1WIMA

Solution structure of the ring finger domain of the human ubcm4-interacting protein 4
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
GSSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0161 protein
publication title Solution Structure of the RING finger Domain of the human UbcM4-interacting Protein 4
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 94
sequence length 94
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wimA00
3LQHA 3DQVR 3L1XA 3SOUA 4S3OC 5TRBA 2YURA 1MM2A 2K1JA 4AP4A 5D1KB 2F6NA 4ZQLA 1JOCA 2ECGA 2YHOA 3GL6A 2G43A 4ZUXU 2K17A 4C9ZA 3M63A 5G0FA 3LQIA 3EB6A 2M6MA 3T7LA 3ZVYA 4A4CA 2G6QA 4L7XA 2FSAA 2LV9A 4UI9B 3PUQA 2K16A 3SOXA 3VK6A 4YABA 5FB1A 3MHHA 1WILA 3T6RA 4Q6FA 3M62A 4A0CD 2VPGA 3U5MA 1FP0A 1E4UA 5DKAA 4L58A 2L5UA 2C2LA 5JG6A 4IC3A 3I2DA 4X3GA 3O33A 3GV4A 4YADA 2LGVA 2F6JA 2YU4A 3DPLR 4FK5A 2YQMA 1G25A 4UP5A 4MSXA 1WIMA 2NAAA 2KWNA 2MD8C 5FERA 5FB0A 5J3XA 3U5OA 2AN6A 4YBMA 1LDJB 2VNFA 2EGPA 1WEQA 2OXQC 4V3KC 3HCUA 2CT2A 1FBVA 3ZTGA 3ZNIA 2YSJA 3HCTA 2MA6A 3N9MA 1WGMA 2E6RA 5LCWB 3U5NA 2L75A 4YATA 3QZVA 2QJ0A 2EODA 2XEUA 3NG2A 5TBNA 2YUCA 2D8SA 2CKLB 4LKAA 2VJFB 1F62A 4AYCB 1VYXA 4R2YA 2DX8A 4P5OB 4GNGA 2QICA 3ZPV1 3C5KA 3ASLA 2ECIA 2MT5A 2Y43A 4QF2A 1HYJA 4YC9A 2KGGA 4PPEA 3RPGC 5DINA 2LGGA 2Y1NA 2ECVA 2KWJA 2CSYA 3SOWA 2KGIA 2JRJA 5KH7A 1WFKA 1X4JA 3ZPVE 4BBQA 1Z60A 2YW8A 1JM7B 4I7CA 2LN0A 4N4FA 2KREA 2CKLA 3O34A 2VJFA 4S3OB 1WESA 4GNDA 4YAXA 5AITA 3LQJA 2JMJA 4FIPA 2L80A 4FO9A 4A4BA 1XWHA 5C13A 4LADB 3N9LA 2YSMA 2ZETC 3C6WA 5B79A 4UP0A 1WEVA 2FUIA 5KH9A 3M99A 3IHPA 3O37A 2K4DA 2LGKA 2KYUA 4I7DA 2MD7B 5D1MB 1JM7A 4YBSA 1RMDA 2I50A 1Z2QA 2M3HA 1CHCA 3SHBA 3O36A 5LKXA 1WENA 2RI7A 5AIUA 2L0BA 3O35A 1BORA 1WEUA 2HDPA 4R7EA 3ZVZB 1LDKC 5B75A 4B86C 1HYIA 4GNEA 5C11A 1MM3A 2RSDA 2PUYA 2MNZA 2VJEB 4CCGX 2YQLA 4WZ3B 3HCSA 5EYAF 3KQIA 2ECNA 2KIZA 3N9PA 1X4UA 2LDRA 4IC2A 5FEYA 2H0DB 2MNYA 1WEEA 2LXPC 3KNVA 4MVTA 3O70A 4LK9A 2M1RA 4WA6A 4V3LC 3RTRB 2HYED 4NN2A 2VPEA 2PNXA 5H1VA 2Y1MA 4LJNA 4N3WA 5B78A 1U6GB 5LKUA 5G05B 1N87A 2VJEA 2BAYA 2CSZA 3KV6A 2KWKA 1K2FA 1ZBDB 3N9OA 5B76A 2VPBA 2MA5A 5B77A 4AYCA 2H0DA 2UZGA 4F52B 2YYRA 4FJCA 5H1TA 4YBTA 4O64A 3RPGB 3MHSA 2KR4A 2IDAA 4LLBA 4AUQB 2C2VS 4AVXA 2JMIA 5TDWA 4CA1A 1VD4A 2LQ6A 5D1LB 2MUMA 2KE1A 2VP7A 3PHDA 2XB1A 4A49A 4WZ2A 3N9QA 5TDRA 1X4IA 1V87A 3FL2A 2YHNA 5B8DA 4I7BA 2L43A 2E6SA 