2PNXA

The phd finger of ing4 in complex with an h3k4me3 histone peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
51
structure length
51
Chain Sequence
EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 4
publication title ING4 mediates crosstalk between histone H3 K4 trimethylation and H3 acetylation to attenuate cellular transformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 7
structure length 51
sequence length 51
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2pnxA00
2ECTA 2AN6A 5TABA 5TDWA 1WILA 2YHNA 3SOWA 5D1LB 4TKPB 3ZPV1 4YATA 2LN0A 2MA5A 3N9LA 3N9OA 3I2DA 3O36A 4R2YA 2QJ0A 4FK5A 4QF3A 2E6RA 5EYAF 2LXPC 4PTBA 4NN2A 2K16A 1VYXA 3LRQA 2MUMA 5B8DA 2CT2A 2I50A 4IC2A 4B7YC 4CCGX 2YUCA 4YADA 2Y1NA 4R7EA 5TRBA 1CHCA 2H0DA 3FL2A 4AP4A 2KIZA 2QIZA 1F62A 2Y43A 4CA1A 1WEVA 2H0DB 4WZ0A 3SOUA 4AVXA 1V87A 2JMIA 1K2FA 2HYED 4ZQLA 2L80A 2MA6A 2M85A 1JM7A 4W4UA 3KQIA 2VJEA 3DPLR 4L58A 3O7AA 1JM7B 2VJEB 2G6QA 2HDPA 2YSJA 5KH3A 3N9MA 2FSAA 3N9QA 3T7LA 3DQVR 4QF2A 4I7DA 1Z6UA 4GNGA 5TDRA 5LKUA 4FJCA 3O70A 1WESA 1RMDA 4ZUXU 4S3OB 2LGGA 4MVTA 5H1UA 3ZPVE 1LDJB 5J3XA 2C2LA 2YSMA 2NAAA 4XI1A 2JMJA 2E6SA 2JRJA 3ASLA 4BHWA 3U5NA 2DX8A 1VD4A 3T6RA 4L7XA 2XEUA 1VFYA 2VPEA 2CSZA 4X3GA 3KV5A 3C5KA 2LV9A 4WZ3B 3N9NA 2K17A 3N9PA 4ZDTA 3O33A 2KWNA 5H1TA 4I7CA 5LKXA 1HYJA 5AITA 3O34A 1WFKA 2LGVA 4GB0A 3ZNIA 5D1MB 3U5OA 2VJFA 3V43A 2M6MA 1IYMA 4UP5A 4R8PK 2MD7B 3MHHA 2C2VS 2VJFB 5TBNA 1BORA 4YBSA 1E4UA 2L43A 2JMDA 1FBVA 2YYRA 4A4BA 2L0BA 2L5UA 2F42A 2UZGA 1ZBDB 3MHSA 4I7BA 2YURA 3EB5A 4V3KC 1Z60A 2VPBA 3M62A 4FO9A 4S3OC 5B76A 4C9ZA 2IDAA 2VNFA 5FB1A 4BBQA 4P5OB 1FP0A 3O35A 4AYCB 4LKAA 2MT5A 1WEQA 2YT5A 2YQLA 3NG2A 4N3WA 1X4JA 3RTRB 4MSXA 4WZ2A 4N4FA 4LLBA 3HCSA 4YC9A 3ZVYA 2K4DA 2MNZA 3ZVZB 1MM3A 2PUYA 2EGPA 5LCWB 3PHDA 4GNFA 1WEWA 3M99A 2M1RA 2ECNA 4UI9B 2FUUA 5G0FA 4YABA 5AIUA 4IC3A 1DVPA 2KWOA 4FIPA 2VPGA 3LQJA 1WEMA 1Z2QA 2KR4A 2LGLA 1WE9A 4GNDA 4V3LC 3IHPA 5LKTA 3ZTGA 2BAYA 3HTKC 3PURA 2YQMA 1JOCA 2KYUA 3L11A 2M3HA 5G05B 4F52B 2XB1A 3SOXA 2VPDA 2LDRA 2OXQC 4YBMA 5B75A 2MD8C 2FUIA 2KGGA 2YU4A 4LJNA 5B78A 4A0CD 4Q6FA 2KGIA 2ECJA 2KE1A 3U5PA 3L1XA 2KWJA 2KU3A 2QICA 2ECVA 4WA6A 5FEYA 1U6GB 3LQIA 5KH7A 5KH9A 3PUQA 2VP7A 4A49A 5JG6A 2F6NA 2G45A 2LQ6A 5D1KB 2G43A 3LQHA 5FB0A 3C6WA 4LADB 3HCUA 5H9MA 1MM2A 2EA6A 4AYCA 5I3LA 2EODA 2KREA 1WEOA 1XWHA 2CSYA 4LK9A 3U5MA 2YW8A 5LKZA 