA A;  4LKA A;  4PPE A;  2LGG A;  5B75 A;  2LXH C;  4GND A;  2ECN A;  4PTB A;  3V43 A;  2OXQ C;  1HYI A;  3M99 A;  5H1T A;  4W4U A;  4UI9 B;  2ECJ A;  4N4F A;  5JG6 A;  1LDJ B;  5I3L A;  5DIN A;  1E4U A;  5G05 B;  2ECW A;  2MIQ A;  5G0F A;  4YAD A;  5FB1 A;  1FBV A;  4GNG A;  2JMI A;  4AVX A;  2KWO A;  2LN0 A;  2M85 A;  3ZVZ B;  2VPB A;  2VJF A;  2LDR A;  3NG2 A;  5D1L B;  1VFY A;  2MD8 C;  2K4D A;  2L75 A;  3O37 A;  5C13 A;  1WEQ A;  3VK6 A;  3RPG C;  3SOU A;  5H9M A;  2Y43 A;  3ZPV 1;  3IHP A;  4UP0 A;  4LLB A;  5AIT A;  2MA5 A;  3KV5 A;  2EOD A;  3ZPV E;  2E6R A;  1VYX A;  1LDK C;  3U5O A;  4GB0 A;  2PUY A;  4L7X A;  4V3L C;  1WEU A;  2UZG A;  2KRE A;  4ZUX U;  2F42 A;  3EB5 A;  3ZNI A;  1WE9 A;  4YBS A;  2LV9 A;  2L43 A;  2YSM A;  1F62 A;  4YBT A;  3DQV R;  5TAB A;  5LKZ A;  2G43 A;  4X3G A;  2M3H A;  2MA6 A;  2ZET C;  4S3O B;  3T7L A;  2Y1M A;  4N3W A;  1WFK A;  3C5K A;  1WES A;  3SOW A;  4YAT A;  3N9L A;  2CSZ A;  3HCT A;  2Y1N A;  3DPL R;  1WEM A;  4UP5 A;  5AIU A;  3I2D A;  4GNF A;  3U5M A;  4A4B A;  2F6J A;  3HCU A;  2K16 A;  2QIC A;  2YUR A;  3PUQ A;  5EYA F;  2FUU A;  1WIM A;  3T6R A;  2ECT A;  4YAB A;  4CCG X;  1JM7 A;  2LGK A;  2VNF A;  1G25 A;  2M6M A;  4ZDT A;  1WEP A;  3C6W A;  4AP4 A;  5FER A;  4AYC B;  2RSD A;  4I7D A; 
#chains in the Genus database with same CATH topology
 4LJN A;  1X4I A;  1WEE A;  3PUR A;  4C9Z A;  2CON A;  4GNE A;  2KFT A;  2BAY A;  3LVQ E;  2M13 A;  4IC3 A;  3QZV A;  1FP0 A;  2QJ0 A;  1BOR A;  2C2L A;  2LXP C;  5G04 B;  4AUQ B;  3KDE C;  1MBM A;  2QIZ A;  1K2F A;  2XOC A;  4OGE A;  2ECI A;  2KIZ A;  1U6G B;  3M62 A;  2YUC A;  5TDW A;  2C2V S;  2CSV A;  3O33 A;  2KYU A;  4L58 A;  3O36 A;  2F6N A;  2E61 A;  2JRJ A;  2KGG A;  5KH9 A;  2CT2 A;  4V3K C;  1CHC A;  5B79 A;  2LGV A;  2LGL A;  3L1Z B;  3O7A A;  5SVY A;  3LRQ A;  3MHS A;  1WIL A;  4FIP A;  1N87 A;  3E2D A;  5D1M B;  1HYJ A;  4IC2 A;  4FJC A;  2KE1 A;  3N9M A;  2KWJ A;  3N9O A;  3SUB A;  2CRW A;  4YBM A;  1IYM A;  4TKP B;  3O35 A;  2VPD A;  4B86 C;  1RMD A;  4I7B A;  2FSA A;  1MM3 A;  2LRI C;  3N9N A;  2MUM A;  2FUI A;  4WZ3 B;  2ECV A;  4MSX A;  2KWN A;  4R7E A;  4ZQL A;  2MD7 B;  1WEV A;  3MHH A;  2L5U A;  4F52 B;  2CKL B;  2D8U A;  2YHN A;  