2QIZA 5KH3A 2ECJA 2LRIC 3PURA 3V43A 2ECWA 1VFYA 3L11A 2JMDA 4QF3A 3EB5A 2FUUA 4GNFA 5H1UA 3KV5A 5LKZA 1DVPA 1WE9A 2ECTA 4B7YC 3U5PA 2LGLA 5TABA 5H9MA 4BHWA 3ZYQA 3N9NA 4R8PK 2MIQA 3LRQA 2KWOA 1T1HA 2KFTA 3L1ZB 4XI1A 2YREA 2YT5A 4WZ0A 5LKTA 2EA6A 4ZDTA 5G04B 2M85A 1WEPA 1IYMA 3HTKC 2LXHC 1Z6UA 4W4UA 2F42A 2G45A 1WEOA 4PTBA 4TKPB 1WEWA 3O7AA 4GB0A 1WEMA 2VPDA 5I3LA 2KU3A
chains in the Genus database with same CATH superfamily
3LQHA 3DQVR 3L1XA 3SOUA 4S3OC 5TRBA 2YURA 1MM2A 2K1JA 4AP4A 5D1KB 2F6NA 4ZQLA 1JOCA 2ECGA 2YHOA 3GL6A 2G43A 4ZUXU 2K17A 4C9ZA 3M63A 5G0FA 3LQIA 3EB6A 2M6MA 3SUBA 3T7LA 3ZVYA 5SVIB 4A4CA 2G6QA 4L7XA 2FSAA 2LV9A 4UI9B 3PUQA 2K16A 3SOXA 2MKEA 3VK6A 4YABA 5FB1A 3MHHA 1WILA 3T6RA 3JUEA 5SVYA 4Q6FA 2KKYA 3M62A 4A0CD 2VPGA 3U5MA 1FP0A 1E4UA 5DKAA 2LAUA 4L58A 2L5UA 2C2LA 5JG6A 4IC3A 3I2DA 4X3GA 3O33A 3GV4A 5SVIA 4YADA 2LGVA 2F6JA 3LVQE 2YU4A 3DPLR 4FK5A 2YQMA 1G25A 4UP5A 4MSXA 1WIMA 2NAAA 2FFWA 2CONA 2KWNA 2MD8C 5FERA 5FB0A 2B0OE 5J3XA 3U5OA 2AN6A 4YBMA 1LDJB 2VNFA 2EGPA 1WEQA 2OXQC 4V3KC 3HCUA 2CT2A 1FBVA 1DCQA 3M7KA 3ZTGA 5K3QA 3ZNIA 2YSJA 3HCTA 2MA6A 3N9MA 1WGMA 2E6RA 5LCWB 3U5NA 2L75A 4YATA 3QZVA 2QJ0A 2EODA 3LVRE 2XEUA 3NG2A 5TBNA 2YUCA 2D8SA 2CKLB 4LKAA 2VJFB 2EXUA 4AYCB 4F1PA 1F62A 2JM3A 1VYXA 3FAOA 2IQJA 4R2YA 2DX8A 4P5OB 4GNGA 2YVRA 2QICA 3ZPV1 3C5KA 3ASLA 2ECIA 2MT5A 2Y43A 4QF2A 4QQ4A 1HYJA 4YC9A 2KGGA 4PPEA 3RPGC 5DINA 2LGGA 2Y1NA 2ECVA 2KWJA 2CSYA 3SOWA 2KGIA 2JRJA 5KH7A 1WFKA 1X4JA 3ZPVE 4BBQA 1Z60A 2YW8A 1JM7B 4I7CA 2LN0A 4N4FA 2KREA 2CKLA 2P57A 2VJFA 3O34A 2XOCA 4S3OB 1WESA 4GNDA 4YAXA 5AITA 3LQJA 2JMJA 4FIPA 2L80A 4FO9A 4A4BA 3Q1DA 1XWHA 5C13A 4LADB 3N9LA 2YSMA 2ZETC 3C6WA 5B79A 4UP0A 1WEVA 2FUIA 5KH9A 3M99A 3IHPA 3O37A 2XP0A 2K4DA 2LGKA 2KYUA 4I7DA 2MD7B 5D1MB 1JM7A 4YBSA 1RMDA 3FEHA 2I50A 1Z2QA 2M3HA 1CHCA 3SHBA 3O36A 5LKXA 1WENA 2RI7A 5AIUA 2L0BA 3O35A 1BORA 1WEUA 2HDPA 4R7EA 3E2DA 3ZVZB 1LDKC 5B75A 4B86C 1HYIA 4GNEA 5C11A 2L7PA 1MM3A 2OWAA 2RSDA 2PUYA 2MNZA 2VJEB 4CCGX 2YQLA 4WZ3B 3HCSA 2KKXA 5EYAF 3KQIA 2ECNA 2KIZA 3N9PA 2DSMA 1X4UA 4H9DA 2LDRA 4IC2A 5FEYA 2H0DB 3H7HA 2MNYA 3DWDA 2JUNA 1WEEA 2LXPC 2RR4A 3KNVA 4MVTA 3O70A 4LK9A 2M1RA 4WA6A 4V3LC 3RTRB 2HYED 4NN2A 2VPEA 3KDEC 2PNXA 5H1VA 2Y1MA 3T9KA 3MDBC 4LJNA 4O62A 4N3WA 5B78A 1U6GB 5LKUA 5G05B 1N87A 2E61A 2VJEA 2BAYA 2CSZA 3KV6A 2KWKA 1K2FA 2XOZA 1ZBDB 3N9OA 3PLWA 5B76A 2VPBA 2MA5A 