2PNXA

The phd finger of ing4 in complex with an h3k4me3 histone peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
51
structure length
51
Chain Sequence
b'EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 4
publication title ING4 mediates crosstalk between histone H3 K4 trimethylation and H3 acetylation to attenuate cellular transformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 7
structure length 51
sequence length 51
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2pnxA00
3NG2A 1CHCA 2YREA 2LDRA 3RPGB 2LRIC 2QJ0A 2VPGA 4V3KC 2FUUA 2LGVA 4YAXA 2F42A 2ECWA 1Z60A 3GV4A 3U5PA 4W4UA 2VNFA 2F6NA 3HCSA 3MHHA 3RPGC 3ZVZB 2KWKA 3DPLR 4L7XA 5FERA 4QF3A 4I7DA 4A0CD 5KH9A 2PNXA 2LXHC 4I7CA 5I3LA 2RI7A 3LQHA 1WEQA 2QIZA 2ECGA 5FB0A 4WZ0A 2VJFB 2MUMA 4GNEA 1E4UA 4IC2A 2G45A 4UI9B 2LV9A 2ZETC 4B7YC 4O64A 1RMDA 1N87A 2YQLA 5KH3A 2YHNA 1JOCA 2K1JA 3N9NA 2YQMA 5AITA 2KR4A 4UP5A 3LRQA 3PUQA 2G6QA 4WZ2A 2EA6A 2QICA 2IDAA 1MM3A 2L5UA 2LN0A 2NAAA 2Y43A 2EGPA 1G25A 4YBTA 2CSZA 3MHSA 4A4BA 1WIMA 2YSJA 3SHBA 3U5MA 2E6RA 2M85A 3PHDA 3QZVA 4PPEA 2C2VS 3L1XA 2YSMA 1WESA 4QF2A 1Z2QA 4L58A 4AYCB 1FP0A 4BHWA 5B76A 2L75A 4LLBA 2C2LA 2MNYA 2VP7A 2JRJA 2CT2A 3ZVYA 2KFTA 1WILA 2LXPC 3L1ZB 3PURA 1VD4A 5J3XA 4PTBA 3LQJA 5FEYA 2YW8A 2JMJA 3VK6A 4YBMA 1WENA 2G43A 2L43A 4GNFA 5D1LB 5DINA 2JMDA 3L11A 1WEWA 3GL6A 5G05B 3KQIA 4GNGA 5LKXA 4B86C 3O7AA 3N9PA 4C9ZA 4CCGX 2ECTA 5AIUA 3ZPVE 3T7LA 3ZTGA 5C11A 2KYUA 2K4DA 1LDJB 1VFYA 4MVTA 1V87A 2YURA 1MM2A 4P5OB 2KWOA 2YUCA 3T6RA 2KREA 4LK9A 5LKTA 3N9LA 1X4IA 2YHOA 3ZYQA 2MD8C 2KU3A 1FBVA 3IHPA 3RTRB 3ZPV1 5B78A 5TDRA 4TKPB 5DKAA 5LKUA 2Y1NA 4A4CA 2VJEA 2FSAA 3EB5A 3I2DA 4GNDA 4LJNA 2YU4A 2KGGA 1Z6UA 3HCUA 2KE1A 4MSXA 2ECNA 1HYIA 2H0DB 1WEPA 3M63A 3O36A 2PUYA 2LGLA 1T1HA 2BAYA 5H1VA 2LGKA 4IC3A 4YATA 1HYJA 1X4JA 2YT5A 4Q6FA 4FIPA 5B79A 1WEMA 2FUIA 3O33A 2LQ6A 4AUQB 4F52B 2MNZA 4N4FA 4YBSA 2EODA 2RSDA 2KWJA 2KGIA 3KV5A 2MA5A 5D1MB 5G04B 1X4UA 1K2FA 5H9MA 4YADA 2DX8A 4V3LC 3HCTA 2CSYA 4XI1A 4LKAA 2XEUA 5LCWB 2VJFA 5B77A 4NN2A 4YABA 4R7EA 5TDWA 4UP0A 4A49A 2H0DA 1WEOA 4ZUXU 4AP4A 5B8DA 3C6WA 4YC9A 3HTKC 2CKLB 2HDPA 2YYRA 2ECVA 3KV6A 3LQIA 2OXQC 2VPEA 5JG6A 2M6MA 2VPBA 4ZDTA 4R2YA 5C13A 1IYMA 4I7BA 1JM7B 4AYCA 2JMIA 2K16A 3V43A 4BBQA 5TBNA 4AVXA 2MT5A 2MD7B 2HYED 2E6SA 5KH7A 3U5NA 5H1TA 1DVPA 4R8PK 4ZQLA 2VPDA 2M3HA 5FB1A 3SOUA 2F6JA 3ASLA 3O37A 4CA1A 