1WENA 5B77A 2MIQA 5C11A 2D8SA 2YHOA 1WIMA 3VK6A 4AUQB 3HCTA 2PNXA 2Y1MA 1WGMA 3L1ZB 4A4CA 2ECIA 1N87A 2YREA 3KV6A 1X4UA 5H1VA 5B79A 5G04B 3EB6A 4YAXA 4O64A 5DKAA 2LXHC 2KFTA 4YBTA 1G25A 2ECWA 1T1HA 5C13A 3SHBA 3KNVA 1X4IA 4GNEA 4B86C 1WEUA 1LDKC 2L75A 4PPEA 2LRIC 3ZYQA 2MNYA 3RPGC 2KWKA 1WEPA 5DINA 2ZETC 2F6JA 5FERA 3M63A 3O37A 1HYIA 2K1JA 2LGKA 3GV4A 4UP0A 2ECGA 2CKLA 2RSDA 3QZVA 1WEEA 2RI7A 2CKLB 3RPGB 3GL6A
chains in the Genus database with same CATH superfamily
2ECTA 2AN6A 2XP0A 5TABA 5TDWA 2D8UA 2XOCA 1WILA 2YHNA 2CSVA 3SOWA 5D1LB 2L7PA 4TKPB 3ZPV1 4YATA 2LN0A 2MA5A 3N9LA 3N9OA 3I2DA 3O36A 4R2YA 2QJ0A 4FK5A 4F1PA 4QF3A 2E6RA 5K3QA 5EYAF 2LXPC 4PTBA 4NN2A 2K16A 1VYXA 3LRQA 2CONA 2MUMA 3M7KA 5B8DA 2CT2A 3FAOA 2CRWA 2I50A 4IC2A 4B7YC 4CCGX 2YUCA 3LJUX 4YADA 2Y1NA 4O62A 4R7EA 5TRBA 1CHCA 2H0DA 3FL2A 4AP4A 2KIZA 2QIZA 1F62A 2Y43A 4CA1A 1WEVA 2H0DB 4WZ0A 3SOUA 3KDEC 4AVXA 1V87A 2JMIA 1K2FA 2HYED 4ZQLA 2L80A 2EGMA 2MA6A 2M85A 2FFWA 1JM7A 4W4UA 3FJUB 3KQIA 2VJEA 3DPLR 4L58A 2JUNA 3O7AA 1JM7B 2VJEB 2G6QA 5SVYA 2HDPA 2CRRA 2YSJA 5KH3A 3N9MA 2FSAA 3N9QA 3T7LA 3DQVR 2DJAA 4QF2A 4I7DA 4GNGA 1Z6UA 5TDRA 5LKUA 4FJCA 3O70A 1WESA 1RMDA 4ZUXU 3T9KA 4S3OB 2LGGA 4MVTA 5H1UA 3ZPVE 1LDJB 5J3XA 2C2LA 2YSMA 2NAAA 4XI1A 2JMJA 2B0OE 2E6SA 2JRJA 3E2DA 2XOZA 2EXUA 3ASLA 4BHWA 3U5NA 2DX8A 1VD4A 3T6RA 4L7XA 2FD4A 2XEUA 1VFYA 2VPEA 2CSZA 4X3GA 3KV5A 3C5KA 2LV9A 4WZ3B 3N9NA 2RR4A 2K17A 3N9PA 4ZDTA 5SVXA 3O33A 2KWNA 2KKXA 5H1TA 4I7CA 5LKXA 1HYJA 5AITA 3H7HA 3O34A 1WFKA 2LGVA 4GB0A 3ZNIA 2OWAA 5D1MB 3U5OA 2VJFA 3V43A 2M6MA 1IYMA 2P57A 3SUBA 4UP5A 3O47A 4R8PK 2MD7B 3MHHA 2C2VS 2VJFB 5TBNA 1BORA 4H9DA 4YBSA 1E4UA 2L43A 2JMDA 1FBVA 2YYRA 4A4BA 2L0BA 2L5UA 2F42A 2UZGA 1ZBDB 3MHSA 4I7BA 2YURA 3EB5A 1DCQA 4OGEA 4V3KC 3LDYA 1Z60A 2VPBA 3M62A 4FO9A 4S3OC 5B76A 4C9ZA 2IDAA 2VNFA 5FB1A 4BBQA 4P5OB 1FP0A 3O35A 4AYCB 4LKAA 2MT5A 3LVQE 1WEQA 2YT5A 2YQLA 3NG2A 3DWDA 4N3WA 1X4JA 3RTRB 4MSXA 4WZ2A 4N4FA 4LLBA 3HCSA 4YC9A 3ZVYA 2K4DA 2MNZA 3ZVZB 1MM3A 2PUYA 2EGPA 5LCWB 4OGCA 3PHDA 2DSMA 1MBMA 4GNFA 1WEWA 3M99A 2M1RA 2ECNA 4UI9B 2FUUA 5G0FA 4YABA 5AIUA 4IC3A 1DVPA 2KWOA 4FIPA 2VPGA 3LQJA 2YVRA 1WEMA 1Z2QA 2KR4A 2LGLA 1WE9A 4GNDA 4V3LC 3IHPA 5LKTA 4QQ4A 3ZTGA 2BAYA 3HTKC 3PURA 2YQMA 1JOCA 2KYUA 3L11A 2M3HA 5G05B 4F52B 2XB1A 3SOXA 2VPDA 2LDRA 2OXQC 4YBMA 5B75A 2JM3A 4Z0OA 2MD8C 2FUIA 2KGGA 2YU4A 4LJNA 5B78A 4A0CD 4Q6FA 2KGIA 