5B77A 4AYCA 2H0DA 2UZGA 4F52B 2YYRA 3FJUB 4FJCA 2DJAA 5H1TA 4YBTA 4O64A 3RPGB 3MHSA 2KR4A 2IDAA 4LLBA 4AUQB 2C2VS 4AVXA 2JMIA 4OGCA 5TDWA 2XOYA 4CA1A 3FANA 1VD4A 2CRRA 4OGEA 3DDTA 2LQ6A 5D1LB 2MUMA 2KE1A 2VP7A 2CSVA 3PHDA 2XB1A 4A49A 4WZ2A 3N9QA 3FM8C 5TDRA 2FD4A 1X4IA 1V87A 3FL2A 2YHNA 5B8DA 4I7BA 3O47A 2L43A 2E6SA 4Z0RA 2D8UA 2QIZA 5KH3A 2ECJA 2LRIC 3PURA 3V43A 2ECWA 1VFYA 3L11A 2JMDA 2EGMA 4Z0OA 4QF3A 3EB5A 2FUUA 3LJUX 4GNFA 5H1UA 3KV5A 5LKZA 1DVPA 5SVXA 1WE9A 2ECTA 4B7YC 3U5PA 2LGLA 5TABA 2M13A 5H9MA 4BHWA 3ZYQA 3N9NA 3LDYA 4R8PK 2MIQA 3LRQA 2KWOA 1T1HA 2KFTA 3L1ZB 4XI1A 2YREA 2YT5A 1MBMA 4WZ0A 5LKTA 2EA6A 4ZDTA 5G04B 2M85A 1WEPA 1IYMA 3HTKC 2LXHC 1Z6UA 2CRWA 2F42A 2G45A 4W4UA 1WEOA 4PTBA 4TKPB 1WEWA 4GB0A 3O7AA 1WEMA 2VPDA 5I3LA 2KU3A
chains in the Genus database with same CATH topology
3LQHA 3DQVR 3L1XA 3SOUA 4S3OC 5TRBA 2YURA 1MM2A 2K1JA 4AP4A 5D1KB 2F6NA 4ZQLA 1JOCA 2ECGA 2YHOA 3GL6A 2G43A 4ZUXU 2K17A 4C9ZA 3M63A 5G0FA 3LQIA 3EB6A 2M6MA 3T7LA 3ZVYA 4A4CA 2G6QA 4L7XA 2FSAA 2LV9A 4UI9B 3PUQA 2K16A 3SOXA 3VK6A 4YABA 5FB1A 3MHHA 1WILA 3T6RA 4Q6FA 3M62A 4A0CD 2VPGA 3U5MA 1FP0A 1E4UA 5DKAA 4L58A 2L5UA 2C2LA 5JG6A 4IC3A 3I2DA 4X3GA 3O33A 3GV4A 4YADA 2LGVA 2F6JA 2YU4A 3DPLR 4FK5A 2YQMA 1G25A 4UP5A 4MSXA 1WIMA 2NAAA 2KWNA 2MD8C 5FERA 5FB0A 5J3XA 3U5OA 2AN6A 4YBMA 1LDJB 2VNFA 2EGPA 1WEQA 2OXQC 4V3KC 3HCUA 2CT2A 1FBVA 3ZTGA 3ZNIA 2YSJA 3HCTA 2MA6A 3N9MA 1WGMA 2E6RA 5LCWB 3U5NA 2L75A 4YATA 3QZVA 2QJ0A 2EODA 2XEUA 3NG2A 5TBNA 2YUCA 2D8SA 2CKLB 4LKAA 2VJFB 1F62A 4AYCB 1VYXA 4R2YA 2DX8A 4P5OB 4GNGA 2QICA 3ZPV1 3C5KA 3ASLA 2ECIA 2MT5A 2Y43A 4QF2A 1HYJA 4YC9A 2KGGA 4PPEA 3RPGC 5DINA 2LGGA 2Y1NA 2ECVA 2KWJA 2CSYA 3SOWA 2KGIA 2JRJA 5KH7A 1WFKA 1X4JA 3ZPVE 4BBQA 1Z60A 2YW8A 1JM7B 4I7CA 2LN0A 4N4FA 2KREA 2CKLA 3O34A 2VJFA 4S3OB 1WESA 4GNDA 4YAXA 5AITA 3LQJA 2JMJA 4FIPA 2L80A 4FO9A 4A4BA 1XWHA 5C13A 4LADB 3N9LA 2YSMA 2ZETC 3C6WA 5B79A 4UP0A 1WEVA 2FUIA 5KH9A 3M99A 3IHPA 3O37A 2K4DA 2LGKA 2KYUA 4I7DA 2MD7B 5D1MB 1JM7A 4YBSA 1RMDA 2I50A 1Z2QA 2M3HA 1CHCA 3SHBA 3O36A 5LKXA 1WENA 2RI7A 5AIUA 2L0BA 3O35A 1BORA 1WEUA 2HDPA 4R7EA 3ZVZB 1LDKC 5B75A 4B86C 1HYIA 4GNEA 5C11A 1MM3A 2RSDA 2PUYA 2MNZA 2VJEB 4CCGX 2YQLA 4WZ3B 3HCSA 5EYAF 3KQIA 2ECNA 2KIZA 3N9PA 1X4UA 2LDRA 4IC2A 5FEYA 2H0DB 2MNYA 1WEEA 2LXPC 3KNVA 4MVTA 3O70A 4LK9A 2M1RA 4WA6A 4V3LC 3RTRB 2HYED 4NN2A 2VPEA 2PNXA 5H1VA 2Y1MA 4LJNA 