3PHD A;  5B78 A;  3M63 A;  4CA1 A;  3LDY A;  3FAN A;  5FEY A;  2YHO A;  4R8P K;  3LQI A;  5B8D A;  2KGI A;  2YRE A;  3RPG B;  4O64 A;  2LAU A;  3O47 A;  2AN6 A;  2XEU A;  2DJA A;  3HCS A;  2RI7 A;  1WGM A;  4YAX A;  3ZYQ A;  2YQL A;  3KV6 A;  5KH7 A;  5LKX A;  2CRR A;  2JMJ A;  4BBQ A;  1X4J A;  3EB6 A;  4XI1 A;  2CSY A;  2KWK A;  2VJE B;  3LVR E;  4A49 A;  2YU4 A;  2L80 A;  1JOC A;  3GV4 A;  3LQJ A;  5B77 A;  2LQ6 A;  2YSJ A;  1V87 A;  4B7Y C;  1T1H A;  1Z2Q A;  5TRB A;  2VJF B;  1WEN A;  2D8S A;  3GL6 A;  2P57 A;  2EGP A;  1WEO A;  3DWD A;  1XWH A;  2HDP A;  3L1X A;  3ASL A;  2E6S A;  5DKA A;  2NAA A;  2VJE A;  2H0D B;  2KU3 A;  5TDR A;  5KH3 A;  2PNX A;  3LQH A;  3T9K A;  4FK5 A;  2ECG A;  4AYC A;  3RTR B;  2EA6 A;  1DCQ A;  2DX8 A;  4QQ4 A;  2L0B A;  5K3Q A;  2MT5 A;  4YC9 A;  2G45 A;  2I50 A;  4S3O C;  1DVP A;  2JM3 A;  3LJU X;  3KNV A;  4FO9 A;  4R2Y A;  1X4U A;  3O70 A;  3MDB C;  3FL2 A;  3M7K A;  5LCW B;  2K17 A;  4WZ0 A;  4A4C A;  4WA6 A;  2H0D A;  3HTK C;  2YW8 A;  3H7H A;  3O34 A;  4MVT A;  1ZBD B;  3ZVY A;  5FB0 A;  3U5N A;  2YVR A;  2FFW A;  5J3X A;  2XOY A;  1MM2 A;  4Q6F A;  4WZ2 A;  2OWA A;  2HYE D;  2VPG A;  2MNZ A;  3U5P A;  3KQI A;  3SHB A;  3JUE A;  1Z60 A;  2VPE A;  2YT5 A;  4P5O B;  2G6Q A;  3L11 A;  5D1K B;  4QF3 A;  5LKU A;  2K1J A;  3DDT A;  5TBN A;  5LKT A;  2YYR A;  1VD4 A;  2MKE A;  4A0C D;  4NN2 A;  3SOX A;  2KR4 A;  5C11 A;  4BHW A;  4I7C A;  2XB1 A;  1WEW A;  3N9Q A;  2JMD A;  5B76 A;  3N9P A;  2YQM A;  1JM7 B;  5H1V A;  3ZTG A;  2XOZ A;  1Z6U A;  2CKL A;  4QF2 A;  4LK9 A;  5H1U A;  2VP7 A;  4LAD B;  2MNY A;  2M1R A;  2IDA A;  4LKA A;  5SVI B;  3PLW A;  2KKY A;  4PPE A;  2IQJ A;  2LGG A;  4F1P A;  5B75 A;  2LXH C;  4GND A;  2ECN A;  4PTB A;  3V43 A;  2OXQ C;  1HYI A;  3M99 A;  5H1T A;  4W4U A;  4UI9 B;  2ECJ A;  4N4F A;  5JG6 A;  1LDJ B;  5I3L A;  5DIN A;  1E4U A;  5G05 B;  2ECW A;  2RR4 A;  2MIQ A;  5G0F A;  4YAD A;  5FB1 A;  1FBV A;  3FJU B;  4GNG A;  2JMI A;  4AVX A;  2L7P A;  2KWO A;  2LN0 A;  2M85 A;  3ZVZ B;  2VPB A;  2VJF A;  2LDR A;  3NG2 A;  5D1L B;  1VFY A;  2MD8 C;  4O62 A;  2EXU A;  2K4D A;  2KKX A;  2L75 A;  3O37 A;  5C13 A;  1WEQ A;  3VK6 A;  3RPG C;  3FAO A;  2DSM A;  3Q1D A;  2XP0 A;  3SOU