2ECJA 2KE1A 3U5PA 3LVRE 3L1XA 2KWJA 2KU3A 2QICA 3JUEA 2ECVA 4WA6A 5FEYA 1U6GB 3LQIA 5KH7A 5SVIA 5KH9A 3PUQA 2VP7A 4A49A 5JG6A 2F6NA 2G45A 2LQ6A 3FM8C 2G43A 5D1KB 3LQHA 5FB0A 3C6WA 3MDBC 5SVIB 4LADB 3HCUA 5H9MA 1MM2A 2EA6A 4AYCA 5I3LA 2EODA 2KREA 2LAUA 1WEOA 1XWHA 2CSYA 4LK9A 3U5MA 2YW8A 4Z0RA 5LKZA 1WENA 5B77A 2MIQA 5C11A 2D8SA 2YHOA 2IQJA 1WIMA 3VK6A 4AUQB 3HCTA 2PNXA 2Y1MA 1WGMA 3L1ZB 3Q1DA 4A4CA 2ECIA 1N87A 2YREA 3KV6A 1X4UA 5H1VA 5B79A 5G04B 3EB6A 4YAXA 4O64A 5DKAA 2LXHC 2KFTA 2MKEA 4YBTA 1G25A 3PLWA 2ECWA 1T1HA 5C13A 3SHBA 3KNVA 2E61A 1X4IA 4GNEA 4B86C 1WEUA 1LDKC 2L75A 4PPEA 2LRIC 3ZYQA 2MNYA 3RPGC 2KWKA 1WEPA 5DINA 2ZETC 2F6JA 5FERA 3M63A 3O37A 2M13A 1HYIA 2K1JA 2LGKA 3GV4A 3FANA 3DDTA 4UP0A 3FEHA 2XOYA 2ECGA 2CKLA 2RSDA 3QZVA 2KKYA 1WEEA 2RI7A 2CKLB 3RPGB 3GL6A
chains in the Genus database with same CATH topology
2ECTA 2AN6A 5TABA 5TDWA 1WILA 2YHNA 3SOWA 5D1LB 4TKPB 3ZPV1 4YATA 2LN0A 2MA5A 3N9LA 3N9OA 3I2DA 3O36A 4R2YA 2QJ0A 4FK5A 4QF3A 2E6RA 5EYAF 2LXPC 4PTBA 4NN2A 2K16A 1VYXA 3LRQA 2MUMA 5B8DA 2CT2A 2I50A 4IC2A 4B7YC 4CCGX 2YUCA 4YADA 2Y1NA 4R7EA 5TRBA 1CHCA 2H0DA 3FL2A 4AP4A 2KIZA 2QIZA 1F62A 2Y43A 4CA1A 1WEVA 2H0DB 4WZ0A 3SOUA 4AVXA 1V87A 2JMIA 1K2FA 2HYED 4ZQLA 2L80A 2MA6A 2M85A 1JM7A 4W4UA 3KQIA 2VJEA 3DPLR 4L58A 3O7AA 1JM7B 2VJEB 2G6QA 2HDPA 2YSJA 5KH3A 3N9MA 2FSAA 3N9QA 3T7LA 3DQVR 4QF2A 4I7DA 1Z6UA 4GNGA 5TDRA 5LKUA 4FJCA 3O70A 1WESA 1RMDA 4ZUXU 4S3OB 2LGGA 4MVTA 5H1UA 3ZPVE 1LDJB 5J3XA 2C2LA 2YSMA 2NAAA 4XI1A 2JMJA 2E6SA 2JRJA 3ASLA 4BHWA 3U5NA 2DX8A 1VD4A 3T6RA 4L7XA 2XEUA 1VFYA 2VPEA 2CSZA 4X3GA 3KV5A 3C5KA 2LV9A 4WZ3B 3N9NA 2K17A 3N9PA 4ZDTA 3O33A 2KWNA 5H1TA 4I7CA 5LKXA 1HYJA 5AITA 3O34A 1WFKA 2LGVA 4GB0A 3ZNIA 5D1MB 3U5OA 2VJFA 3V43A 2M6MA 1IYMA 4UP5A 4R8PK 2MD7B 3MHHA 2C2VS 2VJFB 5TBNA 1BORA 4YBSA 1E4UA 2L43A 2JMDA 1FBVA 2YYRA 4A4BA 2L0BA 2L5UA 2F42A 2UZGA 1ZBDB 3MHSA 4I7BA 2YURA 3EB5A 4V3KC 1Z60A 2VPBA 3M62A 4FO9A 4S3OC 5B76A 4C9ZA 2IDAA 2VNFA 5FB1A 4BBQA 4P5OB 1FP0A 3O35A 4AYCB 4LKAA 2MT5A 1WEQA 2YT5A 2YQLA 3NG2A 4N3WA 1X4JA 3RTRB 4MSXA 4WZ2A 4N4FA 4LLBA 3HCSA 4YC9A 3ZVYA 2K4DA 2MNZA 3ZVZB 1MM3A 2PUYA 2EGPA 5LCWB 3PHDA 4GNFA 1WEWA 3M99A 2M1RA 2ECNA 4UI9B 2FUUA 5G0FA 4YABA 5AIUA 4IC3A 1DVPA 2KWOA 4FIPA 2VPGA 3LQJA 1WEMA 1Z2QA 2KR4A 2LGLA 1WE9A 4GNDA 4V3LC 3IHPA 5LKTA 3ZTGA 2BAYA 3HTKC 3PURA 2YQMA 1JOCA 2KYUA 3L11A 2M3HA 5G05B 4F52B 2XB1A 3SOXA 2VPDA 