4FO9A 1WE9A 3N9OA 4FK5A 2KWNA 1WEVA 1LDKC 2UZGA 3SOXA 2ECJA 1WEUA 2MIQA 5EYAF 4WZ3B 4LADB 3M99A 4FJCA 2L80A 1U6GB 3FL2A 1F62A 1VYXA 2VJEB 3N9QA 3DQVR 5H1UA 1WFKA 5B75A 3O34A 3O35A 4GB0A 3O70A 1WEEA 2M1RA 2ECIA 3C5KA 4S3OB 3U5OA 5D1KB 3ZNIA 2I50A 5G0FA 5TRBA 2D8SA 4WA6A 2LGGA 3KNVA 2K17A 5TABA 2L0BA 2CKLA 4N3WA 2XB1A 2Y1MA 3N9MA 2KIZA 4S3OC 1XWHA 1JM7A 1ZBDB 1WGMA 3M62A 5LKZA 2MA6A 4X3GA 3EB6A 3SOWA 1BORA 2AN6A
chains in the Genus database with same CATH superfamily
3NG2A 1CHCA 2YREA 2E61A 2LDRA 3RPGB 2LRIC 2QJ0A 2VPGA 4V3KC 3MDBC 2FUUA 2LGVA 4YAXA 2F42A 2ECWA 1Z60A 2MKEA 3GV4A 3U5PA 4W4UA 2VNFA 2F6NA 3HCSA 3KDEC 3MHHA 3RPGC 3ZVZB 2KWKA 3DPLR 4L7XA 5FERA 4QF3A 4I7DA 4A0CD 5KH9A 3T9KA 2PNXA 2LXHC 4I7CA 5I3LA 2RI7A 3LQHA 1WEQA 2QIZA 2ECGA 5FB0A 4WZ0A 4OGEA 2VJFB 2MUMA 4GNEA 1E4UA 4IC2A 2G45A 4UI9B 2LV9A 2ZETC 4B7YC 3FEHA 4O64A 1RMDA 1N87A 2YQLA 5KH3A 2YHNA 1JOCA 2K1JA 3N9NA 2YQMA 5AITA 2KR4A 3E2DA 4UP5A 3LRQA 3PUQA 2G6QA 4WZ2A 2OWAA 2EA6A 2QICA 2JM3A 2IDAA 1MM3A 2L5UA 4F1PA 2LN0A 2NAAA 2CSVA 2Y43A 2EGPA 1G25A 4YBTA 2CSZA 3MHSA 4A4BA 2D8UA 1WIMA 2YSJA 3SHBA 3U5MA 2E6RA 2M85A 3PHDA 3QZVA 4PPEA 2C2VS 3L1XA 2YSMA 1WESA 4QF2A 2FFWA 1Z2QA 4L58A 4AYCB 1FP0A 4BHWA 5B76A 2L75A 4LLBA 2C2LA 2MNYA 2VP7A 2JRJA 2CT2A 3ZVYA 3LDYA 2KFTA 1WILA 2LXPC 3L1ZB 3PURA 1VD4A 5J3XA 4PTBA 3LQJA 5FEYA 2YW8A 2JMJA 3VK6A 4YBMA 1WENA 2G43A 2L43A 4GNFA 5D1LB 2YVRA 5DINA 2JMDA 2L7PA 3FANA 3L11A 1WEWA 3GL6A 5G05B 3KQIA 4GNGA 5LKXA 2P57A 4B86C 3O7AA 3N9PA 4C9ZA 3DWDA 4CCGX 2ECTA 5AIUA 3ZPVE 3T7LA 3ZTGA 5C11A 2KYUA 2KKXA 2K4DA 1LDJB 1VFYA 4MVTA 1V87A 2YURA 1MM2A 4P5OB 2KWOA 2YUCA 5SVIB 3T6RA 2KREA 4LK9A 5LKTA 3N9LA 1X4IA 2YHOA 3ZYQA 2MD8C 2KU3A 1FBVA 3IHPA 3RTRB 3ZPV1 5B78A 5TDRA 4TKPB 5DKAA 2XP0A 3LVQE 5LKUA 2Y1NA 4A4CA 2VJEA 2FSAA 3EB5A 2CRRA 3I2DA 4GNDA 4LJNA 2YU4A 2KGGA 1Z6UA 3HCUA 2XOYA 2KE1A 4MSXA 2ECNA 1HYIA 2H0DB 1WEPA 3M63A 3O36A 2PUYA 2LGLA 1T1HA 2BAYA 5H1VA 2LGKA 3M7KA 4IC3A 4YATA 1HYJA 5SVXA 1X4JA 2YT5A 4Q6FA 4FIPA 5B79A 4OGCA 1WEMA 3DDTA 2FUIA 3O33A 2LQ6A 4AUQB 4F52B 3FAOA 4QQ4A 2MNZA 2LAUA 4N4FA 4YBSA 2EODA 2RSDA 2CONA 2KWJA 2KGIA 2JUNA 3KV5A 2MA5A 5D1MB 4O62A 5G04B 5SVIA 1X4UA 1K2FA 3SUBA 5H9MA 4YADA 2DX8A 4V3LC 3HCTA 2CSYA 4XI1A 4LKAA 2XEUA 5LCWB 2CRWA 2VJFA 5B77A 2XOZA 3LVRE 4NN2A 4YABA 1MBMA 3FM8C 4R7EA 3FJUB 3O47A 5TDWA 4UP0A 5K3QA 4A49A 2B0OE 2EXUA 2H0DA 1WEOA 2KKYA 4ZUXU 4AP4A 5B8DA 3C6WA 