4N3WA 5B78A 1U6GB 5LKUA 5G05B 1N87A 2VJEA 2BAYA 2CSZA 3KV6A 2KWKA 1K2FA 1ZBDB 3N9OA 5B76A 2VPBA 2MA5A 5B77A 4AYCA 2H0DA 2UZGA 4F52B 2YYRA 4FJCA 5H1TA 4YBTA 4O64A 3RPGB 3MHSA 2KR4A 2IDAA 4LLBA 4AUQB 2C2VS 4AVXA 2JMIA 5TDWA 4CA1A 1VD4A 2LQ6A 5D1LB 2MUMA 2KE1A 2VP7A 3PHDA 2XB1A 4A49A 4WZ2A 3N9QA 5TDRA 1X4IA 1V87A 3FL2A 2YHNA 5B8DA 4I7BA 2L43A 2E6SA 2QIZA 5KH3A 2ECJA 2LRIC 3PURA 3V43A 2ECWA 1VFYA 3L11A 2JMDA 4QF3A 3EB5A 2FUUA 4GNFA 5H1UA 3KV5A 5LKZA 1DVPA 1WE9A 2ECTA 4B7YC 3U5PA 2LGLA 5TABA 5H9MA 4BHWA 3ZYQA 3N9NA 4R8PK 2MIQA 3LRQA 2KWOA 1T1HA 2KFTA 3L1ZB 4XI1A 2YREA 2YT5A 4WZ0A 5LKTA 2EA6A 4ZDTA 5G04B 2M85A 1WEPA 1IYMA 3HTKC 2LXHC 1Z6UA 4W4UA 2F42A 2G45A 1WEOA 4PTBA 4TKPB 1WEWA 3O7AA 4GB0A 1WEMA 2VPDA 5I3LA 2KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQH A;  3DQV R;  3L1X A;  3SOU A;  4S3O C;  5TRB A;  2YUR A;  1MM2 A;  2K1J A;  4AP4 A;  5D1K B;  2F6N A;  4ZQL A;  1JOC A;  2ECG A;  2YHO A;  3GL6 A;  2G43 A;  4ZUX U;  2K17 A;  4C9Z A;  3M63 A;  5G0F A;  3LQI A;  3EB6 A;  2M6M A;  3T7L A;  3ZVY A;  4A4C A;  2G6Q A;  4L7X A;  2FSA A;  2LV9 A;  4UI9 B;  3PUQ A;  2K16 A;  3SOX A;  3VK6 A;  4YAB A;  5FB1 A;  3MHH A;  1WIL A;  3T6R A;  4Q6F A;  3M62 A;  4A0C D;  2VPG A;  3U5M A;  1FP0 A;  1E4U A;  5DKA A;  4L58 A;  2L5U A;  2C2L A;  5JG6 A;  4IC3 A;  3I2D A;  4X3G A;  3O33 A;  3GV4 A;  4YAD A;  2LGV A;  2F6J A;  2YU4 A;  3DPL R;  4FK5 A;  2YQM A;  1G25 A;  4UP5 A;  4MSX A;  1WIM A;  2NAA A;  2KWN A;  2MD8 C;  5FER A;  5FB0 A;  5J3X A;  3U5O A;  2AN6 A;  4YBM A;  1LDJ B;  2VNF A;  2EGP A;  1WEQ A;  2OXQ C;  4V3K C;  3HCU A;  2CT2 A;  1FBV A;  3ZTG A;  3ZNI A;  2YSJ A;  3HCT A;  2MA6 A;  3N9M A;  1WGM A;  2E6R A;  5LCW B;  3U5N A;  2L75 A;  4YAT A;  3QZV A;  2QJ0 A;  2EOD A;  2XEU A;  3NG2 A;  5TBN A;  2YUC A;  2D8S A;  2CKL B;  4LKA A;  2VJF B;  1F62 A;  4AYC B;  1VYX A;  4R2Y A;  2DX8 A;  4P5O B;  4GNG A;  2QIC A;  3ZPV 1;  3C5K A;  3ASL A;  2ECI A;  2MT5 A;  2Y43 A;  4QF2 A;  1HYJ A;  4YC9 A;  2KGG A;  4PPE A;  3RPG C;  5DIN A;  2LGG A;  2Y1N A;  2ECV A;  2KWJ A;  2CSY A;  3SOW A;  2KGI A;  2JRJ A;  5KH7 A;  1WFK A;  1X4J A;  3ZPV E;  4BBQ A;  1Z60 A;  2YW8 A;  1JM7 B;  4I7C A;  2LN0 A;  4N4F A;  2KRE A;  2CKL A;  3O34 A;  2VJF A;  4S3O B;  1WES A;  4GND A;  4YAX A;  5AIT A;  3LQJ A;  2JMJ A;  4FIP A;  2L80 A;  4FO9 A;  4A4B A;  1XWH A;  5C13 A;  4LAD B;  3N9L A;  2YSM