2LDRA 2OXQC 4YBMA 5B75A 2MD8C 2FUIA 2KGGA 2YU4A 4LJNA 5B78A 4A0CD 4Q6FA 2KGIA 2ECJA 2KE1A 3U5PA 3L1XA 2KWJA 2KU3A 2QICA 2ECVA 4WA6A 5FEYA 1U6GB 3LQIA 5KH7A 5KH9A 3PUQA 2VP7A 4A49A 5JG6A 2F6NA 2G45A 2LQ6A 5D1KB 2G43A 3LQHA 5FB0A 3C6WA 4LADB 3HCUA 5H9MA 1MM2A 2EA6A 4AYCA 5I3LA 2EODA 2KREA 1WEOA 1XWHA 2CSYA 4LK9A 3U5MA 2YW8A 5LKZA 1WENA 5B77A 2MIQA 5C11A 2D8SA 2YHOA 1WIMA 3VK6A 4AUQB 3HCTA 2PNXA 2Y1MA 1WGMA 3L1ZB 4A4CA 2ECIA 1N87A 2YREA 3KV6A 1X4UA 5H1VA 5B79A 5G04B 3EB6A 4YAXA 4O64A 5DKAA 2LXHC 2KFTA 4YBTA 1G25A 2ECWA 1T1HA 5C13A 3SHBA 3KNVA 1X4IA 4GNEA 4B86C 1WEUA 1LDKC 2L75A 4PPEA 2LRIC 3ZYQA 2MNYA 3RPGC 2KWKA 1WEPA 5DINA 2ZETC 2F6JA 5FERA 3M63A 3O37A 1HYIA 2K1JA 2LGKA 3GV4A 4UP0A 2ECGA 2CKLA 2RSDA 3QZVA 1WEEA 2RI7A 2CKLB 3RPGB 3GL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECT A;  2AN6 A;  5TAB A;  5TDW A;  1WIL A;  2YHN A;  3SOW A;  5D1L B;  4TKP B;  3ZPV 1;  4YAT A;  2LN0 A;  2MA5 A;  3N9L A;  3N9O A;  3I2D A;  3O36 A;  4R2Y A;  2QJ0 A;  4FK5 A;  4QF3 A;  2E6R A;  5EYA F;  2LXP C;  4PTB A;  4NN2 A;  2K16 A;  1VYX A;  3LRQ A;  2MUM A;  5B8D A;  2CT2 A;  2I50 A;  4IC2 A;  4B7Y C;  4CCG X;  2YUC A;  4YAD A;  2Y1N A;  4R7E A;  5TRB A;  1CHC A;  2H0D A;  3FL2 A;  4AP4 A;  2KIZ A;  2QIZ A;  1F62 A;  2Y43 A;  4CA1 A;  1WEV A;  2H0D B;  4WZ0 A;  3SOU A;  4AVX A;  1V87 A;  2JMI A;  1K2F A;  2HYE D;  4ZQL A;  2L80 A;  2MA6 A;  2M85 A;  1JM7 A;  4W4U A;  3KQI A;  2VJE A;  3DPL R;  4L58 A;  3O7A A;  1JM7 B;  2VJE B;  2G6Q A;  2HDP A;  2YSJ A;  5KH3 A;  3N9M A;  2FSA A;  3N9Q A;  3T7L A;  3DQV R;  4QF2 A;  4I7D A;  1Z6U A;  4GNG A;  5TDR A;  5LKU A;  4FJC A;  3O70 A;  1WES A;  1RMD A;  4ZUX U;  4S3O B;  2LGG A;  4MVT A;  5H1U A;  3ZPV E;  1LDJ B;  5J3X A;  2C2L A;  2YSM A;  2NAA A;  4XI1 A;  2JMJ A;  2E6S A;  2JRJ A;  3ASL A;  4BHW A;  3U5N A;  2DX8 A;  1VD4 A;  3T6R A;  4L7X A;  2XEU A;  1VFY A;  2VPE A;  2CSZ A;  4X3G A;  3KV5 A;  3C5K A;  2LV9 A;  4WZ3 B;  3N9N A;  2K17 A;  3N9P A;  4ZDT A;  3O33 A;  2KWN A;  5H1T A;  4I7C A;  5LKX A;  1HYJ A;  5AIT A;  3O34 A;  1WFK A;  2LGV A;  4GB0 A;  3ZNI A;  5D1M B;  3U5O A;  2VJF A;  3V43 A;  2M6M A;  1IYM A;  4UP5 A;  4R8P K;  2MD7 B;  3MHH A;  2C2V S;  2VJF B;  5TBN A;  1BOR A;  4YBS A;  1E4U A;  2L43 A;  2JMD A;  1FBV A;  2YYR A;  4A4B A;  2L0B A;  2L5U A;  2F42 A;  2UZG A;  1ZBD B;  3MHS A;  4I7B A;  2YUR A;  3EB5 A;  4V3K C;  