2PNXA

The phd finger of ing4 in complex with an h3k4me3 histone peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
51
structure length
51
Chain Sequence
EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ING4 mediates crosstalk between histone H3 K4 trimethylation and H3 acetylation to attenuate cellular transformation
pubmed doi rcsb
molecule keywords Inhibitor of growth protein 4
molecule tags Gene regulation
source organism Homo sapiens
total genus 7
structure length 51
sequence length 51
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2pnxA00
3ZTGA 4QF3A 3U5MA 2JMDA 4L58A 3LQHA 2ECNA 3PHDA 5D1MB 1ZBDB 4S3OB 5FERA 4W4UA 5B8DA 3O7AA 2LGLA 2F6JA 3L11A 2VJFB 2QICA 4O64A 3ZPVE 3C6WA 3GV4A 2K4DA 2G45A 1X4JA 3PURA 5DKAA 4ZDTA 2LQ6A 3RPGC 3ZVZB 3M62A 5LKZA 1DVPA 1FBVA 5H9MA 2QJ0A 3SOWA 4PPEA 4AVXA 1Z60A 4YAXA 2LGVA 5TDWA 3M63A 1F62A 4AUQB 2FUUA 2F42A 2KGGA 2ECJA 4N4FA 2RI7A 4GNGA 2ECTA 2LN0A 5B77A 2KGIA 3HTKC 2F6NA 2VPGA 4XI1A 1T1HA 5D1KB 2I50A 5B79A 5AITA 1VFYA 1LDKC 2KYUA 2MNZA 2YT5A 2VNFA 3U5NA 2YHOA 5C11A 4V3LC 3RTRB 3ASLA 2KREA 2QIZA 1WIMA 5FB1A 3VK6A 3EB5A 4ZQLA 2LGKA 5JG6A 2MD8C 2M1RA 2ECWA 2EA6A 2ECGA 1X4UA 4UP5A 2H0DB 2KWNA 2MT5A 2M85A 2YQMA 5LCWB 4Q6FA 3O36A 4YBTA 4GNEA 4YC9A 3M99A 4UI9B 3N9PA 2YSMA 2ECIA 4FO9A 4R2YA 4WZ3B 4P5OB 3T7LA 2LXPC 2YUCA 2YQLA 3HCSA 4UP0A 4CA1A 4A49A 1N87A 3O70A 2YURA 1WILA 2VJEB 4QF2A 4YBSA 2KR4A 2CSYA 5B78A 4B86C 4LLBA 2YSJA 1VYXA 4YBMA 3O35A 4V3KC 2CSZA 3MHHA 4AP4A 1FP0A 1E4UA 1WGMA 1WEWA 2MNYA 5B75A 4A0CD 2CKLA 1WEVA 2VPBA 4C9ZA 5J3XA 4I7CA 2IDAA 1WFKA 5KH9A 2Y43A 3MHSA 1WEPA 2JMJA 3V43A 1WEQA 5H1UA 3GL6A 4FJCA 4CCGX 2LDRA 3O34A 2VPEA 3L1XA 2XEUA 3O33A 5TRBA 1WEMA 3LQJA 5G04B 2NAAA 1MM3A 4BHWA 2L80A 4B7YC 4NN2A 5KH3A 1JM7A 4X3GA 2RSDA 4MSXA 5C13A 2Y1NA 4YABA 3IHPA 3FL2A 1WENA 2LGGA 4LJNA 3ZVYA 4BBQA 2MIQA 5AIUA 1K2FA 2K17A 4A4BA 2JMIA 1HYIA 3N9QA 5EYAF 2G6QA 2ZETC 3NG2A 4L7XA 2EGPA 1JOCA 5LKTA 4GB0A 4S3OC 5H1TA 3KV5A 2MA6A 4R7EA 2DX8A 4R8PK 2KIZA 3C5KA 1XWHA 4AYCA 1Z2QA 3SOUA 3N9NA 1WEOA 2OXQC 5G0FA 5FB0A 2KWKA 2K1JA 2L43A 2KWJA 4LK9A 2C2LA 4YATA 4TKPB 2HYED 2AN6A 4FK5A 4N3WA 2LRIC 2M3HA 2PUYA 2YU4A 2MUMA 1Z6UA 5I3LA 5B76A 4ZUXU 1WESA 4GNDA 2KE1A 3ZPV1 2VJEA 3DQVR 4LADB 2CT2A 5H1VA 1U6GB 2ECVA 2FSAA 2VJFA 2XB1A 5TABA 3ZYQA 3L1ZB 4IC2A 1VD4A 3LRQA 2PNXA 3KV6A 1HYJA 2HDPA 3KNVA 2VP7A 2CKLB 1IYMA 4LKAA 3U5PA 2Y1MA 3HCUA 5TDRA 2K16A 2YW8A 