A;  2ZET C;  3C6W A;  5B79 A;  4UP0 A;  1WEV A;  2FUI A;  5KH9 A;  3M99 A;  3IHP A;  3O37 A;  2K4D A;  2LGK A;  2KYU A;  4I7D A;  2MD7 B;  5D1M B;  1JM7 A;  4YBS A;  1RMD A;  2I50 A;  1Z2Q A;  2M3H A;  1CHC A;  3SHB A;  3O36 A;  5LKX A;  1WEN A;  2RI7 A;  5AIU A;  2L0B A;  3O35 A;  1BOR A;  1WEU A;  2HDP A;  4R7E A;  3ZVZ B;  1LDK C;  5B75 A;  4B86 C;  1HYI A;  4GNE A;  5C11 A;  1MM3 A;  2RSD A;  2PUY A;  2MNZ A;  2VJE B;  4CCG X;  2YQL A;  4WZ3 B;  3HCS A;  5EYA F;  3KQI A;  2ECN A;  2KIZ A;  3N9P A;  1X4U A;  2LDR A;  4IC2 A;  5FEY A;  2H0D B;  2MNY A;  1WEE A;  2LXP C;  3KNV A;  4MVT A;  3O70 A;  4LK9 A;  2M1R A;  4WA6 A;  4V3L C;  3RTR B;  2HYE D;  4NN2 A;  2VPE A;  2PNX A;  5H1V A;  2Y1M A;  4LJN A;  4N3W A;  5B78 A;  1U6G B;  5LKU A;  5G05 B;  1N87 A;  2VJE A;  2BAY A;  2CSZ A;  3KV6 A;  2KWK A;  1K2F A;  1ZBD B;  3N9O A;  5B76 A;  2VPB A;  2MA5 A;  5B77 A;  4AYC A;  2H0D A;  2UZG A;  4F52 B;  2YYR A;  4FJC A;  5H1T A;  4YBT A;  4O64 A;  3RPG B;  3MHS A;  2KR4 A;  2IDA A;  4LLB A;  4AUQ B;  2C2V S;  4AVX A;  2JMI A;  5TDW A;  4CA1 A;  1VD4 A;  2LQ6 A;  5D1L B;  2MUM A;  2KE1 A;  2VP7 A;  3PHD A;  2XB1 A;  4A49 A;  4WZ2 A;  3N9Q A;  5TDR A;  1X4I A;  1V87 A;  3FL2 A;  2YHN A;  5B8D A;  4I7B A;  2L43 A;  2E6S A;  2QIZ A;  5KH3 A;  2ECJ A;  2LRI C;  3PUR A;  3V43 A;  2ECW A;  1VFY A;  3L11 A;  2JMD A;  4QF3 A;  3EB5 A;  2FUU A;  4GNF A;  5H1U A;  3KV5 A;  5LKZ A;  1DVP A;  1WE9 A;  2ECT A;  4B7Y C;  3U5P A;  2LGL A;  5TAB A;  5H9M A;  4BHW A;  3ZYQ A;  3N9N A;  4R8P K;  2MIQ A;  3LRQ A;  2KWO A;  1T1H A;  2KFT A;  3L1Z B;  4XI1 A;  2YRE A;  2YT5 A;  4WZ0 A;  5LKT A;  2EA6 A;  4ZDT A;  5G04 B;  2M85 A;  1WEP A;  1IYM A;  3HTK C;  2LXH C;  1Z6U A;  4W4U A;  2F42 A;  2G45 A;  1WEO A;  4PTB A;  4TKP B;  1WEW A;  3O7A A;  4GB0 A;  1WEM A;  2VPD A;  5I3L A;  2KU3 A; 
#chains in the Genus database with same CATH topology
 3LQH A;  3DQV R;  3L1X A;  3SOU A;  4S3O C;  5TRB A;  2YUR A;  1MM2 A;  2K1J A;  4AP4 A;  5D1K B;  2F6N A;  4ZQL A;  1JOC A;  2ECG A;  2YHO A;  3GL6 A;  2G43 A;  4ZUX U;  2K17 A;  4C9Z A;  3M63 A;  5G0F A;  3LQI A;  3EB6 A;  2M6M A;  3SUB A;  3T7L A;  3ZVY A;  5SVI B;  4A4C A;  2G6Q A;  4L7X A;  2FSA A;  2LV9 A;  4UI9 B;  3PUQ A;  2K16 A;  3SOX A;  2MKE A;  3VK6 A;  4YAB A;  5FB1 A;  3MHH A;  1WIL A;  3T6R A;  3JUE A;  5SVY A;  4Q6F A;  2KKY A;  3M62 A;  