1WIMA

Solution structure of the ring finger domain of the human ubcm4-interacting protein 4
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
GSSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0161 protein
publication title Solution Structure of the RING finger Domain of the human UbcM4-interacting Protein 4
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 94
sequence length 94
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wimA00
3FL2A 2RI7A 2UZGA 4I7CA 4ZUXU 2ECTA 2M3HA 2KR4A 4GNEA 5B75A 2LGKA 5LKTA 4O64A 4WZ3B 2CKLA 2LXHC 2ECIA 4ZQLA 1HYJA 2BAYA 2ECJA 5DKAA 2YU4A 4YBTA 2YSJA 3HTKC 2CKLB 1WILA 4WZ0A 2KWNA 2VPDA 1WEOA 3PHDA 2VPGA 2QIZA 2MNZA 2JRJA 2C2VS 4TKPB 4GNGA 4AUQB 3N9QA 2EODA 2NAAA 2KWOA 1T1HA 2YQMA 3SOXA 3ZVYA 4MVTA 1BORA 4R2YA 2LV9A 3L1ZB 2F6JA 3ZPVE 3U5PA 1LDKC 2LN0A 5TBNA 2C2LA 3T6RA 3ASLA 5G04B 5J3XA 5KH9A 4AP4A 4IC3A 4A0CD 3KV6A 3I2DA 2HDPA 1JOCA 1X4UA 2F6NA 2CSZA 4I7DA 1WEPA 2KE1A 4A4BA 3RPGB 4L58A 4YBSA 4XI1A 3DPLR 5LKZA 3ZNIA 3M62A 2MNYA 2YT5A 2PUYA 5FEYA 5DINA 3M63A 4A4CA 2K17A 2MA5A 1Z60A 1VD4A 4WZ2A 2F42A 3MHSA 4NN2A 1WFKA 5I3LA 2YHNA 2JMIA 2LGVA 4GNFA 4W4UA 2L0BA 1WEVA 4B86C 1VFYA 4V3KC 2KYUA 3RPGC 2L80A 2Y43A 4N4FA 2CT2A 4LK9A 4X3GA 3LQJA 2HYED 3MHHA 1X4IA 1IYMA 5D1KB 4ZDTA 1V87A 1WGMA 1ZBDB 4L7XA 2VNFA 2YYRA 2E6RA 2XB1A 4Q6FA 5TRBA 1Z2QA 2K16A 4IC2A 5B79A 3HCTA 5AITA 2VJEA 4UI9B 1XWHA 3EB5A 4CA1A 4S3OB 3O34A 5H1TA 2MUMA 2VJEB 4R8PK 4FJCA 3NG2A 2KGGA 4PPEA 1WEMA 4BHWA 2L75A 3SOWA 2KFTA 4YAXA 1WENA 4N3WA 4FK5A 5D1MB 3U5OA 5B77A 4AYCA 1WEQA 3L11A 1VYXA 2M6MA 3LQIA 5G05B 1U6GB 1Z6UA 2KREA 3O37A 4LJNA 5G0FA 4AYCB 2YSMA 4S3OC 5B8DA 3O36A 3KV5A 2YQLA 3O35A 3GL6A 4I7BA 2LDRA 2VPEA 4LLBA 3IHPA 2MIQA 3KQIA 2K4DA 4B7YC 2EGPA 5EYAF 4BBQA 5TDRA 1JM7B 1CHCA 2ECVA 1FP0A 2MD8C 3SOUA 2YURA 2ZETC 2Y1NA 5H9MA 3HCSA 2LGLA 1WIMA 3O7AA 2QICA 4QF2A 2OXQC 2YUCA 1WEUA 3HCUA 1G25A 3N9OA 5B76A 4A49A 1E4UA 3N9MA 2G6QA 4YADA 5FERA 2G45A 2VPBA 2VP7A 4C9ZA 2Y1MA 2PNXA 2LQ6A 1WEWA 1HYIA 3T7LA 1WESA 4UP0A 4F52B 3GV4A 1F62A 4QF3A 2L5UA 3ZYQA 