2E6RA 2YREA 1WEEA 4YADA 3QZVA 1RMDA 5LKXA 4FIPA 3I2DA 4WA6A 4WZ0A 3DPLR 2C2VS 4A4CA 2D8SA 2UZGA 2L75A 3LQIA 3N9MA 3RPGB 1JM7B 1BORA 2YYRA 5TBNA 2LV9A 2M6MA 4WZ2A 5DINA 5FEYA 1WEUA 2G43A 2KFTA 4I7DA 3PUQA 3N9OA 2VPDA 5LKUA 3SHBA 3U5OA 1MM2A 2FUIA 2LXHC 2E6SA 1CHCA 2L0BA 3EB6A 4MVTA 4PTBA 1G25A 4F52B 4IC3A 3SOXA 3T6RA 1X4IA 3N9LA 4AYCB 4I7BA 2L5UA 1V87A 1WE9A 2H0DA 2KU3A 3ZNIA 2KWOA 5KH7A 2JRJA 2BAYA 1LDJB 4GNFA 3HCTA 5G05B 2MA5A 2YHNA 3KQIA 3O37A 5D1LB 2EODA 2MD7B
chains in the Genus database with same CATH superfamily
3ZTGA 2KKXA 2RR4A 4QF3A 3U5MA 2JMDA 4L58A 3LQHA 2ECNA 3PHDA 5D1MB 1ZBDB 2E61A 4S3OB 4W4UA 5FERA 5B8DA 3O7AA 2LGLA 2F6JA 3L11A 2DSMA 2VJFB 2XOYA 2QICA 3O47A 4O64A 3ZPVE 3C6WA 3GV4A 2K4DA 2G45A 1X4JA 2KKYA 3PURA 5DKAA 4ZDTA 2YVRA 3LJUX 2LQ6A 3RPGC 3MDBC 5SVIA 3ZVZB 3M62A 3DWDA 3KDEC 5LKZA 1DVPA 3E2DA 2FD4A 1FBVA 5H9MA 2QJ0A 4PPEA 3SOWA 4AVXA 1Z60A 3LVRE 4YAXA 2LGVA 5TDWA 3M63A 1F62A 4AUQB 2FUUA 4Z0RA 2F42A 2KGGA 3LDYA 2ECJA 4N4FA 2RI7A 4GNGA 2ECTA 2LN0A 5B77A 3Q1DA 2KGIA 3HTKC 2F6NA 2VPGA 4XI1A 1T1HA 5D1KB 2I50A 5B79A 5AITA 1VFYA 1LDKC 2KYUA 2MNZA 2YT5A 2B0OE 2VNFA 3U5NA 5K3QA 2YHOA 5C11A 4V3LC 3RTRB 3ASLA 2KREA 2QIZA 1WIMA 5FB1A 3VK6A 3EB5A 4ZQLA 2MKEA 2LGKA 5JG6A 2MD8C 2M1RA 2ECWA 2EA6A 2ECGA 1X4UA 4UP5A 4O62A 2H0DB 2KWNA 2MT5A 3FAOA 2M85A 2YQMA 5LCWB 4Q6FA 3O36A 4YBTA 4GNEA 4YC9A 3M99A 4UI9B 3N9PA 2YSMA 2ECIA 4FO9A 4R2YA 4WZ3B 4P5OB 3T7LA 1MBMA 2LXPC 2YUCA 3PLWA 2YQLA 3HCSA 4UP0A 4CA1A 3JUEA 4A49A 1N87A 3O70A 2YURA 1WILA 2VJEB 4QF2A 4YBSA 2KR4A 2CSYA 5B78A 2XOCA 3FM8C 4B86C 4LLBA 2JUNA 2P57A 2YSJA 1VYXA 4YBMA 3O35A 4V3KC 3LVQE 2CSZA 2JM3A 3MHHA 4AP4A 1FP0A 1E4UA 2IQJA 1WGMA 1WEWA 2MNYA 5B75A 5SVIB 4A0CD 2CKLA 1WEVA 2VPBA 4C9ZA 5J3XA 3M7KA 4I7CA 2IDAA 1WFKA 5KH9A 2Y43A 2DJAA 3MHSA 1WEPA 2JMJA 3V43A 1WEQA 4Z0OA 3GL6A 4FJCA 5H1UA 4CCGX 2LDRA 3O34A 2VPEA 3L1XA 2XEUA 3O33A 5TRBA 1WEMA 3LQJA 5G04B 2NAAA 1MM3A 4BHWA 2L80A 4B7YC 4NN2A 5KH3A 1JM7A 4X3GA 2RSDA 4MSXA 5C13A 2Y1NA 4F1PA 4YABA 2L7PA 3IHPA 3FL2A 1WENA 2LGGA 3H7HA 4LJNA 3ZVYA 4BBQA 2MIQA 5AIUA 1K2FA 2K17A 4A4BA 2JMIA 1HYIA 3N9QA 5EYAF 2G6QA 2ZETC 3NG2A 4L7XA 2EGPA 1JOCA 5LKTA 4GB0A 4H9DA 4S3OC 5H1TA 3KV5A 2MA6A 4R7EA 2DX8A 4R8PK 2KIZA 3C5KA 1XWHA 4AYCA 1Z2QA 3SOUA 3N9NA 1WEOA 4QQ4A 2OXQC 5G0FA 5FB0A 2KWKA 2K1JA 2L43A 2KWJA 2LAUA 4LK9A 2C2LA 4YATA 4TKPB 2HYED 2AN6A 4FK5A 4N3WA 4OGCA 2LRIC 2M3HA 2PUYA 2YU4A 2CRRA 2MUMA 