4A0C D;  2VPG A;  3U5M A;  1FP0 A;  1E4U A;  5DKA A;  2LAU A;  4L58 A;  2L5U A;  2C2L A;  5JG6 A;  4IC3 A;  3I2D A;  4X3G A;  3O33 A;  3GV4 A;  5SVI A;  4YAD A;  2LGV A;  2F6J A;  3LVQ E;  2YU4 A;  3DPL R;  4FK5 A;  2YQM A;  1G25 A;  4UP5 A;  4MSX A;  1WIM A;  2NAA A;  2FFW A;  2CON A;  2KWN A;  2MD8 C;  5FER A;  5FB0 A;  2B0O E;  5J3X A;  3U5O A;  2AN6 A;  4YBM A;  1LDJ B;  2VNF A;  2EGP A;  1WEQ A;  2OXQ C;  4V3K C;  3HCU A;  2CT2 A;  1FBV A;  1DCQ A;  3M7K A;  3ZTG A;  5K3Q A;  3ZNI A;  2YSJ A;  3HCT A;  2MA6 A;  3N9M A;  1WGM A;  2E6R A;  5LCW B;  3U5N A;  2L75 A;  4YAT A;  3QZV A;  2QJ0 A;  2EOD A;  3LVR E;  2XEU A;  3NG2 A;  5TBN A;  2YUC A;  2D8S A;  2CKL B;  4LKA A;  2VJF B;  2EXU A;  4AYC B;  4F1P A;  1F62 A;  2JM3 A;  1VYX A;  3FAO A;  2IQJ A;  4R2Y A;  2DX8 A;  4P5O B;  4GNG A;  2YVR A;  2QIC A;  3ZPV 1;  3C5K A;  3ASL A;  2ECI A;  2MT5 A;  2Y43 A;  4QF2 A;  4QQ4 A;  1HYJ A;  4YC9 A;  2KGG A;  4PPE A;  3RPG C;  5DIN A;  2LGG A;  2Y1N A;  2ECV A;  2KWJ A;  2CSY A;  3SOW A;  2KGI A;  2JRJ A;  5KH7 A;  1WFK A;  1X4J A;  3ZPV E;  4BBQ A;  1Z60 A;  2YW8 A;  1JM7 B;  4I7C A;  2LN0 A;  4N4F A;  2KRE A;  2CKL A;  2P57 A;  2VJF A;  3O34 A;  2XOC A;  4S3O B;  1WES A;  4GND A;  4YAX A;  5AIT A;  3LQJ A;  2JMJ A;  4FIP A;  2L80 A;  4FO9 A;  4A4B A;  3Q1D A;  1XWH A;  5C13 A;  4LAD B;  3N9L A;  2YSM A;  2ZET C;  3C6W A;  5B79 A;  4UP0 A;  1WEV A;  2FUI A;  5KH9 A;  3M99 A;  3IHP A;  3O37 A;  2XP0 A;  2K4D A;  2LGK A;  2KYU A;  4I7D A;  2MD7 B;  5D1M B;  1JM7 A;  4YBS A;  1RMD A;  3FEH A;  2I50 A;  1Z2Q A;  2M3H A;  1CHC A;  3SHB A;  3O36 A;  5LKX A;  1WEN A;  2RI7 A;  5AIU A;  2L0B A;  3O35 A;  1BOR A;  1WEU A;  2HDP A;  4R7E A;  3E2D A;  3ZVZ B;  1LDK C;  5B75 A;  4B86 C;  1HYI A;  4GNE A;  5C11 A;  2L7P A;  1MM3 A;  2OWA A;  2RSD A;  2PUY A;  2MNZ A;  2VJE B;  4CCG X;  2YQL A;  4WZ3 B;  3HCS A;  2KKX A;  5EYA F;  3KQI A;  2ECN A;  2KIZ A;  3N9P A;  2DSM A;  1X4U A;  4H9D A;  2LDR A;  4IC2 A;  5FEY A;  2H0D B;  3H7H A;  2MNY A;  3DWD A;  2JUN A;  1WEE A;  2LXP C;  2RR4 A;  3KNV A;  4MVT A;  3O70 A;  4LK9 A;  2M1R A;  4WA6 A;  4V3L C;  3RTR B;  2HYE D;  4NN2 A;  2VPE A;  3KDE C;  2PNX A;  5H1V A;  2Y1M A;  3T9K A;  3MDB C;  4LJN A;  4O62 A;  4N3W A;  5B78 A;  1U6G B;  5LKU A;  5G05 B;  1N87 A;  2E61 A;  2VJE A;  2BAY A;  2CSZ A;  3KV6 A;  2KWK A;  1K2F A;  2XOZ A;  1ZBD