1Z60 A;  2VPB A;  3M62 A;  4FO9 A;  4S3O C;  5B76 A;  4C9Z A;  2IDA A;  2VNF A;  5FB1 A;  4BBQ A;  4P5O B;  1FP0 A;  3O35 A;  4AYC B;  4LKA A;  2MT5 A;  1WEQ A;  2YT5 A;  2YQL A;  3NG2 A;  4N3W A;  1X4J A;  3RTR B;  4MSX A;  4WZ2 A;  4N4F A;  4LLB A;  3HCS A;  4YC9 A;  3ZVY A;  2K4D A;  2MNZ A;  3ZVZ B;  1MM3 A;  2PUY A;  2EGP A;  5LCW B;  3PHD A;  4GNF A;  1WEW A;  3M99 A;  2M1R A;  2ECN A;  4UI9 B;  2FUU A;  5G0F A;  4YAB A;  5AIU A;  4IC3 A;  1DVP A;  2KWO A;  4FIP A;  2VPG A;  3LQJ A;  1WEM A;  1Z2Q A;  2KR4 A;  2LGL A;  1WE9 A;  4GND A;  4V3L C;  3IHP A;  5LKT A;  3ZTG A;  2BAY A;  3HTK C;  3PUR A;  2YQM A;  1JOC A;  2KYU A;  3L11 A;  2M3H A;  5G05 B;  4F52 B;  2XB1 A;  3SOX A;  2VPD A;  2LDR A;  2OXQ C;  4YBM A;  5B75 A;  2MD8 C;  2FUI A;  2KGG A;  2YU4 A;  4LJN A;  5B78 A;  4A0C D;  4Q6F A;  2KGI A;  2ECJ A;  2KE1 A;  3U5P A;  3L1X A;  2KWJ A;  2KU3 A;  2QIC A;  2ECV A;  4WA6 A;  5FEY A;  1U6G B;  3LQI A;  5KH7 A;  5KH9 A;  3PUQ A;  2VP7 A;  4A49 A;  5JG6 A;  2F6N A;  2G45 A;  2LQ6 A;  5D1K B;  2G43 A;  3LQH A;  5FB0 A;  3C6W A;  4LAD B;  3HCU A;  5H9M A;  1MM2 A;  2EA6 A;  4AYC A;  5I3L A;  2EOD A;  2KRE A;  1WEO A;  1XWH A;  2CSY A;  4LK9 A;  3U5M A;  2YW8 A;  5LKZ A;  1WEN A;  5B77 A;  2MIQ A;  5C11 A;  2D8S A;  2YHO A;  1WIM A;  3VK6 A;  4AUQ B;  3HCT A;  2PNX A;  2Y1M A;  1WGM A;  3L1Z B;  4A4C A;  2ECI A;  1N87 A;  2YRE A;  3KV6 A;  1X4U A;  5H1V A;  5B79 A;  5G04 B;  3EB6 A;  4YAX A;  4O64 A;  5DKA A;  2LXH C;  2KFT A;  4YBT A;  1G25 A;  2ECW A;  1T1H A;  5C13 A;  3SHB A;  3KNV A;  1X4I A;  4GNE A;  4B86 C;  1WEU A;  1LDK C;  2L75 A;  4PPE A;  2LRI C;  3ZYQ A;  2MNY A;  3RPG C;  2KWK A;  1WEP A;  5DIN A;  2ZET C;  2F6J A;  5FER A;  3M63 A;  3O37 A;  1HYI A;  2K1J A;  2LGK A;  3GV4 A;  4UP0 A;  2ECG A;  2CKL A;  2RSD A;  3QZV A;  1WEE A;  2RI7 A;  2CKL B;  3RPG B;  3GL6 A; 
#chains in the Genus database with same CATH topology
 2ECT A;  2AN6 A;  2XP0 A;  5TAB A;  5TDW A;  2D8U A;  2XOC A;  1WIL A;  2YHN A;  2CSV A;  3SOW A;  5D1L B;  2L7P A;  4TKP B;  3ZPV 1;  4YAT A;  2LN0 A;  2MA5 A;  3N9L A;  3N9O A;  3I2D A;  3O36 A;  4R2Y A;  2QJ0 A;  4FK5 A;  4F1P A;  4QF3 A;  2E6R A;  5K3Q A;  5EYA F;  2LXP C;  4PTB A;  4NN2 A;  2K16 A;  1VYX A;  3LRQ A;  2CON A;  2MUM A;  3M7K A;  5B8D A;  2CT2 A;  3FAO A;  2CRW A;  2I50 A;  4IC2 A;  4B7Y C;  4CCG X;  2YUC A;  3LJU X;  