1Z6UA 5I3LA 5B76A 4ZUXU 1WESA 3FANA 4GNDA 2XOZA 2KE1A 3ZPV1 2VJEA 2XP0A 3DQVR 2OWAA 4LADB 2CT2A 1U6GB 2ECVA 2EGMA 2FSAA 5H1VA 2VJFA 2XB1A 5TABA 3ZYQA 3L1ZB 4IC2A 3FJUB 2CSVA 1VD4A 3LRQA 2PNXA 3KV6A 1HYJA 2HDPA 3KNVA 2VP7A 2CKLB 1IYMA 4LKAA 3U5PA 2Y1MA 3FEHA 3HCUA 2CRWA 5TDRA 2K16A 2YW8A 2E6RA 2YREA 1WEEA 4YADA 3QZVA 1RMDA 2EXUA 5LKXA 2FFWA 4FIPA 3I2DA 4WA6A 4WZ0A 3DPLR 2C2VS 1DCQA 5SVXA 4A4CA 5SVYA 2D8SA 2UZGA 2L75A 3LQIA 3N9MA 3RPGB 1JM7B 1BORA 2YYRA 5TBNA 2LV9A 2M6MA 4WZ2A 5DINA 5FEYA 1WEUA 2G43A 2D8UA 2KFTA 4I7DA 3PUQA 3N9OA 4OGEA 2VPDA 5LKUA 3SUBA 3SHBA 3U5OA 2M13A 3DDTA 1MM2A 2FUIA 2LXHC 2E6SA 1CHCA 2L0BA 3EB6A 4MVTA 3T9KA 4PTBA 1G25A 4F52B 4IC3A 3SOXA 3T6RA 1X4IA 3N9LA 4AYCB 4I7BA 2L5UA 1V87A 1WE9A 2H0DA 2KU3A 3ZNIA 2KWOA 5KH7A 2JRJA 2BAYA 1LDJB 4GNFA 3HCTA 2MA5A 2CONA 2YHNA 5G05B 3KQIA 3O37A 5D1LB 2EODA 2MD7B
chains in the Genus database with same CATH topology
3ZTGA 4QF3A 3U5MA 2JMDA 4L58A 3LQHA 2ECNA 3PHDA 5D1MB 1ZBDB 4S3OB 5FERA 4W4UA 5B8DA 3O7AA 2LGLA 2F6JA 3L11A 2VJFB 2QICA 4O64A 3ZPVE 3C6WA 3GV4A 2K4DA 2G45A 1X4JA 3PURA 5DKAA 4ZDTA 2LQ6A 3RPGC 3ZVZB 3M62A 5LKZA 1DVPA 1FBVA 5H9MA 2QJ0A 3SOWA 4PPEA 4AVXA 1Z60A 4YAXA 2LGVA 5TDWA 3M63A 1F62A 4AUQB 2FUUA 2F42A 2KGGA 2ECJA 4N4FA 2RI7A 4GNGA 2ECTA 2LN0A 5B77A 2KGIA 3HTKC 2F6NA 2VPGA 4XI1A 1T1HA 5D1KB 2I50A 5B79A 5AITA 1VFYA 1LDKC 2KYUA 2MNZA 2YT5A 2VNFA 3U5NA 2YHOA 5C11A 4V3LC 3RTRB 3ASLA 2KREA 2QIZA 1WIMA 5FB1A 3VK6A 3EB5A 4ZQLA 2LGKA 5JG6A 2MD8C 2M1RA 2ECWA 2EA6A 2ECGA 1X4UA 4UP5A 2H0DB 2KWNA 2MT5A 2M85A 2YQMA 5LCWB 4Q6FA 3O36A 4YBTA 4GNEA 4YC9A 3M99A 4UI9B 3N9PA 2YSMA 2ECIA 4FO9A 4R2YA 4WZ3B 4P5OB 3T7LA 2LXPC 2YUCA 2YQLA 3HCSA 4UP0A 4CA1A 4A49A 1N87A 3O70A 2YURA 1WILA 2VJEB 4QF2A 4YBSA 2KR4A 2CSYA 5B78A 4B86C 4LLBA 2YSJA 1VYXA 4YBMA 3O35A 4V3KC 2CSZA 3MHHA 4AP4A 1FP0A 1E4UA 1WGMA 1WEWA 2MNYA 5B75A 4A0CD 2CKLA 1WEVA 2VPBA 4C9ZA 5J3XA 4I7CA 2IDAA 1WFKA 5KH9A 2Y43A 3MHSA 1WEPA 2JMJA 3V43A 1WEQA 5H1UA 3GL6A 4FJCA 4CCGX 2LDRA 3O34A 2VPEA 3L1XA 2XEUA 3O33A 5TRBA 1WEMA 3LQJA 5G04B 2NAAA 1MM3A 4BHWA 2L80A 4B7YC 4NN2A 5KH3A 1JM7A 4X3GA 2RSDA 4MSXA 5C13A 2Y1NA 4YABA 3IHPA 3FL2A 1WENA 2LGGA 4LJNA 3ZVYA 4BBQA 2MIQA 5AIUA 1K2FA 2K17A 4A4BA 2JMIA 1HYIA 3N9QA 5EYAF 2G6QA 2ZETC 3NG2A 4L7XA 2EGPA 1JOCA 5LKTA 4GB0A 4S3OC 5H1TA 3KV5A 2MA6A 4R7EA 2DX8A 4R8PK 2KIZA 3C5KA 1XWHA 4AYCA 1Z2QA 3SOUA 3N9NA 1WEOA 2OXQC 5G0FA 5FB0A 2KWKA 2K1JA 2L43A 