B;  3N9O A;  3PLW A;  5B76 A;  2VPB A;  2MA5 A;  5B77 A;  4AYC A;  2H0D A;  2UZG A;  4F52 B;  2YYR A;  3FJU B;  4FJC A;  2DJA A;  5H1T A;  4YBT A;  4O64 A;  3RPG B;  3MHS A;  2KR4 A;  2IDA A;  4LLB A;  4AUQ B;  2C2V S;  4AVX A;  2JMI A;  4OGC A;  5TDW A;  2XOY A;  4CA1 A;  3FAN A;  1VD4 A;  2CRR A;  4OGE A;  3DDT A;  2LQ6 A;  5D1L B;  2MUM A;  2KE1 A;  2VP7 A;  2CSV A;  3PHD A;  2XB1 A;  4A49 A;  4WZ2 A;  3N9Q A;  3FM8 C;  5TDR A;  2FD4 A;  1X4I A;  1V87 A;  3FL2 A;  2YHN A;  5B8D A;  4I7B A;  3O47 A;  2L43 A;  2E6S A;  4Z0R A;  2D8U A;  2QIZ A;  5KH3 A;  2ECJ A;  2LRI C;  3PUR A;  3V43 A;  2ECW A;  1VFY A;  3L11 A;  2JMD A;  2EGM A;  4Z0O A;  4QF3 A;  3EB5 A;  2FUU A;  3LJU X;  4GNF A;  5H1U A;  3KV5 A;  5LKZ A;  1DVP A;  5SVX A;  1WE9 A;  2ECT A;  4B7Y C;  3U5P A;  2LGL A;  5TAB A;  2M13 A;  5H9M A;  4BHW A;  3ZYQ A;  3N9N A;  3LDY A;  4R8P K;  2MIQ A;  3LRQ A;  2KWO A;  1T1H A;  2KFT A;  3L1Z B;  4XI1 A;  2YRE A;  2YT5 A;  1MBM A;  4WZ0 A;  5LKT A;  2EA6 A;  4ZDT A;  5G04 B;  2M85 A;  1WEP A;  1IYM A;  3HTK C;  2LXH C;  1Z6U A;  2CRW A;  2F42 A;  2G45 A;  4W4U A;  1WEO A;  4PTB A;  4TKP B;  1WEW A;  4GB0 A;  3O7A A;  1WEM A;  2VPD A;  5I3L A;  2KU3 A; 
#chains in the Genus database with same CATH homology
 3LQH A;  3DQV R;  3L1X A;  3SOU A;  4S3O C;  5TRB A;  2YUR A;  1MM2 A;  2K1J A;  4AP4 A;  5D1K B;  2F6N A;  4ZQL A;  1JOC A;  2ECG A;  2YHO A;  3GL6 A;  2G43 A;  4ZUX U;  2K17 A;  4C9Z A;  3M63 A;  5G0F A;  3LQI A;  3EB6 A;  2M6M A;  3T7L A;  3ZVY A;  4A4C A;  2G6Q A;  4L7X A;  2FSA A;  2LV9 A;  4UI9 B;  3PUQ A;  2K16 A;  3SOX A;  3VK6 A;  4YAB A;  5FB1 A;  3MHH A;  1WIL A;  3T6R A;  4Q6F A;  3M62 A;  4A0C D;  2VPG A;  3U5M A;  1FP0 A;  1E4U A;  5DKA A;  4L58 A;  2L5U A;  2C2L A;  5JG6 A;  4IC3 A;  3I2D A;  4X3G A;  3O33 A;  3GV4 A;  4YAD A;  2LGV A;  2F6J A;  2YU4 A;  3DPL R;  4FK5 A;  2YQM A;  1G25 A;  4UP5 A;  4MSX A;  1WIM A;  2NAA A;  2KWN A;  2MD8 C;  5FER A;  5FB0 A;  5J3X A;  3U5O A;  2AN6 A;  4YBM A;  1LDJ B;  2VNF A;  2EGP A;  1WEQ A;  2OXQ C;  4V3K C;  3HCU A;  2CT2 A;  1FBV A;  3ZTG A;  3ZNI A;  2YSJ A;  3HCT A;  2MA6 A;  3N9M A;  1WGM A;  2E6R A;  5LCW B;  3U5N A;  2L75 A;  4YAT A;  3QZV A;  2QJ0 A;  2EOD A;  2XEU A;  3NG2 A;  5TBN A;  2YUC A;  2D8S A;  2CKL B;  4LKA A;  2VJF B;  1F62 A;  4AYC B;  1VYX A;  4R2Y A;  2DX8 A;  4P5O B;  4GNG A;  2QIC A;  