4YAD A;  2Y1N A;  4O62 A;  4R7E A;  5TRB A;  1CHC A;  2H0D A;  3FL2 A;  4AP4 A;  2KIZ A;  2QIZ A;  1F62 A;  2Y43 A;  4CA1 A;  1WEV A;  2H0D B;  4WZ0 A;  3SOU A;  3KDE C;  4AVX A;  1V87 A;  2JMI A;  1K2F A;  2HYE D;  4ZQL A;  2L80 A;  2EGM A;  2MA6 A;  2M85 A;  2FFW A;  1JM7 A;  4W4U A;  3FJU B;  3KQI A;  2VJE A;  3DPL R;  4L58 A;  2JUN A;  3O7A A;  1JM7 B;  2VJE B;  2G6Q A;  5SVY A;  2HDP A;  2CRR A;  2YSJ A;  5KH3 A;  3N9M A;  2FSA A;  3N9Q A;  3T7L A;  3DQV R;  2DJA A;  4QF2 A;  4I7D A;  4GNG A;  1Z6U A;  5TDR A;  5LKU A;  4FJC A;  3O70 A;  1WES A;  1RMD A;  4ZUX U;  3T9K A;  4S3O B;  2LGG A;  4MVT A;  5H1U A;  3ZPV E;  1LDJ B;  5J3X A;  2C2L A;  2YSM A;  2NAA A;  4XI1 A;  2JMJ A;  2B0O E;  2E6S A;  2JRJ A;  3E2D A;  2XOZ A;  2EXU A;  3ASL A;  4BHW A;  3U5N A;  2DX8 A;  1VD4 A;  3T6R A;  4L7X A;  2FD4 A;  2XEU A;  1VFY A;  2VPE A;  2CSZ A;  4X3G A;  3KV5 A;  3C5K A;  2LV9 A;  4WZ3 B;  3N9N A;  2RR4 A;  2K17 A;  3N9P A;  4ZDT A;  5SVX A;  3O33 A;  2KWN A;  2KKX A;  5H1T A;  4I7C A;  5LKX A;  1HYJ A;  5AIT A;  3H7H A;  3O34 A;  1WFK A;  2LGV A;  4GB0 A;  3ZNI A;  2OWA A;  5D1M B;  3U5O A;  2VJF A;  3V43 A;  2M6M A;  1IYM A;  2P57 A;  3SUB A;  4UP5 A;  3O47 A;  4R8P K;  2MD7 B;  3MHH A;  2C2V S;  2VJF B;  5TBN A;  1BOR A;  4H9D A;  4YBS A;  1E4U A;  2L43 A;  2JMD A;  1FBV A;  2YYR A;  4A4B A;  2L0B A;  2L5U A;  2F42 A;  2UZG A;  1ZBD B;  3MHS A;  4I7B A;  2YUR A;  3EB5 A;  1DCQ A;  4OGE A;  4V3K C;  3LDY A;  1Z60 A;  2VPB A;  3M62 A;  4FO9 A;  4S3O C;  5B76 A;  4C9Z A;  2IDA A;  2VNF A;  5FB1 A;  4BBQ A;  4P5O B;  1FP0 A;  3O35 A;  4AYC B;  4LKA A;  2MT5 A;  3LVQ E;  1WEQ A;  2YT5 A;  2YQL A;  3NG2 A;  3DWD A;  4N3W A;  1X4J A;  3RTR B;  4MSX A;  4WZ2 A;  4N4F A;  4LLB A;  3HCS A;  4YC9 A;  3ZVY A;  2K4D A;  2MNZ A;  3ZVZ B;  1MM3 A;  2PUY A;  2EGP A;  5LCW B;  4OGC A;  3PHD A;  2DSM A;  1MBM A;  4GNF A;  1WEW A;  3M99 A;  2M1R A;  2ECN A;  4UI9 B;  2FUU A;  5G0F A;  4YAB A;  5AIU A;  4IC3 A;  1DVP A;  2KWO A;  4FIP A;  2VPG A;  3LQJ A;  2YVR A;  1WEM A;  1Z2Q A;  2KR4 A;  2LGL A;  1WE9 A;  4GND A;  4V3L C;  3IHP A;  5LKT A;  4QQ4 A;  3ZTG A;  2BAY A;  3HTK C;  3PUR A;  2YQM A;  1JOC A;  2KYU A;  3L11 A;  2M3H A;  5G05 B;  4F52 B;  2XB1 A;  3SOX A;  2VPD A;  2LDR A;  2OXQ C;  4YBM A;  5B75 A;  2JM3 A;  4Z0O A;  2MD8 C;  2FUI A;  2KGG A;  2YU4 A;  4LJN A;  5B78 A;  4A0C D;  