2KWJA 4LK9A 2C2LA 4YATA 4TKPB 2HYED 2AN6A 4FK5A 4N3WA 2LRIC 2M3HA 2PUYA 2YU4A 2MUMA 1Z6UA 5I3LA 5B76A 4ZUXU 1WESA 4GNDA 2KE1A 3ZPV1 2VJEA 3DQVR 4LADB 2CT2A 5H1VA 1U6GB 2ECVA 2FSAA 2VJFA 2XB1A 5TABA 3ZYQA 3L1ZB 4IC2A 1VD4A 3LRQA 2PNXA 3KV6A 1HYJA 2HDPA 3KNVA 2VP7A 2CKLB 1IYMA 4LKAA 3U5PA 2Y1MA 3HCUA 5TDRA 2K16A 2YW8A 2E6RA 2YREA 1WEEA 4YADA 3QZVA 1RMDA 5LKXA 4FIPA 3I2DA 4WA6A 4WZ0A 3DPLR 2C2VS 4A4CA 2D8SA 2UZGA 2L75A 3LQIA 3N9MA 3RPGB 1JM7B 1BORA 2YYRA 5TBNA 2LV9A 2M6MA 4WZ2A 5DINA 5FEYA 1WEUA 2G43A 2KFTA 4I7DA 3PUQA 3N9OA 2VPDA 5LKUA 3SHBA 3U5OA 1MM2A 2FUIA 2LXHC 2E6SA 1CHCA 2L0BA 3EB6A 4MVTA 4PTBA 1G25A 4F52B 4IC3A 3SOXA 3T6RA 1X4IA 3N9LA 4AYCB 4I7BA 2L5UA 1V87A 1WE9A 2H0DA 2KU3A 3ZNIA 2KWOA 5KH7A 2JRJA 2BAYA 1LDJB 4GNFA 3HCTA 5G05B 2MA5A 2YHNA 3KQIA 3O37A 5D1LB 2EODA 2MD7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTG A;  4QF3 A;  3U5M A;  2JMD A;  4L58 A;  3LQH A;  2ECN A;  3PHD A;  5D1M B;  1ZBD B;  4S3O B;  5FER A;  4W4U A;  5B8D A;  3O7A A;  2LGL A;  2F6J A;  3L11 A;  2VJF B;  2QIC A;  4O64 A;  3ZPV E;  3C6W A;  3GV4 A;  2K4D A;  2G45 A;  1X4J A;  3PUR A;  5DKA A;  4ZDT A;  2LQ6 A;  3RPG C;  3ZVZ B;  3M62 A;  5LKZ A;  1DVP A;  1FBV A;  5H9M A;  2QJ0 A;  3SOW A;  4PPE A;  4AVX A;  1Z60 A;  4YAX A;  2LGV A;  5TDW A;  3M63 A;  1F62 A;  4AUQ B;  2FUU A;  2F42 A;  2KGG A;  2ECJ A;  4N4F A;  2RI7 A;  4GNG A;  2ECT A;  2LN0 A;  5B77 A;  2KGI A;  3HTK C;  2F6N A;  2VPG A;  4XI1 A;  1T1H A;  5D1K B;  2I50 A;  5B79 A;  5AIT A;  1VFY A;  1LDK C;  2KYU A;  2MNZ A;  2YT5 A;  2VNF A;  3U5N A;  2YHO A;  5C11 A;  4V3L C;  3RTR B;  3ASL A;  2KRE A;  2QIZ A;  1WIM A;  5FB1 A;  3VK6 A;  3EB5 A;  4ZQL A;  2LGK A;  5JG6 A;  2MD8 C;  2M1R A;  2ECW A;  2EA6 A;  2ECG A;  1X4U A;  4UP5 A;  2H0D B;  2KWN A;  2MT5 A;  2M85 A;  2YQM A;  5LCW B;  4Q6F A;  3O36 A;  4YBT A;  4GNE A;  4YC9 A;  3M99 A;  4UI9 B;  3N9P A;  2YSM A;  2ECI A;  4FO9 A;  4R2Y A;  4WZ3 B;  4P5O B;  3T7L A;  2LXP C;  2YUC A;  2YQL A;  3HCS A;  4UP0 A;  4CA1 A;  4A49 A;  1N87 A;  3O70 A;  2YUR A;  1WIL A;  2VJE B;  4QF2 A;  4YBS A;  2KR4 A;  2CSY A;  5B78 A;  4B86 C;  4LLB A;  2YSJ A;  1VYX A;  4YBM A;  3O35 A;  4V3K C;  2CSZ A;  3MHH A;  4AP4 A;  1FP0 A;  1E4U A;  1WGM A;  1WEW A;  2MNY A;  5B75 A;  4A0C D;  2CKL A;  1WEV A;  2VPB A;  4C9Z A;  5J3X A;  4I7C A;  2IDA A;  1WFK A;  5KH9 A;  2Y43 A;  3MHS A;  1WEP A;  2JMJ A;  3V43 