4FIPA 1N87A 4LKAA 1X4JA 2L43A 2E6SA 2YHOA 4GB0A 1DVPA 4R7EA 2LGGA 2XEUA 1K2FA 1RMDA 3O33A 5FB0A 4MSXA 3U5NA 2YW8A 2K1JA 2ECGA 1WEEA 3VK6A 3L1XA 5B78A 3ZPV1 2I50A 2LXPC 3DQVR 3SHBA 2ECNA 2KGIA 3LRQA 5H1UA 2KWKA 1FBVA 4YATA 4P5OB 3U5MA 5C13A 1WE9A 2FUIA 3EB6A 3N9PA 5LCWB 3N9LA 2EA6A 2VJFA 1MM3A 4PTBA 2ECWA 5H1VA 2IDAA 3M99A 4AVXA 1JM7A 3LQHA 3O70A 2VJFB 2M85A 2DX8A 2KWJA 4V3LC 2YREA 2RSDA 2M1RA 5AIUA 3ZTGA 4WA6A 4YC9A 5JG6A 4CCGX 1MM2A 5TABA 3QZVA 3PURA 2KIZA 2D8SA 4FO9A 5C11A 4YBMA 2QJ0A 4UP5A 5KH3A 3C6WA 3ZVZB 2AN6A 2H0DA 3N9NA 3RTRB 4YABA 3KNVA 2MT5A 2LRIC 4LADB 2JMDA 4GNDA 5KH7A 2G43A 2MD7B 5LKXA 5LKUA 2H0DB 2MA6A 1LDJB 2FSAA 2KU3A 5TDWA 2FUUA 3V43A 2JMJA 5D1LB 5FB1A 3PUQA 3C5KA 2CSYA
chains in the Genus database with same CATH superfamily
3FL2A 2RI7A 2UZGA 2XP0A 4I7CA 5SVIA 4ZUXU 2ECTA 2M3HA 2KR4A 4GNEA 5B75A 2LGKA 5LKTA 4O64A 4WZ3B 2CKLA 4OGEA 2LXHC 2ECIA 5SVIB 2CRWA 4ZQLA 1HYJA 2BAYA 2ECJA 5DKAA 2YU4A 4YBTA 2YSJA 3HTKC 2CKLB 1WILA 4WZ0A 2KWNA 2VPDA 1WEOA 3PHDA 3T9KA 2VPGA 2QIZA 2EGMA 2MNZA 2JRJA 2C2VS 3FAOA 4TKPB 4GNGA 4AUQB 3N9QA 2EODA 2NAAA 2KWOA 1T1HA 2YQMA 3SOXA 3ZVYA 4MVTA 1BORA 4R2YA 2LV9A 3L1ZB 2DJAA 2F6JA 3ZPVE 2M13A 3U5PA 1LDKC 2LN0A 3LJUX 5TBNA 2C2LA 3T6RA 3ASLA 5G04B 2YVRA 5SVXA 5J3XA 5KH9A 2XOZA 4AP4A 4IC3A 4A0CD 3KV6A 3I2DA 2HDPA 2KKXA 1JOCA 1X4UA 2CRRA 3E2DA 2F6NA 2CSZA 4I7DA 1WEPA 2KE1A 2MKEA 4A4BA 3RPGB 4L58A 4YBSA 3LDYA 4XI1A 3DPLR 5LKZA 3ZNIA 3M62A 3O47A 2MNYA 2YT5A 2PUYA 5FEYA 5DINA 3M63A 4A4CA 2K17A 2MA5A 1Z60A 1VD4A 3FJUB 4WZ2A 2F42A 2JM3A 3MHSA 2D8UA 4NN2A 1WFKA 5I3LA 2EXUA 2YHNA 2JMIA 2LGVA 4GNFA 4W4UA 2L0BA 1WEVA 4B86C 2E61A 1VFYA 4V3KC 2KYUA 3RPGC 2L80A 2Y43A 4N4FA 2CT2A 3LVRE 4LK9A 4X3GA 3LQJA 2HYED 3MHHA 1X4IA 1IYMA 5D1KB 4ZDTA 1V87A 1WGMA 1ZBDB 4L7XA 2VNFA 2DSMA 2YYRA 2E6RA 2XB1A 4Q6FA 5TRBA 1Z2QA 2K16A 4IC2A 5B79A 3HCTA 5AITA 2VJEA 4UI9B 1XWHA 3EB5A 4CA1A 4S3OB 3O34A 3H7HA 5H1TA 2MUMA 4Z0OA 2VJEB 2XOYA 4R8PK 4FJCA 3NG2A 2KGGA 4PPEA 1WEMA 4BHWA 2L75A 3SOWA 2KFTA 4YAXA 2CSVA 1WENA 4N3WA 2JUNA 4FK5A 5SVYA 5D1MB 3U5OA 5B77A 