4YC9A 3HTKC 4H9DA 2CKLB 2HDPA 2YYRA 2ECVA 3KV6A 3LQIA 2OXQC 2VPEA 5JG6A 2M6MA 2VPBA 4ZDTA 4R2YA 5C13A 1IYMA 2XOCA 4I7BA 1JM7B 4AYCA 2JMIA 2K16A 3V43A 4BBQA 5TBNA 4AVXA 2MT5A 2MD7B 2HYED 2E6SA 5KH7A 3U5NA 5H1TA 1DVPA 4R8PK 4ZQLA 2VPDA 2M3HA 2DJAA 5FB1A 2RR4A 3SOUA 2F6JA 3ASLA 3O37A 4CA1A 4FO9A 1WE9A 3N9OA 4FK5A 3H7HA 2KWNA 1WEVA 1DCQA 1LDKC 2UZGA 3SOXA 2ECJA 1WEUA 2MIQA 2FD4A 5EYAF 4WZ3B 4Z0OA 4LADB 3M99A 3Q1DA 4FJCA 2L80A 5SVYA 1U6GB 3FL2A 1F62A 1VYXA 2VJEB 3N9QA 3DQVR 5H1UA 1WFKA 5B75A 3O34A 3O35A 4GB0A 3O70A 1WEEA 2M1RA 2ECIA 3C5KA 4Z0RA 4S3OB 3U5OA 5D1KB 3ZNIA 2I50A 5G0FA 3JUEA 5TRBA 2D8SA 4WA6A 2LGGA 3KNVA 2K17A 5TABA 2L0BA 2CKLA 4N3WA 2XB1A 2Y1MA 3N9MA 2KIZA 2DSMA 3LJUX 4S3OC 3PLWA 1XWHA 2EGMA 1JM7A 1ZBDB 1WGMA 3M62A 5LKZA 2MA6A 4X3GA 2IQJA 3EB6A 3SOWA 2M13A 1BORA 2AN6A
chains in the Genus database with same CATH topology
3NG2A 1CHCA 2YREA 2LDRA 3RPGB 2LRIC 2QJ0A 2VPGA 4V3KC 2FUUA 2LGVA 4YAXA 2F42A 2ECWA 1Z60A 3GV4A 3U5PA 4W4UA 2VNFA 2F6NA 3HCSA 3MHHA 3RPGC 3ZVZB 2KWKA 3DPLR 4L7XA 5FERA 4QF3A 4I7DA 4A0CD 5KH9A 2PNXA 2LXHC 4I7CA 5I3LA 2RI7A 3LQHA 1WEQA 2QIZA 2ECGA 5FB0A 4WZ0A 2VJFB 2MUMA 4GNEA 1E4UA 4IC2A 2G45A 4UI9B 2LV9A 2ZETC 4B7YC 4O64A 1RMDA 1N87A 2YQLA 5KH3A 2YHNA 1JOCA 2K1JA 3N9NA 2YQMA 5AITA 2KR4A 4UP5A 3LRQA 3PUQA 2G6QA 4WZ2A 2EA6A 2QICA 2IDAA 1MM3A 2L5UA 2LN0A 2NAAA 2Y43A 2EGPA 1G25A 4YBTA 2CSZA 3MHSA 4A4BA 1WIMA 2YSJA 3SHBA 3U5MA 2E6RA 2M85A 3PHDA 3QZVA 4PPEA 2C2VS 3L1XA 2YSMA 1WESA 4QF2A 1Z2QA 4L58A 4AYCB 1FP0A 4BHWA 5B76A 2L75A 4LLBA 2C2LA 2MNYA 2VP7A 2JRJA 2CT2A 3ZVYA 2KFTA 1WILA 2LXPC 3L1ZB 3PURA 1VD4A 5J3XA 4PTBA 3LQJA 5FEYA 2YW8A 2JMJA 3VK6A 4YBMA 1WENA 2G43A 2L43A 4GNFA 5D1LB 5DINA 2JMDA 3L11A 1WEWA 3GL6A 5G05B 3KQIA 4GNGA 5LKXA 4B86C 3O7AA 3N9PA 4C9ZA 4CCGX 2ECTA 5AIUA 3ZPVE 3T7LA 3ZTGA 5C11A 2KYUA 2K4DA 1LDJB 1VFYA 4MVTA 1V87A 2YURA 1MM2A 4P5OB 2KWOA 2YUCA 3T6RA 2KREA 4LK9A 5LKTA 3N9LA 1X4IA 2YHOA 3ZYQA 2MD8C 2KU3A 1FBVA 3IHPA 3RTRB 3ZPV1 5B78A 5TDRA 4TKPB 5DKAA 5LKUA 2Y1NA 4A4CA 2VJEA 2FSAA 3EB5A 3I2DA 4GNDA 4LJNA 2YU4A 2KGGA 1Z6UA 3HCUA 2KE1A 4MSXA 2ECNA 1HYIA 2H0DB 1WEPA 3M63A 3O36A 2PUYA 2LGLA 1T1HA 2BAYA 5H1VA 2LGKA 4IC3A 4YATA 1HYJA 1X4JA 2YT5A 4Q6FA 4FIPA 5B79A 1WEMA 2FUIA 3O33A 2LQ6A 4AUQB 4F52B 2MNZA 4N4FA 4YBSA 2EODA 2RSDA 2KWJA 2KGIA 3KV5A 2MA5A 5D1MB 5G04B 1X4UA 1K2FA 5H9MA 4YADA 2DX8A 4V3LC 3HCTA 2CSYA 4XI1A 4LKAA 2XEUA 5LCWB 2VJFA 5B77A 