A;  1WEQ A;  5H1U A;  3GL6 A;  4FJC A;  4CCG X;  2LDR A;  3O34 A;  2VPE A;  3L1X A;  2XEU A;  3O33 A;  5TRB A;  1WEM A;  3LQJ A;  5G04 B;  2NAA A;  1MM3 A;  4BHW A;  2L80 A;  4B7Y C;  4NN2 A;  5KH3 A;  1JM7 A;  4X3G A;  2RSD A;  4MSX A;  5C13 A;  2Y1N A;  4YAB A;  3IHP A;  3FL2 A;  1WEN A;  2LGG A;  4LJN A;  3ZVY A;  4BBQ A;  2MIQ A;  5AIU A;  1K2F A;  2K17 A;  4A4B A;  2JMI A;  1HYI A;  3N9Q A;  5EYA F;  2G6Q A;  2ZET C;  3NG2 A;  4L7X A;  2EGP A;  1JOC A;  5LKT A;  4GB0 A;  4S3O C;  5H1T A;  3KV5 A;  2MA6 A;  4R7E A;  2DX8 A;  4R8P K;  2KIZ A;  3C5K A;  1XWH A;  4AYC A;  1Z2Q A;  3SOU A;  3N9N A;  1WEO A;  2OXQ C;  5G0F A;  5FB0 A;  2KWK A;  2K1J A;  2L43 A;  2KWJ A;  4LK9 A;  2C2L A;  4YAT A;  4TKP B;  2HYE D;  2AN6 A;  4FK5 A;  4N3W A;  2LRI C;  2M3H A;  2PUY A;  2YU4 A;  2MUM A;  1Z6U A;  5I3L A;  5B76 A;  4ZUX U;  1WES A;  4GND A;  2KE1 A;  3ZPV 1;  2VJE A;  3DQV R;  4LAD B;  2CT2 A;  5H1V A;  1U6G B;  2ECV A;  2FSA A;  2VJF A;  2XB1 A;  5TAB A;  3ZYQ A;  3L1Z B;  4IC2 A;  1VD4 A;  3LRQ A;  2PNX A;  3KV6 A;  1HYJ A;  2HDP A;  3KNV A;  2VP7 A;  2CKL B;  1IYM A;  4LKA A;  3U5P A;  2Y1M A;  3HCU A;  5TDR A;  2K16 A;  2YW8 A;  2E6R A;  2YRE A;  1WEE A;  4YAD A;  3QZV A;  1RMD A;  5LKX A;  4FIP A;  3I2D A;  4WA6 A;  4WZ0 A;  3DPL R;  2C2V S;  4A4C A;  2D8S A;  2UZG A;  2L75 A;  3LQI A;  3N9M A;  3RPG B;  1JM7 B;  1BOR A;  2YYR A;  5TBN A;  2LV9 A;  2M6M A;  4WZ2 A;  5DIN A;  5FEY A;  1WEU A;  2G43 A;  2KFT A;  4I7D A;  3PUQ A;  3N9O A;  2VPD A;  5LKU A;  3SHB A;  3U5O A;  1MM2 A;  2FUI A;  2LXH C;  2E6S A;  1CHC A;  2L0B A;  3EB6 A;  4MVT A;  4PTB A;  1G25 A;  4F52 B;  4IC3 A;  3SOX A;  3T6R A;  1X4I A;  3N9L A;  4AYC B;  4I7B A;  2L5U A;  1V87 A;  1WE9 A;  2H0D A;  2KU3 A;  3ZNI A;  2KWO A;  5KH7 A;  2JRJ A;  2BAY A;  1LDJ B;  4GNF A;  3HCT A;  5G05 B;  2MA5 A;  2YHN A;  3KQI A;  3O37 A;  5D1L B;  2EOD A;  2MD7 B; 
#chains in the Genus database with same CATH topology
 3ZTG A;  2KKX A;  2RR4 A;  4QF3 A;  3U5M A;  2JMD A;  4L58 A;  3LQH A;  2ECN A;  3PHD A;  5D1M B;  1ZBD B;  2E61 A;  4S3O B;  4W4U A;  5FER A;  5B8D A;  3O7A A;  2LGL A;  2F6J A;  3L11 A;  2DSM A;  2VJF B;  2XOY A;  2QIC A;  3O47 A;  4O64 A;  3ZPV E;  3C6W A;  3GV4 A;  2K4D A;  2G45 A;  1X4J A;  2KKY A;  3PUR A;  5DKA A;  4ZDT A;  2YVR A;  3LJU X;  2LQ6 A;  3RPG C;  3MDB C;  5SVI A;  3ZVZ B;  3M62 A;  3DWD A;  3KDE