4Q6F A;  2KGI A;  2ECJ A;  2KE1 A;  3U5P A;  3LVR E;  3L1X A;  2KWJ A;  2KU3 A;  2QIC A;  3JUE A;  2ECV A;  4WA6 A;  5FEY A;  1U6G B;  3LQI A;  5KH7 A;  5SVI A;  5KH9 A;  3PUQ A;  2VP7 A;  4A49 A;  5JG6 A;  2F6N A;  2G45 A;  2LQ6 A;  3FM8 C;  2G43 A;  5D1K B;  3LQH A;  5FB0 A;  3C6W A;  3MDB C;  5SVI B;  4LAD B;  3HCU A;  5H9M A;  1MM2 A;  2EA6 A;  4AYC A;  5I3L A;  2EOD A;  2KRE A;  2LAU A;  1WEO A;  1XWH A;  2CSY A;  4LK9 A;  3U5M A;  2YW8 A;  4Z0R A;  5LKZ A;  1WEN A;  5B77 A;  2MIQ A;  5C11 A;  2D8S A;  2YHO A;  2IQJ A;  1WIM A;  3VK6 A;  4AUQ B;  3HCT A;  2PNX A;  2Y1M A;  1WGM A;  3L1Z B;  3Q1D A;  4A4C A;  2ECI A;  1N87 A;  2YRE A;  3KV6 A;  1X4U A;  5H1V A;  5B79 A;  5G04 B;  3EB6 A;  4YAX A;  4O64 A;  5DKA A;  2LXH C;  2KFT A;  2MKE A;  4YBT A;  1G25 A;  3PLW A;  2ECW A;  1T1H A;  5C13 A;  3SHB A;  3KNV A;  2E61 A;  1X4I A;  4GNE A;  4B86 C;  1WEU A;  1LDK C;  2L75 A;  4PPE A;  2LRI C;  3ZYQ A;  2MNY A;  3RPG C;  2KWK A;  1WEP A;  5DIN A;  2ZET C;  2F6J A;  5FER A;  3M63 A;  3O37 A;  2M13 A;  1HYI A;  2K1J A;  2LGK A;  3GV4 A;  3FAN A;  3DDT A;  4UP0 A;  3FEH A;  2XOY A;  2ECG A;  2CKL A;  2RSD A;  3QZV A;  2KKY A;  1WEE A;  2RI7 A;  2CKL B;  3RPG B;  3GL6 A; 
#chains in the Genus database with same CATH homology
 2ECT A;  2AN6 A;  5TAB A;  5TDW A;  1WIL A;  2YHN A;  3SOW A;  5D1L B;  4TKP B;  3ZPV 1;  4YAT A;  2LN0 A;  2MA5 A;  3N9L A;  3N9O A;  3I2D A;  3O36 A;  4R2Y A;  2QJ0 A;  4FK5 A;  4QF3 A;  2E6R A;  5EYA F;  2LXP C;  4PTB A;  4NN2 A;  2K16 A;  1VYX A;  3LRQ A;  2MUM A;  5B8D A;  2CT2 A;  2I50 A;  4IC2 A;  4B7Y C;  4CCG X;  2YUC A;  4YAD A;  2Y1N A;  4R7E A;  5TRB A;  1CHC A;  2H0D A;  3FL2 A;  4AP4 A;  2KIZ A;  2QIZ A;  1F62 A;  2Y43 A;  4CA1 A;  1WEV A;  2H0D B;  4WZ0 A;  3SOU A;  4AVX A;  1V87 A;  2JMI A;  1K2F A;  2HYE D;  4ZQL A;  2L80 A;  2MA6 A;  2M85 A;  1JM7 A;  4W4U A;  3KQI A;  2VJE A;  3DPL R;  4L58 A;  3O7A A;  1JM7 B;  2VJE B;  2G6Q A;  2HDP A;  2YSJ A;  5KH3 A;  3N9M A;  2FSA A;  3N9Q A;  3T7L A;  3DQV R;  4QF2 A;  4I7D A;  1Z6U A;  4GNG A;  5TDR A;  5LKU A;  4FJC A;  3O70 A;  1WES A;  1RMD A;  4ZUX U;  4S3O B;  2LGG A;  4MVT A;  5H1U A;  3ZPV E;  1LDJ B;  5J3X A;  2C2L A;  2YSM A;  2NAA A;  4XI1 A;  2JMJ A;  2E6S A;  2JRJ A;  3ASL A;  4BHW A;  3U5N A;  2DX8 A;  1VD4 A;  3T6R A;  4L7X A;  2XEU A;  1VFY A;  2VPE A;  2CSZ A;  4X3G A;  3KV5 A;  3C5K