4NN2A 4YABA 4R7EA 5TDWA 4UP0A 4A49A 2H0DA 1WEOA 4ZUXU 4AP4A 5B8DA 3C6WA 4YC9A 3HTKC 2CKLB 2HDPA 2YYRA 2ECVA 3KV6A 3LQIA 2OXQC 2VPEA 5JG6A 2M6MA 2VPBA 4ZDTA 4R2YA 5C13A 1IYMA 4I7BA 1JM7B 4AYCA 2JMIA 2K16A 3V43A 4BBQA 5TBNA 4AVXA 2MT5A 2MD7B 2HYED 2E6SA 5KH7A 3U5NA 5H1TA 1DVPA 4R8PK 4ZQLA 2VPDA 2M3HA 5FB1A 3SOUA 2F6JA 3ASLA 3O37A 4CA1A 4FO9A 1WE9A 3N9OA 4FK5A 2KWNA 1WEVA 1LDKC 2UZGA 3SOXA 2ECJA 1WEUA 2MIQA 5EYAF 4WZ3B 4LADB 3M99A 4FJCA 2L80A 1U6GB 3FL2A 1F62A 1VYXA 2VJEB 3N9QA 3DQVR 5H1UA 1WFKA 5B75A 3O34A 3O35A 4GB0A 3O70A 1WEEA 2M1RA 2ECIA 3C5KA 4S3OB 3U5OA 5D1KB 3ZNIA 2I50A 5G0FA 5TRBA 2D8SA 4WA6A 2LGGA 3KNVA 2K17A 5TABA 2L0BA 2CKLA 4N3WA 2XB1A 2Y1MA 3N9MA 2KIZA 4S3OC 1XWHA 1JM7A 1ZBDB 1WGMA 3M62A 5LKZA 2MA6A 4X3GA 3EB6A 3SOWA 1BORA 2AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NG2 A;  1CHC A;  2YRE A;  2LDR A;  3RPG B;  2LRI C;  2QJ0 A;  2VPG A;  4V3K C;  2FUU A;  2LGV A;  4YAX A;  2F42 A;  2ECW A;  1Z60 A;  3GV4 A;  3U5P A;  4W4U A;  2VNF A;  2F6N A;  3HCS A;  3MHH A;  3RPG C;  3ZVZ B;  2KWK A;  3DPL R;  4L7X A;  5FER A;  4QF3 A;  4I7D A;  4A0C D;  5KH9 A;  2PNX A;  2LXH C;  4I7C A;  5I3L A;  2RI7 A;  3LQH A;  1WEQ A;  2QIZ A;  2ECG A;  5FB0 A;  4WZ0 A;  2VJF B;  2MUM A;  4GNE A;  1E4U A;  4IC2 A;  2G45 A;  4UI9 B;  2LV9 A;  2ZET C;  4B7Y C;  4O64 A;  1RMD A;  1N87 A;  2YQL A;  5KH3 A;  2YHN A;  1JOC A;  2K1J A;  3N9N A;  2YQM A;  5AIT A;  2KR4 A;  4UP5 A;  3LRQ A;  3PUQ A;  2G6Q A;  4WZ2 A;  2EA6 A;  2QIC A;  2IDA A;  1MM3 A;  2L5U A;  2LN0 A;  2NAA A;  2Y43 A;  2EGP A;  1G25 A;  4YBT A;  2CSZ A;  3MHS A;  4A4B A;  1WIM A;  2YSJ A;  3SHB A;  3U5M A;  2E6R A;  2M85 A;  3PHD A;  3QZV A;  4PPE A;  2C2V S;  3L1X A;  2YSM A;  1WES A;  4QF2 A;  1Z2Q A;  4L58 A;  4AYC B;  1FP0 A;  4BHW A;  5B76 A;  2L75 A;  4LLB A;  2C2L A;  2MNY A;  2VP7 A;  2JRJ A;  2CT2 A;  3ZVY A;  2KFT A;  1WIL A;  2LXP C;  3L1Z B;  3PUR A;  1VD4 A;  5J3X A;  4PTB A;  3LQJ A;  5FEY A;  2YW8 A;  2JMJ A;  3VK6 A;  4YBM A;  1WEN A;  2G43 A;  2L43 A;  4GNF A;  5D1L B;  5DIN A;  2JMD A;  3L11 A;  1WEW A;  3GL6 A;  5G05 B;  3KQI A;  4GNG A;  5LKX A;  4B86 C;  3O7A A;  3N9P A;  4C9Z A;  4CCG X;  2ECT A;  5AIU A;  3ZPV E;  3T7L A;  3ZTG A;  5C11 A;  2KYU A;  2K4D A;  1LDJ B;  1VFY A;  4MVT A;  1V87 A;  2YUR A;  1MM2 A;  4P5O B;  2KWO A;  2YUC A;  3T6R A;  2KRE A;  4LK9 A;  5LKT A;  3N9L A;  1X4I A;  2YHO A;  