A;  5H9M A;  2Y43 A;  3ZPV 1;  3IHP A;  4UP0 A;  4LLB A;  5AIT A;  2MA5 A;  3KV5 A;  2EOD A;  3ZPV E;  2E6R A;  1VYX A;  1LDK C;  3U5O A;  4GB0 A;  2PUY A;  4L7X A;  4V3L C;  1WEU A;  2UZG A;  2KRE A;  4ZUX U;  2F42 A;  3EB5 A;  3ZNI A;  1WE9 A;  4YBS A;  2LV9 A;  4H9D A;  2L43 A;  2YSM A;  1F62 A;  4YBT A;  3DQV R;  5TAB A;  5LKZ A;  2G43 A;  4X3G A;  2M3H A;  4Z0R A;  2MA6 A;  2ZET C;  4S3O B;  3T7L A;  2Y1M A;  4N3W A;  4Z0O A;  1WFK A;  3C5K A;  1WES A;  2EGM A;  3SOW A;  4YAT A;  3N9L A;  2CSZ A;  3HCT A;  2Y1N A;  3DPL R;  1WEM A;  3FEH A;  2FD4 A;  4UP5 A;  5AIU A;  3I2D A;  4GNF A;  2B0O E;  3U5M A;  4A4B A;  2F6J A;  3HCU A;  2K16 A;  2QIC A;  2YUR A;  3PUQ A;  2JUN A;  4OGC A;  5EYA F;  2FUU A;  1WIM A;  3T6R A;  2ECT A;  4YAB A;  4CCG X;  1JM7 A;  2LGK A;  2VNF A;  3FM8 C;  1G25 A;  2M6M A;  4ZDT A;  1WEP A;  3C6W A;  4AP4 A;  5SVX A;  5FER A;  4AYC B;  2RSD A;  4I7D A;  5SVI A; 
#chains in the Genus database with same CATH homology
 4LJN A;  1X4I A;  1WEE A;  3PUR A;  4C9Z A;  4GNE A;  2KFT A;  2BAY A;  4IC3 A;  3QZV A;  1FP0 A;  2QJ0 A;  1BOR A;  2C2L A;  2LXP C;  5G04 B;  4AUQ B;  2QIZ A;  1K2F A;  2ECI A;  2KIZ A;  1U6G B;  3M62 A;  2YUC A;  5TDW A;  2C2V S;  3O33 A;  2KYU A;  4L58 A;  3O36 A;  2F6N A;  2JRJ A;  2KGG A;  5KH9 A;  2CT2 A;  4V3K C;  1CHC A;  5B79 A;  2LGV A;  2LGL A;  3L1Z B;  3O7A A;  3LRQ A;  3MHS A;  1WIL A;  4FIP A;  1N87 A;  5D1M B;  1HYJ A;  4IC2 A;  4FJC A;  2KE1 A;  3N9M A;  2KWJ A;  3N9O A;  4YBM A;  1IYM A;  4TKP B;  3O35 A;  2VPD A;  4B86 C;  1RMD A;  4I7B A;  2FSA A;  1MM3 A;  2LRI C;  3N9N A;  2MUM A;  2FUI A;  4WZ3 B;  2ECV A;  4MSX A;  2KWN A;  4R7E A;  4ZQL A;  2MD7 B;  1WEV A;  3MHH A;  2L5U A;  4F52 B;  2CKL B;  2YHN A;  3PHD A;  5B78 A;  3M63 A;  4CA1 A;  5FEY A;  2YHO A;  4R8P K;  3LQI A;  5B8D A;  2KGI A;  2YRE A;  3RPG B;  4O64 A;  2AN6 A;  2XEU A;  3HCS A;  2RI7 A;  1WGM A;  4YAX A;  3ZYQ A;  2YQL A;  3KV6 A;  5KH7 A;  5LKX A;  2JMJ A;  4BBQ A;  1X4J A;  3EB6 A;  4XI1 A;  2CSY A;  2KWK A;  2VJE B;  4A49 A;  2YU4 A;  2L80 A;  1JOC A;  3GV4 A;  3LQJ A;  5B77 A;  2LQ6 A;  2YSJ A;  1V87 A;  4B7Y C;  1T1H A;  1Z2Q A;  5TRB A;  2VJF B;  1WEN A;  2D8S A;  3GL6 A;  2EGP A;  1WEO A;  1XWH A;  