3ZPV 1;  3C5K A;  3ASL A;  2ECI A;  2MT5 A;  2Y43 A;  4QF2 A;  1HYJ A;  4YC9 A;  2KGG A;  4PPE A;  3RPG C;  5DIN A;  2LGG A;  2Y1N A;  2ECV A;  2KWJ A;  2CSY A;  3SOW A;  2KGI A;  2JRJ A;  5KH7 A;  1WFK A;  1X4J A;  3ZPV E;  4BBQ A;  1Z60 A;  2YW8 A;  1JM7 B;  4I7C A;  2LN0 A;  4N4F A;  2KRE A;  2CKL A;  3O34 A;  2VJF A;  4S3O B;  1WES A;  4GND A;  4YAX A;  5AIT A;  3LQJ A;  2JMJ A;  4FIP A;  2L80 A;  4FO9 A;  4A4B A;  1XWH A;  5C13 A;  4LAD B;  3N9L A;  2YSM A;  2ZET C;  3C6W A;  5B79 A;  4UP0 A;  1WEV A;  2FUI A;  5KH9 A;  3M99 A;  3IHP A;  3O37 A;  2K4D A;  2LGK A;  2KYU A;  4I7D A;  2MD7 B;  5D1M B;  1JM7 A;  4YBS A;  1RMD A;  2I50 A;  1Z2Q A;  2M3H A;  1CHC A;  3SHB A;  3O36 A;  5LKX A;  1WEN A;  2RI7 A;  5AIU A;  2L0B A;  3O35 A;  1BOR A;  1WEU A;  2HDP A;  4R7E A;  3ZVZ B;  1LDK C;  5B75 A;  4B86 C;  1HYI A;  4GNE A;  5C11 A;  1MM3 A;  2RSD A;  2PUY A;  2MNZ A;  2VJE B;  4CCG X;  2YQL A;  4WZ3 B;  3HCS A;  5EYA F;  3KQI A;  2ECN A;  2KIZ A;  3N9P A;  1X4U A;  2LDR A;  4IC2 A;  5FEY A;  2H0D B;  2MNY A;  1WEE A;  2LXP C;  3KNV A;  4MVT A;  3O70 A;  4LK9 A;  2M1R A;  4WA6 A;  4V3L C;  3RTR B;  2HYE D;  4NN2 A;  2VPE A;  2PNX A;  5H1V A;  2Y1M A;  4LJN A;  4N3W A;  5B78 A;  1U6G B;  5LKU A;  5G05 B;  1N87 A;  2VJE A;  2BAY A;  2CSZ A;  3KV6 A;  2KWK A;  1K2F A;  1ZBD B;  3N9O A;  5B76 A;  2VPB A;  2MA5 A;  5B77 A;  4AYC A;  2H0D A;  2UZG A;  4F52 B;  2YYR A;  4FJC A;  5H1T A;  4YBT A;  4O64 A;  3RPG B;  3MHS A;  2KR4 A;  2IDA A;  4LLB A;  4AUQ B;  2C2V S;  4AVX A;  2JMI A;  5TDW A;  4CA1 A;  1VD4 A;  2LQ6 A;  5D1L B;  2MUM A;  2KE1 A;  2VP7 A;  3PHD A;  2XB1 A;  4A49 A;  4WZ2 A;  3N9Q A;  5TDR A;  1X4I A;  1V87 A;  3FL2 A;  2YHN A;  5B8D A;  4I7B A;  2L43 A;  2E6S A;  2QIZ A;  5KH3 A;  2ECJ A;  2LRI C;  3PUR A;  3V43 A;  2ECW A;  1VFY A;  3L11 A;  2JMD A;  4QF3 A;  3EB5 A;  2FUU A;  4GNF A;  5H1U A;  3KV5 A;  5LKZ A;  1DVP A;  1WE9 A;  2ECT A;  4B7Y C;  3U5P A;  2LGL A;  5TAB A;  5H9M A;  4BHW A;  3ZYQ A;  3N9N A;  4R8P K;  2MIQ A;  3LRQ A;  2KWO A;  1T1H A;  2KFT A;  3L1Z B;  4XI1 A;  2YRE A;  2YT5 A;  4WZ0 A;  5LKT A;  2EA6 A;  4ZDT A;  5G04 B;  2M85 A;  1WEP A;  1IYM A;  3HTK C;  2LXH C;  1Z6U A;  4W4U A;  2F42 A;  2G45 A;  1WEO A;  4PTB A;  4TKP B;  1WEW A;  3O7A A;  4GB0 A;  1WEM A;  2VPD A;  5I3L A;  2KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...