3ZYQ A;  2MD8 C;  2KU3 A;  1FBV A;  3IHP A;  3RTR B;  3ZPV 1;  5B78 A;  5TDR A;  4TKP B;  5DKA A;  5LKU A;  2Y1N A;  4A4C A;  2VJE A;  2FSA A;  3EB5 A;  3I2D A;  4GND A;  4LJN A;  2YU4 A;  2KGG A;  1Z6U A;  3HCU A;  2KE1 A;  4MSX A;  2ECN A;  1HYI A;  2H0D B;  1WEP A;  3M63 A;  3O36 A;  2PUY A;  2LGL A;  1T1H A;  2BAY A;  5H1V A;  2LGK A;  4IC3 A;  4YAT A;  1HYJ A;  1X4J A;  2YT5 A;  4Q6F A;  4FIP A;  5B79 A;  1WEM A;  2FUI A;  3O33 A;  2LQ6 A;  4AUQ B;  4F52 B;  2MNZ A;  4N4F A;  4YBS A;  2EOD A;  2RSD A;  2KWJ A;  2KGI A;  3KV5 A;  2MA5 A;  5D1M B;  5G04 B;  1X4U A;  1K2F A;  5H9M A;  4YAD A;  2DX8 A;  4V3L C;  3HCT A;  2CSY A;  4XI1 A;  4LKA A;  2XEU A;  5LCW B;  2VJF A;  5B77 A;  4NN2 A;  4YAB A;  4R7E A;  5TDW A;  4UP0 A;  4A49 A;  2H0D A;  1WEO A;  4ZUX U;  4AP4 A;  5B8D A;  3C6W A;  4YC9 A;  3HTK C;  2CKL B;  2HDP A;  2YYR A;  2ECV A;  3KV6 A;  3LQI A;  2OXQ C;  2VPE A;  5JG6 A;  2M6M A;  2VPB A;  4ZDT A;  4R2Y A;  5C13 A;  1IYM A;  4I7B A;  1JM7 B;  4AYC A;  2JMI A;  2K16 A;  3V43 A;  4BBQ A;  5TBN A;  4AVX A;  2MT5 A;  2MD7 B;  2HYE D;  2E6S A;  5KH7 A;  3U5N A;  5H1T A;  1DVP A;  4R8P K;  4ZQL A;  2VPD A;  2M3H A;  5FB1 A;  3SOU A;  2F6J A;  3ASL A;  3O37 A;  4CA1 A;  4FO9 A;  1WE9 A;  3N9O A;  4FK5 A;  2KWN A;  1WEV A;  1LDK C;  2UZG A;  3SOX A;  2ECJ A;  1WEU A;  2MIQ A;  5EYA F;  4WZ3 B;  4LAD B;  3M99 A;  4FJC A;  2L80 A;  1U6G B;  3FL2 A;  1F62 A;  1VYX A;  2VJE B;  3N9Q A;  3DQV R;  5H1U A;  1WFK A;  5B75 A;  3O34 A;  3O35 A;  4GB0 A;  3O70 A;  1WEE A;  2M1R A;  2ECI A;  3C5K A;  4S3O B;  3U5O A;  5D1K B;  3ZNI A;  2I50 A;  5G0F A;  5TRB A;  2D8S A;  4WA6 A;  2LGG A;  3KNV A;  2K17 A;  5TAB A;  2L0B A;  2CKL A;  4N3W A;  2XB1 A;  2Y1M A;  3N9M A;  2KIZ A;  4S3O C;  1XWH A;  1JM7 A;  1ZBD B;  1WGM A;  3M62 A;  5LKZ A;  2MA6 A;  4X3G A;  3EB6 A;  3SOW A;  1BOR A;  2AN6 A; 
#chains in the Genus database with same CATH topology
 3NG2 A;  1CHC A;  2YRE A;  2E61 A;  2LDR A;  3RPG B;  2LRI C;  2QJ0 A;  2VPG A;  4V3K C;  3MDB C;  2FUU A;  2LGV A;  4YAX A;  2F42 A;  2ECW A;  1Z60 A;  2MKE A;  3GV4 A;  3U5P A;  4W4U A;  2VNF A;  2F6N A;  3HCS A;  3KDE C;  3MHH A;  3RPG C;  3ZVZ B;  2KWK A;  3DPL R;  4L7X A;  5FER A;  4QF3 A;  4I7D A;  4A0C D;  5KH9 A;  3T9K A;  2PNX A;  2LXH C;  4I7C A;  5I3L A;  2RI7 A;  3LQH A;  1WEQ A;  2QIZ A;  2ECG A;  5FB0 A;  4WZ0 A;  4OGE A;  