4AYCA 1WEQA 3L11A 1VYXA 2M6MA 3LQIA 5G05B 1U6GB 1Z6UA 2KREA 3O37A 4LJNA 2XOCA 5G0FA 4AYCB 2YSMA 4S3OC 5B8DA 3O36A 2FD4A 3KV5A 5K3QA 2B0OE 2YQLA 3O35A 3GL6A 4I7BA 3KDEC 2LDRA 2VPEA 3JUEA 3DWDA 4LLBA 2IQJA 3IHPA 2MIQA 3KQIA 2K4DA 4B7YC 2EGPA 5EYAF 4BBQA 5TDRA 1JM7B 1CHCA 2ECVA 1FP0A 2MD8C 3SOUA 2YURA 2ZETC 2Y1NA 5H9MA 3HCSA 2LGLA 1WIMA 3O7AA 2QICA 4QF2A 2FFWA 3FM8C 4O62A 4Z0RA 2OXQC 2YUCA 1WEUA 3HCUA 1G25A 3N9OA 3PLWA 5B76A 4A49A 1E4UA 3N9MA 2G6QA 4YADA 5FERA 2G45A 2VPBA 2VP7A 4C9ZA 2Y1MA 2PNXA 2LQ6A 1WEWA 1HYIA 3T7LA 1WESA 4UP0A 4F1PA 4F52B 3GV4A 2RR4A 2OWAA 3DDTA 1MBMA 1F62A 4QF3A 2L5UA 3ZYQA 4FIPA 1N87A 2LAUA 4LKAA 1X4JA 2L43A 2E6SA 2YHOA 3MDBC 1DVPA 4GB0A 3SUBA 4R7EA 2LGGA 2XEUA 1K2FA 1RMDA 3O33A 5FB0A 4MSXA 3U5NA 2YW8A 2K1JA 2ECGA 1WEEA 3VK6A 3L1XA 5B78A 3ZPV1 2I50A 2LXPC 3DQVR 3SHBA 2ECNA 2KGIA 3LRQA 5H1UA 2KWKA 1FBVA 4YATA 4P5OB 1DCQA 3U5MA 4H9DA 2CONA 5C13A 1WE9A 2FUIA 3M7KA 3EB6A 3N9PA 5LCWB 3LVQE 3N9LA 2L7PA 2EA6A 2VJFA 2P57A 1MM3A 4PTBA 2ECWA 5H1VA 2IDAA 3M99A 4AVXA 1JM7A 3FEHA 3LQHA 3O70A 2VJFB 2M85A 2DX8A 2KWJA 4V3LC 2YREA 2RSDA 2M1RA 5AIUA 3ZTGA 4WA6A 4YC9A 5JG6A 4CCGX 1MM2A 5TABA 3QZVA 3FANA 3PURA 2KIZA 2D8SA 4FO9A 5C11A 4YBMA 2QJ0A 4UP5A 3Q1DA 5KH3A 3C6WA 3ZVZB 2AN6A 2H0DA 3N9NA 4QQ4A 3RTRB 4YABA 3KNVA 2MT5A 2LRIC 4LADB 2JMDA 4GNDA 5KH7A 2G43A 2MD7B 5LKXA 5LKUA 2H0DB 2MA6A 1LDJB 2FSAA 4OGCA 2KU3A 5TDWA 2FUUA 3V43A 2JMJA 5D1LB 2KKYA 3PUQA 5FB1A 3C5KA 2CSYA
chains in the Genus database with same CATH topology
3FL2A 2RI7A 2UZGA 4I7CA 4ZUXU 2ECTA 2M3HA 2KR4A 4GNEA 5B75A 2LGKA 5LKTA 4O64A 4WZ3B 2CKLA 2LXHC 2ECIA 4ZQLA 1HYJA 2BAYA 2ECJA 5DKAA 2YU4A 4YBTA 2YSJA 3HTKC 2CKLB 1WILA 4WZ0A 2KWNA 2VPDA 1WEOA 3PHDA 2VPGA 2QIZA 2MNZA 2JRJA 2C2VS 4TKPB 4GNGA 4AUQB 3N9QA 2EODA 2NAAA 2KWOA 1T1HA 2YQMA 3SOXA 3ZVYA 4MVTA 1BORA 4R2YA 2LV9A 3L1ZB 2F6JA 3ZPVE 3U5PA 1LDKC 2LN0A 5TBNA 2C2LA 3T6RA 3ASLA 5G04B 5J3XA 5KH9A 4AP4A 4IC3A 4A0CD 3KV6A 3I2DA 2HDPA 1JOCA 1X4UA 2F6NA 2CSZA 4I7DA 1WEPA 2KE1A 4A4BA 3RPGB 4L58A 4YBSA 4XI1A 3DPLR 5LKZA 3ZNIA 3M62A 2MNYA 2YT5A 