C;  5LKZ A;  1DVP A;  3E2D A;  2FD4 A;  1FBV A;  5H9M A;  2QJ0 A;  4PPE A;  3SOW A;  4AVX A;  1Z60 A;  3LVR E;  4YAX A;  2LGV A;  5TDW A;  3M63 A;  1F62 A;  4AUQ B;  2FUU A;  4Z0R A;  2F42 A;  2KGG A;  3LDY A;  2ECJ A;  4N4F A;  2RI7 A;  4GNG A;  2ECT A;  2LN0 A;  5B77 A;  3Q1D A;  2KGI A;  3HTK C;  2F6N A;  2VPG A;  4XI1 A;  1T1H A;  5D1K B;  2I50 A;  5B79 A;  5AIT A;  1VFY A;  1LDK C;  2KYU A;  2MNZ A;  2YT5 A;  2B0O E;  2VNF A;  3U5N A;  5K3Q A;  2YHO A;  5C11 A;  4V3L C;  3RTR B;  3ASL A;  2KRE A;  2QIZ A;  1WIM A;  5FB1 A;  3VK6 A;  3EB5 A;  4ZQL A;  2MKE A;  2LGK A;  5JG6 A;  2MD8 C;  2M1R A;  2ECW A;  2EA6 A;  2ECG A;  1X4U A;  4UP5 A;  4O62 A;  2H0D B;  2KWN A;  2MT5 A;  3FAO A;  2M85 A;  2YQM A;  5LCW B;  4Q6F A;  3O36 A;  4YBT A;  4GNE A;  4YC9 A;  3M99 A;  4UI9 B;  3N9P A;  2YSM A;  2ECI A;  4FO9 A;  4R2Y A;  4WZ3 B;  4P5O B;  3T7L A;  1MBM A;  2LXP C;  2YUC A;  3PLW A;  2YQL A;  3HCS A;  4UP0 A;  4CA1 A;  3JUE A;  4A49 A;  1N87 A;  3O70 A;  2YUR A;  1WIL A;  2VJE B;  4QF2 A;  4YBS A;  2KR4 A;  2CSY A;  5B78 A;  2XOC A;  3FM8 C;  4B86 C;  4LLB A;  2JUN A;  2P57 A;  2YSJ A;  1VYX A;  4YBM A;  3O35 A;  4V3K C;  3LVQ E;  2CSZ A;  2JM3 A;  3MHH A;  4AP4 A;  1FP0 A;  1E4U A;  2IQJ A;  1WGM A;  1WEW A;  2MNY A;  5B75 A;  5SVI B;  4A0C D;  2CKL A;  1WEV A;  2VPB A;  4C9Z A;  5J3X A;  3M7K A;  4I7C A;  2IDA A;  1WFK A;  5KH9 A;  2Y43 A;  2DJA A;  3MHS A;  1WEP A;  2JMJ A;  3V43 A;  1WEQ A;  4Z0O A;  3GL6 A;  4FJC A;  5H1U A;  4CCG X;  2LDR A;  3O34 A;  2VPE A;  3L1X A;  2XEU A;  3O33 A;  5TRB A;  1WEM A;  3LQJ A;  5G04 B;  2NAA A;  1MM3 A;  4BHW A;  2L80 A;  4B7Y C;  4NN2 A;  5KH3 A;  1JM7 A;  4X3G A;  2RSD A;  4MSX A;  5C13 A;  2Y1N A;  4F1P A;  4YAB A;  2L7P A;  3IHP A;  3FL2 A;  1WEN A;  2LGG A;  3H7H A;  4LJN A;  3ZVY A;  4BBQ A;  2MIQ A;  5AIU A;  1K2F A;  2K17 A;  4A4B A;  2JMI A;  1HYI A;  3N9Q A;  5EYA F;  2G6Q A;  2ZET C;  3NG2 A;  4L7X A;  2EGP A;  1JOC A;  5LKT A;  4GB0 A;  4H9D A;  4S3O C;  5H1T A;  3KV5 A;  2MA6 A;  4R7E A;  2DX8 A;  4R8P K;  2KIZ A;  3C5K A;  1XWH A;  4AYC A;  1Z2Q A;  3SOU A;  3N9N A;  1WEO A;  4QQ4 A;  2OXQ C;  5G0F A;  5FB0 A;  2KWK A;  2K1J A;  2L43 A;  2KWJ A;  2LAU A;  4LK9 A;  2C2L A;  4YAT A;  4TKP B;  2HYE D;  2AN6 A;  4FK5 A;  4N3W A;  4OGC A;  2LRI C;  2M3H A;  2PUY A;  2YU4 A;  2CRR A;  2MUM A;  1Z6U A;  5I3L A;  5B76 A;  4ZUX U;  1WES