A;  2LV9 A;  4WZ3 B;  3N9N A;  2K17 A;  3N9P A;  4ZDT A;  3O33 A;  2KWN A;  5H1T A;  4I7C A;  5LKX A;  1HYJ A;  5AIT A;  3O34 A;  1WFK A;  2LGV A;  4GB0 A;  3ZNI A;  5D1M B;  3U5O A;  2VJF A;  3V43 A;  2M6M A;  1IYM A;  4UP5 A;  4R8P K;  2MD7 B;  3MHH A;  2C2V S;  2VJF B;  5TBN A;  1BOR A;  4YBS A;  1E4U A;  2L43 A;  2JMD A;  1FBV A;  2YYR A;  4A4B A;  2L0B A;  2L5U A;  2F42 A;  2UZG A;  1ZBD B;  3MHS A;  4I7B A;  2YUR A;  3EB5 A;  4V3K C;  1Z60 A;  2VPB A;  3M62 A;  4FO9 A;  4S3O C;  5B76 A;  4C9Z A;  2IDA A;  2VNF A;  5FB1 A;  4BBQ A;  4P5O B;  1FP0 A;  3O35 A;  4AYC B;  4LKA A;  2MT5 A;  1WEQ A;  2YT5 A;  2YQL A;  3NG2 A;  4N3W A;  1X4J A;  3RTR B;  4MSX A;  4WZ2 A;  4N4F A;  4LLB A;  3HCS A;  4YC9 A;  3ZVY A;  2K4D A;  2MNZ A;  3ZVZ B;  1MM3 A;  2PUY A;  2EGP A;  5LCW B;  3PHD A;  4GNF A;  1WEW A;  3M99 A;  2M1R A;  2ECN A;  4UI9 B;  2FUU A;  5G0F A;  4YAB A;  5AIU A;  4IC3 A;  1DVP A;  2KWO A;  4FIP A;  2VPG A;  3LQJ A;  1WEM A;  1Z2Q A;  2KR4 A;  2LGL A;  1WE9 A;  4GND A;  4V3L C;  3IHP A;  5LKT A;  3ZTG A;  2BAY A;  3HTK C;  3PUR A;  2YQM A;  1JOC A;  2KYU A;  3L11 A;  2M3H A;  5G05 B;  4F52 B;  2XB1 A;  3SOX A;  2VPD A;  2LDR A;  2OXQ C;  4YBM A;  5B75 A;  2MD8 C;  2FUI A;  2KGG A;  2YU4 A;  4LJN A;  5B78 A;  4A0C D;  4Q6F A;  2KGI A;  2ECJ A;  2KE1 A;  3U5P A;  3L1X A;  2KWJ A;  2KU3 A;  2QIC A;  2ECV A;  4WA6 A;  5FEY A;  1U6G B;  3LQI A;  5KH7 A;  5KH9 A;  3PUQ A;  2VP7 A;  4A49 A;  5JG6 A;  2F6N A;  2G45 A;  2LQ6 A;  5D1K B;  2G43 A;  3LQH A;  5FB0 A;  3C6W A;  4LAD B;  3HCU A;  5H9M A;  1MM2 A;  2EA6 A;  4AYC A;  5I3L A;  2EOD A;  2KRE A;  1WEO A;  1XWH A;  2CSY A;  4LK9 A;  3U5M A;  2YW8 A;  5LKZ A;  1WEN A;  5B77 A;  2MIQ A;  5C11 A;  2D8S A;  2YHO A;  1WIM A;  3VK6 A;  4AUQ B;  3HCT A;  2PNX A;  2Y1M A;  1WGM A;  3L1Z B;  4A4C A;  2ECI A;  1N87 A;  2YRE A;  3KV6 A;  1X4U A;  5H1V A;  5B79 A;  5G04 B;  3EB6 A;  4YAX A;  4O64 A;  5DKA A;  2LXH C;  2KFT A;  4YBT A;  1G25 A;  2ECW A;  1T1H A;  5C13 A;  3SHB A;  3KNV A;  1X4I A;  4GNE A;  4B86 C;  1WEU A;  1LDK C;  2L75 A;  4PPE A;  2LRI C;  3ZYQ A;  2MNY A;  3RPG C;  2KWK A;  1WEP A;  5DIN A;  2ZET C;  2F6J A;  5FER A;  3M63 A;  3O37 A;  1HYI A;  2K1J A;  2LGK A;  3GV4 A;  4UP0 A;  2ECG A;  2CKL A;  2RSD A;  3QZV A;  1WEE A;  2RI7 A;  2CKL B;  3RPG B;  3GL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...