2PUYA 5FEYA 5DINA 3M63A 4A4CA 2K17A 2MA5A 1Z60A 1VD4A 4WZ2A 2F42A 3MHSA 4NN2A 1WFKA 5I3LA 2YHNA 2JMIA 2LGVA 4GNFA 4W4UA 2L0BA 1WEVA 4B86C 1VFYA 4V3KC 2KYUA 3RPGC 2L80A 2Y43A 4N4FA 2CT2A 4LK9A 4X3GA 3LQJA 2HYED 3MHHA 1X4IA 1IYMA 5D1KB 4ZDTA 1V87A 1WGMA 1ZBDB 4L7XA 2VNFA 2YYRA 2E6RA 2XB1A 4Q6FA 5TRBA 1Z2QA 2K16A 4IC2A 5B79A 3HCTA 5AITA 2VJEA 4UI9B 1XWHA 3EB5A 4CA1A 4S3OB 3O34A 5H1TA 2MUMA 2VJEB 4R8PK 4FJCA 3NG2A 2KGGA 4PPEA 1WEMA 4BHWA 2L75A 3SOWA 2KFTA 4YAXA 1WENA 4N3WA 4FK5A 5D1MB 3U5OA 5B77A 4AYCA 1WEQA 3L11A 1VYXA 2M6MA 3LQIA 5G05B 1U6GB 1Z6UA 2KREA 3O37A 4LJNA 5G0FA 4AYCB 2YSMA 4S3OC 5B8DA 3O36A 3KV5A 2YQLA 3O35A 3GL6A 4I7BA 2LDRA 2VPEA 4LLBA 3IHPA 2MIQA 3KQIA 2K4DA 4B7YC 2EGPA 5EYAF 4BBQA 5TDRA 1JM7B 1CHCA 2ECVA 1FP0A 2MD8C 3SOUA 2YURA 2ZETC 2Y1NA 5H9MA 3HCSA 2LGLA 1WIMA 3O7AA 2QICA 4QF2A 2OXQC 2YUCA 1WEUA 3HCUA 1G25A 3N9OA 5B76A 4A49A 1E4UA 3N9MA 2G6QA 4YADA 5FERA 2G45A 2VPBA 2VP7A 4C9ZA 2Y1MA 2PNXA 2LQ6A 1WEWA 1HYIA 3T7LA 1WESA 4UP0A 4F52B 3GV4A 1F62A 4QF3A 2L5UA 3ZYQA 4FIPA 1N87A 4LKAA 1X4JA 2L43A 2E6SA 2YHOA 4GB0A 1DVPA 4R7EA 2LGGA 2XEUA 1K2FA 1RMDA 3O33A 5FB0A 4MSXA 3U5NA 2YW8A 2K1JA 2ECGA 1WEEA 3VK6A 3L1XA 5B78A 3ZPV1 2I50A 2LXPC 3DQVR 3SHBA 2ECNA 2KGIA 3LRQA 5H1UA 2KWKA 1FBVA 4YATA 4P5OB 3U5MA 5C13A 1WE9A 2FUIA 3EB6A 3N9PA 5LCWB 3N9LA 2EA6A 2VJFA 1MM3A 4PTBA 2ECWA 5H1VA 2IDAA 3M99A 4AVXA 1JM7A 3LQHA 3O70A 2VJFB 2M85A 2DX8A 2KWJA 4V3LC 2YREA 2RSDA 2M1RA 5AIUA 3ZTGA 4WA6A 4YC9A 5JG6A 4CCGX 1MM2A 5TABA 3QZVA 3PURA 2KIZA 2D8SA 4FO9A 5C11A 4YBMA 2QJ0A 4UP5A 5KH3A 3C6WA 3ZVZB 2AN6A 2H0DA 3N9NA 3RTRB 4YABA 3KNVA 2MT5A 2LRIC 4LADB 2JMDA 4GNDA 5KH7A 2G43A 2MD7B 5LKXA 5LKUA 2H0DB 2MA6A 1LDJB 2FSAA 2KU3A 5TDWA 2FUUA 3V43A 2JMJA 5D1LB 5FB1A 3PUQA 3C5KA 2CSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FL2 A;  2RI7 A;  2UZG A;  4I7C A;  4ZUX U;  2ECT A;  2M3H A;  2KR4 A;  4GNE A;  5B75 A;  2LGK A;  5LKT A;  4O64 A;  4WZ3 B;  2CKL A;  2LXH C;  2ECI A;  4ZQL A;  1HYJ A;  2BAY A;  2ECJ A;  5DKA A;  2YU4 A;  4YBT A;  2YSJ A;  3HTK C;  2CKL B;  1WIL