A;  3FAN A;  4GND A;  2XOZ A;  2KE1 A;  3ZPV 1;  2VJE A;  2XP0 A;  3DQV R;  2OWA A;  4LAD B;  2CT2 A;  1U6G B;  2ECV A;  2EGM A;  2FSA A;  5H1V A;  2VJF A;  2XB1 A;  5TAB A;  3ZYQ A;  3L1Z B;  4IC2 A;  3FJU B;  2CSV A;  1VD4 A;  3LRQ A;  2PNX A;  3KV6 A;  1HYJ A;  2HDP A;  3KNV A;  2VP7 A;  2CKL B;  1IYM A;  4LKA A;  3U5P A;  2Y1M A;  3FEH A;  3HCU A;  2CRW A;  5TDR A;  2K16 A;  2YW8 A;  2E6R A;  2YRE A;  1WEE A;  4YAD A;  3QZV A;  1RMD A;  2EXU A;  5LKX A;  2FFW A;  4FIP A;  3I2D A;  4WA6 A;  4WZ0 A;  3DPL R;  2C2V S;  1DCQ A;  5SVX A;  4A4C A;  5SVY A;  2D8S A;  2UZG A;  2L75 A;  3LQI A;  3N9M A;  3RPG B;  1JM7 B;  1BOR A;  2YYR A;  5TBN A;  2LV9 A;  2M6M A;  4WZ2 A;  5DIN A;  5FEY A;  1WEU A;  2G43 A;  2D8U A;  2KFT A;  4I7D A;  3PUQ A;  3N9O A;  4OGE A;  2VPD A;  5LKU A;  3SUB A;  3SHB A;  3U5O A;  2M13 A;  3DDT A;  1MM2 A;  2FUI A;  2LXH C;  2E6S A;  1CHC A;  2L0B A;  3EB6 A;  4MVT A;  3T9K A;  4PTB A;  1G25 A;  4F52 B;  4IC3 A;  3SOX A;  3T6R A;  1X4I A;  3N9L A;  4AYC B;  4I7B A;  2L5U A;  1V87 A;  1WE9 A;  2H0D A;  2KU3 A;  3ZNI A;  2KWO A;  5KH7 A;  2JRJ A;  2BAY A;  1LDJ B;  4GNF A;  3HCT A;  2MA5 A;  2CON A;  2YHN A;  5G05 B;  3KQI A;  3O37 A;  5D1L B;  2EOD A;  2MD7 B; 
#chains in the Genus database with same CATH homology
 3ZTG A;  4QF3 A;  3U5M A;  2JMD A;  4L58 A;  3LQH A;  2ECN A;  3PHD A;  5D1M B;  1ZBD B;  4S3O B;  5FER A;  4W4U A;  5B8D A;  3O7A A;  2LGL A;  2F6J A;  3L11 A;  2VJF B;  2QIC A;  4O64 A;  3ZPV E;  3C6W A;  3GV4 A;  2K4D A;  2G45 A;  1X4J A;  3PUR A;  5DKA A;  4ZDT A;  2LQ6 A;  3RPG C;  3ZVZ B;  3M62 A;  5LKZ A;  1DVP A;  1FBV A;  5H9M A;  2QJ0 A;  3SOW A;  4PPE A;  4AVX A;  1Z60 A;  4YAX A;  2LGV A;  5TDW A;  3M63 A;  1F62 A;  4AUQ B;  2FUU A;  2F42 A;  2KGG A;  2ECJ A;  4N4F A;  2RI7 A;  4GNG A;  2ECT A;  2LN0 A;  5B77 A;  2KGI A;  3HTK C;  2F6N A;  2VPG A;  4XI1 A;  1T1H A;  5D1K B;  2I50 A;  5B79 A;  5AIT A;  1VFY A;  1LDK C;  2KYU A;  2MNZ A;  2YT5 A;  2VNF A;  3U5N A;  2YHO A;  5C11 A;  4V3L C;  3RTR B;  3ASL A;  2KRE A;  2QIZ A;  1WIM A;  5FB1 A;  3VK6 A;  3EB5 A;  4ZQL A;  2LGK A;  5JG6 A;  2MD8 C;  2M1R A;  2ECW A;  2EA6 A;  2ECG A;  1X4U A;  4UP5 A;  2H0D B;  2KWN A;  2MT5 A;  2M85 A;  2YQM A;  5LCW B;  4Q6F A;  3O36 A;  4YBT A;  4GNE A;  4YC9 A;  3M99 A;  4UI9 B;  3N9P A;  2YSM A;  2ECI A;  4FO9 A;  4R2Y A;  4WZ3 B;  4P5O B;  3T7L A;  2LXP