2VJF B;  2MUM A;  4GNE A;  1E4U A;  4IC2 A;  2G45 A;  4UI9 B;  2LV9 A;  2ZET C;  4B7Y C;  3FEH A;  4O64 A;  1RMD A;  1N87 A;  2YQL A;  5KH3 A;  2YHN A;  1JOC A;  2K1J A;  3N9N A;  2YQM A;  5AIT A;  2KR4 A;  3E2D A;  4UP5 A;  3LRQ A;  3PUQ A;  2G6Q A;  4WZ2 A;  2OWA A;  2EA6 A;  2QIC A;  2JM3 A;  2IDA A;  1MM3 A;  2L5U A;  4F1P A;  2LN0 A;  2NAA A;  2CSV A;  2Y43 A;  2EGP A;  1G25 A;  4YBT A;  2CSZ A;  3MHS A;  4A4B A;  2D8U A;  1WIM A;  2YSJ A;  3SHB A;  3U5M A;  2E6R A;  2M85 A;  3PHD A;  3QZV A;  4PPE A;  2C2V S;  3L1X A;  2YSM A;  1WES A;  4QF2 A;  2FFW A;  1Z2Q A;  4L58 A;  4AYC B;  1FP0 A;  4BHW A;  5B76 A;  2L75 A;  4LLB A;  2C2L A;  2MNY A;  2VP7 A;  2JRJ A;  2CT2 A;  3ZVY A;  3LDY A;  2KFT A;  1WIL A;  2LXP C;  3L1Z B;  3PUR A;  1VD4 A;  5J3X A;  4PTB A;  3LQJ A;  5FEY A;  2YW8 A;  2JMJ A;  3VK6 A;  4YBM A;  1WEN A;  2G43 A;  2L43 A;  4GNF A;  5D1L B;  2YVR A;  5DIN A;  2JMD A;  2L7P A;  3FAN A;  3L11 A;  1WEW A;  3GL6 A;  5G05 B;  3KQI A;  4GNG A;  5LKX A;  2P57 A;  4B86 C;  3O7A A;  3N9P A;  4C9Z A;  3DWD A;  4CCG X;  2ECT A;  5AIU A;  3ZPV E;  3T7L A;  3ZTG A;  5C11 A;  2KYU A;  2KKX A;  2K4D A;  1LDJ B;  1VFY A;  4MVT A;  1V87 A;  2YUR A;  1MM2 A;  4P5O B;  2KWO A;  2YUC A;  5SVI B;  3T6R A;  2KRE A;  4LK9 A;  5LKT A;  3N9L A;  1X4I A;  2YHO A;  3ZYQ A;  2MD8 C;  2KU3 A;  1FBV A;  3IHP A;  3RTR B;  3ZPV 1;  5B78 A;  5TDR A;  4TKP B;  5DKA A;  2XP0 A;  3LVQ E;  5LKU A;  2Y1N A;  4A4C A;  2VJE A;  2FSA A;  3EB5 A;  2CRR A;  3I2D A;  4GND A;  4LJN A;  2YU4 A;  2KGG A;  1Z6U A;  3HCU A;  2XOY A;  2KE1 A;  4MSX A;  2ECN A;  1HYI A;  2H0D B;  1WEP A;  3M63 A;  3O36 A;  2PUY A;  2LGL A;  1T1H A;  2BAY A;  5H1V A;  2LGK A;  3M7K A;  4IC3 A;  4YAT A;  1HYJ A;  5SVX A;  1X4J A;  2YT5 A;  4Q6F A;  4FIP A;  5B79 A;  4OGC A;  1WEM A;  3DDT A;  2FUI A;  3O33 A;  2LQ6 A;  4AUQ B;  4F52 B;  3FAO A;  4QQ4 A;  2MNZ A;  2LAU A;  4N4F A;  4YBS A;  2EOD A;  2RSD A;  2CON A;  2KWJ A;  2KGI A;  2JUN A;  3KV5 A;  2MA5 A;  5D1M B;  4O62 A;  5G04 B;  5SVI A;  1X4U A;  1K2F A;  3SUB A;  5H9M A;  4YAD A;  2DX8 A;  4V3L C;  3HCT A;  2CSY A;  4XI1 A;  4LKA A;  2XEU A;  5LCW B;  2CRW A;  2VJF A;  5B77 A;  2XOZ A;  3LVR E;  4NN2 A;  4YAB A;  1MBM A;  3FM8 C;  4R7E A;  3FJU B;  3O47 A;  5TDW A;  4UP0 A;  5K3Q A;  4A49 A;  2B0O E;  2EXU A;  2H0D A;  1WEO A;  2KKY A;  4ZUX U;  4AP4 A;  5B8D A;  