A;  4WZ0 A;  2KWN A;  2VPD A;  1WEO A;  3PHD A;  2VPG A;  2QIZ A;  2MNZ A;  2JRJ A;  2C2V S;  4TKP B;  4GNG A;  4AUQ B;  3N9Q A;  2EOD A;  2NAA A;  2KWO A;  1T1H A;  2YQM A;  3SOX A;  3ZVY A;  4MVT A;  1BOR A;  4R2Y A;  2LV9 A;  3L1Z B;  2F6J A;  3ZPV E;  3U5P A;  1LDK C;  2LN0 A;  5TBN A;  2C2L A;  3T6R A;  3ASL A;  5G04 B;  5J3X A;  5KH9 A;  4AP4 A;  4IC3 A;  4A0C D;  3KV6 A;  3I2D A;  2HDP A;  1JOC A;  1X4U A;  2F6N A;  2CSZ A;  4I7D A;  1WEP A;  2KE1 A;  4A4B A;  3RPG B;  4L58 A;  4YBS A;  4XI1 A;  3DPL R;  5LKZ A;  3ZNI A;  3M62 A;  2MNY A;  2YT5 A;  2PUY A;  5FEY A;  5DIN A;  3M63 A;  4A4C A;  2K17 A;  2MA5 A;  1Z60 A;  1VD4 A;  4WZ2 A;  2F42 A;  3MHS A;  4NN2 A;  1WFK A;  5I3L A;  2YHN A;  2JMI A;  2LGV A;  4GNF A;  4W4U A;  2L0B A;  1WEV A;  4B86 C;  1VFY A;  4V3K C;  2KYU A;  3RPG C;  2L80 A;  2Y43 A;  4N4F A;  2CT2 A;  4LK9 A;  4X3G A;  3LQJ A;  2HYE D;  3MHH A;  1X4I A;  1IYM A;  5D1K B;  4ZDT A;  1V87 A;  1WGM A;  1ZBD B;  4L7X A;  2VNF A;  2YYR A;  2E6R A;  2XB1 A;  4Q6F A;  5TRB A;  1Z2Q A;  2K16 A;  4IC2 A;  5B79 A;  3HCT A;  5AIT A;  2VJE A;  4UI9 B;  1XWH A;  3EB5 A;  4CA1 A;  4S3O B;  3O34 A;  5H1T A;  2MUM A;  2VJE B;  4R8P K;  4FJC A;  3NG2 A;  2KGG A;  4PPE A;  1WEM A;  4BHW A;  2L75 A;  3SOW A;  2KFT A;  4YAX A;  1WEN A;  4N3W A;  4FK5 A;  5D1M B;  3U5O A;  5B77 A;  4AYC A;  1WEQ A;  3L11 A;  1VYX A;  2M6M A;  3LQI A;  5G05 B;  1U6G B;  1Z6U A;  2KRE A;  3O37 A;  4LJN A;  5G0F A;  4AYC B;  2YSM A;  4S3O C;  5B8D A;  3O36 A;  3KV5 A;  2YQL A;  3O35 A;  3GL6 A;  4I7B A;  2LDR A;  2VPE A;  4LLB A;  3IHP A;  2MIQ A;  3KQI A;  2K4D A;  4B7Y C;  2EGP A;  5EYA F;  4BBQ A;  5TDR A;  1JM7 B;  1CHC A;  2ECV A;  1FP0 A;  2MD8 C;  3SOU A;  2YUR A;  2ZET C;  2Y1N A;  5H9M A;  3HCS A;  2LGL A;  1WIM A;  3O7A A;  2QIC A;  4QF2 A;  2OXQ C;  2YUC A;  1WEU A;  3HCU A;  1G25 A;  3N9O A;  5B76 A;  4A49 A;  1E4U A;  3N9M A;  2G6Q A;  4YAD A;  5FER A;  2G45 A;  2VPB A;  2VP7 A;  4C9Z A;  2Y1M A;  2PNX A;  2LQ6 A;  1WEW A;  1HYI A;  3T7L A;  1WES A;  4UP0 