2HDP A;  3L1X A;  3ASL A;  2E6S A;  5DKA A;  2NAA A;  2VJE A;  2H0D B;  2KU3 A;  5TDR A;  5KH3 A;  2PNX A;  3LQH A;  4FK5 A;  2ECG A;  4AYC A;  3RTR B;  2EA6 A;  2DX8 A;  2L0B A;  2MT5 A;  4YC9 A;  2G45 A;  2I50 A;  4S3O C;  1DVP A;  3KNV A;  4FO9 A;  4R2Y A;  1X4U A;  3O70 A;  3FL2 A;  5LCW B;  2K17 A;  4WZ0 A;  4A4C A;  4WA6 A;  2H0D A;  3HTK C;  2YW8 A;  3O34 A;  4MVT A;  1ZBD B;  3ZVY A;  5FB0 A;  3U5N A;  5J3X A;  1MM2 A;  4Q6F A;  4WZ2 A;  2HYE D;  2VPG A;  2MNZ A;  3U5P A;  3KQI A;  3SHB A;  1Z60 A;  2VPE A;  2YT5 A;  4P5O B;  2G6Q A;  3L11 A;  5D1K B;  4QF3 A;  5LKU A;  2K1J A;  5TBN A;  5LKT A;  2YYR A;  1VD4 A;  4A0C D;  4NN2 A;  3SOX A;  2KR4 A;  5C11 A;  4BHW A;  4I7C A;  2XB1 A;  1WEW A;  3N9Q A;  2JMD A;  5B76 A;  3N9P A;  2YQM A;  1JM7 B;  5H1V A;  3ZTG A;  1Z6U A;  2CKL A;  4QF2 A;  4LK9 A;  5H1U A;  2VP7 A;  4LAD B;  2MNY A;  2M1R A;  2IDA A;  4LKA A;  4PPE A;  2LGG A;  5B75 A;  2LXH C;  4GND A;  2ECN A;  4PTB A;  3V43 A;  2OXQ C;  1HYI A;  3M99 A;  5H1T A;  4W4U A;  4UI9 B;  2ECJ A;  4N4F A;  5JG6 A;  1LDJ B;  5I3L A;  5DIN A;  1E4U A;  5G05 B;  2ECW A;  2MIQ A;  5G0F A;  4YAD A;  5FB1 A;  1FBV A;  4GNG A;  2JMI A;  4AVX A;  2KWO A;  2LN0 A;  2M85 A;  3ZVZ B;  2VPB A;  2VJF A;  2LDR A;  3NG2 A;  5D1L B;  1VFY A;  2MD8 C;  2K4D A;  2L75 A;  3O37 A;  5C13 A;  1WEQ A;  3VK6 A;  3RPG C;  3SOU A;  5H9M A;  2Y43 A;  3ZPV 1;  3IHP A;  4UP0 A;  4LLB A;  5AIT A;  2MA5 A;  3KV5 A;  2EOD A;  3ZPV E;  2E6R A;  1VYX A;  1LDK C;  3U5O A;  4GB0 A;  2PUY A;  4L7X A;  4V3L C;  1WEU A;  2UZG A;  2KRE A;  4ZUX U;  2F42 A;  3EB5 A;  3ZNI A;  1WE9 A;  4YBS A;  2LV9 A;  2L43 A;  2YSM A;  1F62 A;  4YBT A;  3DQV R;  5TAB A;  5LKZ A;  2G43 A;  4X3G A;  2M3H A;  2MA6 A;  2ZET C;  4S3O B;  3T7L A;  2Y1M A;  4N3W A;  1WFK A;  3C5K A;  1WES A;  3SOW A;  4YAT A;  3N9L A;  2CSZ A;  3HCT A;  2Y1N A;  3DPL R;  1WEM A;  4UP5 A;  5AIU A;  3I2D A;  4GNF A;  3U5M A;  4A4B A;  2F6J A;  3HCU A;  2K16 A;  2QIC A;  2YUR A;  3PUQ A;  5EYA F;  2FUU A;  1WIM A;  3T6R A;  2ECT A;  4YAB A;  4CCG X;  1JM7 A;  2LGK A;  2VNF A;  1G25 A;  2M6M A;  4ZDT A;  1WEP A;  3C6W A;  4AP4 A;  5FER A;  4AYC B;  2RSD A;  4I7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...