3C6W A;  4YC9 A;  3HTK C;  4H9D A;  2CKL B;  2HDP A;  2YYR A;  2ECV A;  3KV6 A;  3LQI A;  2OXQ C;  2VPE A;  5JG6 A;  2M6M A;  2VPB A;  4ZDT A;  4R2Y A;  5C13 A;  1IYM A;  2XOC A;  4I7B A;  1JM7 B;  4AYC A;  2JMI A;  2K16 A;  3V43 A;  4BBQ A;  5TBN A;  4AVX A;  2MT5 A;  2MD7 B;  2HYE D;  2E6S A;  5KH7 A;  3U5N A;  5H1T A;  1DVP A;  4R8P K;  4ZQL A;  2VPD A;  2M3H A;  2DJA A;  5FB1 A;  2RR4 A;  3SOU A;  2F6J A;  3ASL A;  3O37 A;  4CA1 A;  4FO9 A;  1WE9 A;  3N9O A;  4FK5 A;  3H7H A;  2KWN A;  1WEV A;  1DCQ A;  1LDK C;  2UZG A;  3SOX A;  2ECJ A;  1WEU A;  2MIQ A;  2FD4 A;  5EYA F;  4WZ3 B;  4Z0O A;  4LAD B;  3M99 A;  3Q1D A;  4FJC A;  2L80 A;  5SVY A;  1U6G B;  3FL2 A;  1F62 A;  1VYX A;  2VJE B;  3N9Q A;  3DQV R;  5H1U A;  1WFK A;  5B75 A;  3O34 A;  3O35 A;  4GB0 A;  3O70 A;  1WEE A;  2M1R A;  2ECI A;  3C5K A;  4Z0R A;  4S3O B;  3U5O A;  5D1K B;  3ZNI A;  2I50 A;  5G0F A;  3JUE A;  5TRB A;  2D8S A;  4WA6 A;  2LGG A;  3KNV A;  2K17 A;  5TAB A;  2L0B A;  2CKL A;  4N3W A;  2XB1 A;  2Y1M A;  3N9M A;  2KIZ A;  2DSM A;  3LJU X;  4S3O C;  3PLW A;  1XWH A;  2EGM A;  1JM7 A;  1ZBD B;  1WGM A;  3M62 A;  5LKZ A;  2MA6 A;  4X3G A;  2IQJ A;  3EB6 A;  3SOW A;  2M13 A;  1BOR A;  2AN6 A; 
#chains in the Genus database with same CATH homology
 3NG2 A;  1CHC A;  2YRE A;  2LDR A;  3RPG B;  2LRI C;  2QJ0 A;  2VPG A;  4V3K C;  2FUU A;  2LGV A;  4YAX A;  2F42 A;  2ECW A;  1Z60 A;  3GV4 A;  3U5P A;  4W4U A;  2VNF A;  2F6N A;  3HCS A;  3MHH A;  3RPG C;  3ZVZ B;  2KWK A;  3DPL R;  4L7X A;  5FER A;  4QF3 A;  4I7D A;  4A0C D;  5KH9 A;  2PNX A;  2LXH C;  4I7C A;  5I3L A;  2RI7 A;  3LQH A;  1WEQ A;  2QIZ A;  2ECG A;  5FB0 A;  4WZ0 A;  2VJF B;  2MUM A;  4GNE A;  1E4U A;  4IC2 A;  2G45 A;  4UI9 B;  2LV9 A;  2ZET C;  4B7Y C;  4O64 A;  1RMD A;  1N87 A;  2YQL A;  5KH3 A;  2YHN A;  1JOC A;  2K1J A;  3N9N A;  2YQM A;  5AIT A;  2KR4 A;  4UP5 A;  3LRQ A;  3PUQ A;  2G6Q A;  4WZ2 A;  2EA6 A;  2QIC A;  2IDA A;  1MM3 A;  2L5U A;  2LN0 A;  2NAA A;  2Y43 A;  2EGP A;  1G25 A;  4YBT A;  2CSZ A;  3MHS A;  4A4B A;  1WIM A;  2YSJ A;  3SHB A;  3U5M A;  2E6R A;  2M85 A;  3PHD A;  3QZV A;  4PPE A;  2C2V S;  3L1X A;  2YSM A;  1WES A;  4QF2 A;  1Z2Q A;  4L58 A;  4AYC B;  1FP0 A;  4BHW A;  5B76 A;  2L75 A;  4LLB A;  2C2L A;  2MNY A;  2VP7 A;  2JRJ A;  2CT2 A;  3ZVY A;  2KFT A;  1WIL A;  2LXP C;  3L1Z B;  3PUR A;  1VD4 A;  5J3X A;  