A;  4F52 B;  3GV4 A;  1F62 A;  4QF3 A;  2L5U A;  3ZYQ A;  4FIP A;  1N87 A;  4LKA A;  1X4J A;  2L43 A;  2E6S A;  2YHO A;  4GB0 A;  1DVP A;  4R7E A;  2LGG A;  2XEU A;  1K2F A;  1RMD A;  3O33 A;  5FB0 A;  4MSX A;  3U5N A;  2YW8 A;  2K1J A;  2ECG A;  1WEE A;  3VK6 A;  3L1X A;  5B78 A;  3ZPV 1;  2I50 A;  2LXP C;  3DQV R;  3SHB A;  2ECN A;  2KGI A;  3LRQ A;  5H1U A;  2KWK A;  1FBV A;  4YAT A;  4P5O B;  3U5M A;  5C13 A;  1WE9 A;  2FUI A;  3EB6 A;  3N9P A;  5LCW B;  3N9L A;  2EA6 A;  2VJF A;  1MM3 A;  4PTB A;  2ECW A;  5H1V A;  2IDA A;  3M99 A;  4AVX A;  1JM7 A;  3LQH A;  3O70 A;  2VJF B;  2M85 A;  2DX8 A;  2KWJ A;  4V3L C;  2YRE A;  2RSD A;  2M1R A;  5AIU A;  3ZTG A;  4WA6 A;  4YC9 A;  5JG6 A;  4CCG X;  1MM2 A;  5TAB A;  3QZV A;  3PUR A;  2KIZ A;  2D8S A;  4FO9 A;  5C11 A;  4YBM A;  2QJ0 A;  4UP5 A;  5KH3 A;  3C6W A;  3ZVZ B;  2AN6 A;  2H0D A;  3N9N A;  3RTR B;  4YAB A;  3KNV A;  2MT5 A;  2LRI C;  4LAD B;  2JMD A;  4GND A;  5KH7 A;  2G43 A;  2MD7 B;  5LKX A;  5LKU A;  2H0D B;  2MA6 A;  1LDJ B;  2FSA A;  2KU3 A;  5TDW A;  2FUU A;  3V43 A;  2JMJ A;  5D1L B;  5FB1 A;  3PUQ A;  3C5K A;  2CSY A; 
#chains in the Genus database with same CATH topology
 3FL2 A;  2RI7 A;  2UZG A;  2XP0 A;  4I7C A;  5SVI A;  4ZUX U;  2ECT A;  2M3H A;  2KR4 A;  4GNE A;  5B75 A;  2LGK A;  5LKT A;  4O64 A;  4WZ3 B;  2CKL A;  4OGE A;  2LXH C;  2ECI A;  5SVI B;  2CRW A;  4ZQL A;  1HYJ A;  2BAY A;  2ECJ A;  5DKA A;  2YU4 A;  4YBT A;  2YSJ A;  3HTK C;  2CKL B;  1WIL A;  4WZ0 A;  2KWN A;  2VPD A;  1WEO A;  3PHD A;  3T9K A;  2VPG A;  2QIZ A;  2EGM A;  2MNZ A;  2JRJ A;  2C2V S;  3FAO A;  4TKP B;  4GNG A;  4AUQ B;  3N9Q A;  2EOD A;  2NAA A;  2KWO A;  1T1H A;  2YQM A;  3SOX A;  3ZVY A;  4MVT A;  1BOR A;  4R2Y A;  2LV9 A;  3L1Z B;  2DJA A;  2F6J A;  3ZPV E;  2M13 A;  3U5P A;  1LDK C;  2LN0 A;  3LJU X;  5TBN A;  2C2L A;  3T6R A;  3ASL A;  5G04 B;  2YVR A;  5SVX A;  5J3X A;  5KH9 A;  2XOZ A;  4AP4 A;  4IC3 A;  4A0C D;  3KV6 A;  3I2D A;  2HDP A;  2KKX A;  1JOC A;  1X4U A;  2CRR A;  3E2D A;  2F6N A;  