C;  2YUC A;  2YQL A;  3HCS A;  4UP0 A;  4CA1 A;  4A49 A;  1N87 A;  3O70 A;  2YUR A;  1WIL A;  2VJE B;  4QF2 A;  4YBS A;  2KR4 A;  2CSY A;  5B78 A;  4B86 C;  4LLB A;  2YSJ A;  1VYX A;  4YBM A;  3O35 A;  4V3K C;  2CSZ A;  3MHH A;  4AP4 A;  1FP0 A;  1E4U A;  1WGM A;  1WEW A;  2MNY A;  5B75 A;  4A0C D;  2CKL A;  1WEV A;  2VPB A;  4C9Z A;  5J3X A;  4I7C A;  2IDA A;  1WFK A;  5KH9 A;  2Y43 A;  3MHS A;  1WEP A;  2JMJ A;  3V43 A;  1WEQ A;  5H1U A;  3GL6 A;  4FJC A;  4CCG X;  2LDR A;  3O34 A;  2VPE A;  3L1X A;  2XEU A;  3O33 A;  5TRB A;  1WEM A;  3LQJ A;  5G04 B;  2NAA A;  1MM3 A;  4BHW A;  2L80 A;  4B7Y C;  4NN2 A;  5KH3 A;  1JM7 A;  4X3G A;  2RSD A;  4MSX A;  5C13 A;  2Y1N A;  4YAB A;  3IHP A;  3FL2 A;  1WEN A;  2LGG A;  4LJN A;  3ZVY A;  4BBQ A;  2MIQ A;  5AIU A;  1K2F A;  2K17 A;  4A4B A;  2JMI A;  1HYI A;  3N9Q A;  5EYA F;  2G6Q A;  2ZET C;  3NG2 A;  4L7X A;  2EGP A;  1JOC A;  5LKT A;  4GB0 A;  4S3O C;  5H1T A;  3KV5 A;  2MA6 A;  4R7E A;  2DX8 A;  4R8P K;  2KIZ A;  3C5K A;  1XWH A;  4AYC A;  1Z2Q A;  3SOU A;  3N9N A;  1WEO A;  2OXQ C;  5G0F A;  5FB0 A;  2KWK A;  2K1J A;  2L43 A;  2KWJ A;  4LK9 A;  2C2L A;  4YAT A;  4TKP B;  2HYE D;  2AN6 A;  4FK5 A;  4N3W A;  2LRI C;  2M3H A;  2PUY A;  2YU4 A;  2MUM A;  1Z6U A;  5I3L A;  5B76 A;  4ZUX U;  1WES A;  4GND A;  2KE1 A;  3ZPV 1;  2VJE A;  3DQV R;  4LAD B;  2CT2 A;  5H1V A;  1U6G B;  2ECV A;  2FSA A;  2VJF A;  2XB1 A;  5TAB A;  3ZYQ A;  3L1Z B;  4IC2 A;  1VD4 A;  3LRQ A;  2PNX A;  3KV6 A;  1HYJ A;  2HDP A;  3KNV A;  2VP7 A;  2CKL B;  1IYM A;  4LKA A;  3U5P A;  2Y1M A;  3HCU A;  5TDR A;  2K16 A;  2YW8 A;  2E6R A;  2YRE A;  1WEE A;  4YAD A;  3QZV A;  1RMD A;  5LKX A;  4FIP A;  3I2D A;  4WA6 A;  4WZ0 A;  3DPL R;  2C2V S;  4A4C A;  2D8S A;  2UZG A;  2L75 A;  3LQI A;  3N9M A;  3RPG B;  1JM7 B;  1BOR A;  2YYR A;  5TBN A;  2LV9 A;  2M6M A;  4WZ2 A;  5DIN A;  5FEY A;  1WEU A;  2G43 A;  2KFT A;  4I7D A;  3PUQ A;  3N9O A;  2VPD A;  5LKU A;  3SHB A;  3U5O A;  1MM2 A;  2FUI A;  2LXH C;  2E6S A;  1CHC A;  2L0B A;  3EB6 A;  4MVT A;  4PTB A;  1G25 A;  4F52 B;  4IC3 A;  3SOX A;  3T6R A;  1X4I A;  3N9L A;  4AYC B;  4I7B A;  2L5U A;  1V87 A;  1WE9 A;  2H0D A;  2KU3 A;  3ZNI A;  2KWO A;  5KH7 A;  2JRJ A;  2BAY A;  1LDJ B;  4GNF A;  3HCT A;  5G05 B;  2MA5 A;  2YHN A;  3KQI A;  3O37 A;  5D1L B;  2EOD A;  2MD7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...