4PTB A;  3LQJ A;  5FEY A;  2YW8 A;  2JMJ A;  3VK6 A;  4YBM A;  1WEN A;  2G43 A;  2L43 A;  4GNF A;  5D1L B;  5DIN A;  2JMD A;  3L11 A;  1WEW A;  3GL6 A;  5G05 B;  3KQI A;  4GNG A;  5LKX A;  4B86 C;  3O7A A;  3N9P A;  4C9Z A;  4CCG X;  2ECT A;  5AIU A;  3ZPV E;  3T7L A;  3ZTG A;  5C11 A;  2KYU A;  2K4D A;  1LDJ B;  1VFY A;  4MVT A;  1V87 A;  2YUR A;  1MM2 A;  4P5O B;  2KWO A;  2YUC A;  3T6R A;  2KRE A;  4LK9 A;  5LKT A;  3N9L A;  1X4I A;  2YHO A;  3ZYQ A;  2MD8 C;  2KU3 A;  1FBV A;  3IHP A;  3RTR B;  3ZPV 1;  5B78 A;  5TDR A;  4TKP B;  5DKA A;  5LKU A;  2Y1N A;  4A4C A;  2VJE A;  2FSA A;  3EB5 A;  3I2D A;  4GND A;  4LJN A;  2YU4 A;  2KGG A;  1Z6U A;  3HCU A;  2KE1 A;  4MSX A;  2ECN A;  1HYI A;  2H0D B;  1WEP A;  3M63 A;  3O36 A;  2PUY A;  2LGL A;  1T1H A;  2BAY A;  5H1V A;  2LGK A;  4IC3 A;  4YAT A;  1HYJ A;  1X4J A;  2YT5 A;  4Q6F A;  4FIP A;  5B79 A;  1WEM A;  2FUI A;  3O33 A;  2LQ6 A;  4AUQ B;  4F52 B;  2MNZ A;  4N4F A;  4YBS A;  2EOD A;  2RSD A;  2KWJ A;  2KGI A;  3KV5 A;  2MA5 A;  5D1M B;  5G04 B;  1X4U A;  1K2F A;  5H9M A;  4YAD A;  2DX8 A;  4V3L C;  3HCT A;  2CSY A;  4XI1 A;  4LKA A;  2XEU A;  5LCW B;  2VJF A;  5B77 A;  4NN2 A;  4YAB A;  4R7E A;  5TDW A;  4UP0 A;  4A49 A;  2H0D A;  1WEO A;  4ZUX U;  4AP4 A;  5B8D A;  3C6W A;  4YC9 A;  3HTK C;  2CKL B;  2HDP A;  2YYR A;  2ECV A;  3KV6 A;  3LQI A;  2OXQ C;  2VPE A;  5JG6 A;  2M6M A;  2VPB A;  4ZDT A;  4R2Y A;  5C13 A;  1IYM A;  4I7B A;  1JM7 B;  4AYC A;  2JMI A;  2K16 A;  3V43 A;  4BBQ A;  5TBN A;  4AVX A;  2MT5 A;  2MD7 B;  2HYE D;  2E6S A;  5KH7 A;  3U5N A;  5H1T A;  1DVP A;  4R8P K;  4ZQL A;  2VPD A;  2M3H A;  5FB1 A;  3SOU A;  2F6J A;  3ASL A;  3O37 A;  4CA1 A;  4FO9 A;  1WE9 A;  3N9O A;  4FK5 A;  2KWN A;  1WEV A;  1LDK C;  2UZG A;  3SOX A;  2ECJ A;  1WEU A;  2MIQ A;  5EYA F;  4WZ3 B;  4LAD B;  3M99 A;  4FJC A;  2L80 A;  1U6G B;  3FL2 A;  1F62 A;  1VYX A;  2VJE B;  3N9Q A;  3DQV R;  5H1U A;  1WFK A;  5B75 A;  3O34 A;  3O35 A;  4GB0 A;  3O70 A;  1WEE A;  2M1R A;  2ECI A;  3C5K A;  4S3O B;  3U5O A;  5D1K B;  3ZNI A;  2I50 A;  5G0F A;  5TRB A;  2D8S A;  4WA6 A;  2LGG A;  3KNV A;  2K17 A;  5TAB A;  2L0B A;  2CKL A;  4N3W A;  2XB1 A;  2Y1M A;  3N9M A;  2KIZ A;  4S3O C;  1XWH A;  1JM7 A;  1ZBD B;  1WGM A;  3M62 A;  5LKZ A;  2MA6 A;  4X3G A;  3EB6 A;  3SOW A;  1BOR A;  2AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...