2CSZ A;  4I7D A;  1WEP A;  2KE1 A;  2MKE A;  4A4B A;  3RPG B;  4L58 A;  4YBS A;  3LDY A;  4XI1 A;  3DPL R;  5LKZ A;  3ZNI A;  3M62 A;  3O47 A;  2MNY A;  2YT5 A;  2PUY A;  5FEY A;  5DIN A;  3M63 A;  4A4C A;  2K17 A;  2MA5 A;  1Z60 A;  1VD4 A;  3FJU B;  4WZ2 A;  2F42 A;  2JM3 A;  3MHS A;  2D8U A;  4NN2 A;  1WFK A;  5I3L A;  2EXU A;  2YHN A;  2JMI A;  2LGV A;  4GNF A;  4W4U A;  2L0B A;  1WEV A;  4B86 C;  2E61 A;  1VFY A;  4V3K C;  2KYU A;  3RPG C;  2L80 A;  2Y43 A;  4N4F A;  2CT2 A;  3LVR E;  4LK9 A;  4X3G A;  3LQJ A;  2HYE D;  3MHH A;  1X4I A;  1IYM A;  5D1K B;  4ZDT A;  1V87 A;  1WGM A;  1ZBD B;  4L7X A;  2VNF A;  2DSM A;  2YYR A;  2E6R A;  2XB1 A;  4Q6F A;  5TRB A;  1Z2Q A;  2K16 A;  4IC2 A;  5B79 A;  3HCT A;  5AIT A;  2VJE A;  4UI9 B;  1XWH A;  3EB5 A;  4CA1 A;  4S3O B;  3O34 A;  3H7H A;  5H1T A;  2MUM A;  4Z0O A;  2VJE B;  2XOY A;  4R8P K;  4FJC A;  3NG2 A;  2KGG A;  4PPE A;  1WEM A;  4BHW A;  2L75 A;  3SOW A;  2KFT A;  4YAX A;  2CSV A;  1WEN A;  4N3W A;  2JUN A;  4FK5 A;  5SVY A;  5D1M B;  3U5O A;  5B77 A;  4AYC A;  1WEQ A;  3L11 A;  1VYX A;  2M6M A;  3LQI A;  5G05 B;  1U6G B;  1Z6U A;  2KRE A;  3O37 A;  4LJN A;  2XOC A;  5G0F A;  4AYC B;  2YSM A;  4S3O C;  5B8D A;  3O36 A;  2FD4 A;  3KV5 A;  5K3Q A;  2B0O E;  2YQL A;  3O35 A;  3GL6 A;  4I7B A;  3KDE C;  2LDR A;  2VPE A;  3JUE A;  3DWD A;  4LLB A;  2IQJ A;  3IHP A;  2MIQ A;  3KQI A;  2K4D A;  4B7Y C;  2EGP A;  5EYA F;  4BBQ A;  5TDR A;  1JM7 B;  1CHC A;  2ECV A;  1FP0 A;  2MD8 C;  3SOU A;  2YUR A;  2ZET C;  2Y1N A;  5H9M A;  3HCS A;  2LGL A;  1WIM A;  3O7A A;  2QIC A;  4QF2 A;  2FFW A;  3FM8 C;  4O62 A;  4Z0R A;  2OXQ C;  2YUC A;  1WEU A;  3HCU A;  1G25 A;  3N9O A;  3PLW A;  5B76 A;  4A49 A;  1E4U A;  3N9M A;  2G6Q A;  4YAD A;  5FER A;  2G45 A;  2VPB A;  2VP7 A;  4C9Z A;  2Y1M A;  2PNX A;  2LQ6 A;  1WEW A;  1HYI A;  3T7L A;  1WES A;  4UP0 A;  4F1P A;  4F52 B;  3GV4 A;  2RR4 A;  2OWA A;  3DDT A;  1MBM A;  1F62 A;  4QF3 A;  2L5U A;  3ZYQ A;  4FIP A;  1N87 A;  2LAU A;  4LKA A;  1X4J A;  2L43 A;  2E6S A;  2YHO A;  3MDB C;  1DVP A;  4GB0 A;  3SUB A;  4R7E A;  2LGG A;  2XEU A;  1K2F A;  1RMD A;  3O33 A;  5FB0 A;  4MSX A;  3U5N A;  2YW8 A;  2K1J A;  2ECG A;  1WEE A;  3VK6 A;  3L1X A;  5B78 A;  3ZPV 1;  2I50 A;  2LXP C;  3DQV R;  3SHB A;  2ECN A;  2KGI A;  3LRQ A;  5H1U A;  2KWK A;  1FBV A;  4YAT A;  4P5O B;  1DCQ A;  3U5M A;  4H9D A;  2CON A;  5C13 A;  1WE9 A;  2FUI A;  3M7K A;  3EB6 A;  3N9P A;  5LCW B;  3LVQ E;  3N9L A;  2L7P A;  2EA6 A;  2VJF A;  2P57 A;  1MM3 A;  4PTB A;  2ECW A;  5H1V A;  2IDA A;  3M99 A;  4AVX A;  1JM7 A;  3FEH A;  3LQH A;  3O70 A;  2VJF B;  2M85 A;  2DX8 A;  2KWJ A;  4V3L C;  2YRE A;  2RSD A;  2M1R A;  5AIU A;  3ZTG A;  4WA6 A;  4YC9 A;  5JG6 A;  4CCG X;  1MM2 A;  5TAB A;  3QZV A;  3FAN A;  3PUR A;  2KIZ A;  2D8S A;  4FO9 A;  5C11 A;  4YBM A;  2QJ0 A;  4UP5 A;  3Q1D A;  5KH3 A;  3C6W A;  3ZVZ B;  2AN6 A;  2H0D A;  3N9N A;  4QQ4 A;  3RTR B;  4YAB A;  3KNV A;  2MT5 A;  2LRI C;  4LAD B;  2JMD A;  4GND A;  5KH7 A;  2G43 A;  2MD7 B;  5LKX A;  5LKU A;  2H0D B;  2MA6 A;  1LDJ B;  2FSA A;  4OGC A;  2KU3 A;  5TDW A;  2FUU A;  3V43 A;  2JMJ A;  5D1L B;  2KKY A;  3PUQ A;  5FB1 A;  3C5K A;  2CSY A; 
#chains in the Genus database with same CATH homology
 3FL2 A;  2RI7 A;  2UZG A;  4I7C A;  4ZUX U;  2ECT A;  2M3H A;  2KR4 A;  4GNE A;  5B75 A;  2LGK A;  5LKT A;  4O64 A;  4WZ3 B;  2CKL A;  2LXH C;  2ECI A;  4ZQL A;  1HYJ A;  2BAY A;  2ECJ A;  5DKA A;  2YU4 A;  4YBT A;  2YSJ A;  3HTK C;  2CKL B;  1WIL A;  4WZ0 A;  2KWN A;  2VPD A;  1WEO A;  3PHD A;  2VPG A;  2QIZ A;  2MNZ A;  2JRJ A;  2C2V S;  4TKP B;  4GNG A;  4AUQ B;  3N9Q A;  2EOD A;  2NAA A;  2KWO A;  1T1H A;  2YQM A;  3SOX A;  3ZVY A;  4MVT A;  1BOR A;  4R2Y A;  2LV9 A;  3L1Z B;  2F6J A;  3ZPV E;  3U5P A;  1LDK C;  2LN0 A;  5TBN A;  2C2L A;  3T6R A;  3ASL A;  5G04 B;  5J3X A;  5KH9 A;  4AP4 A;  4IC3 A;  4A0C D;  3KV6 A;  3I2D A;  2HDP A;  1JOC A;  1X4U A;  2F6N A;  2CSZ A;  4I7D A;  1WEP A;  2KE1 A;  4A4B A;  3RPG B;  4L58 A;  4YBS A;  4XI1 A;  3DPL R;  5LKZ A;  3ZNI A;  3M62 A;  2MNY A;  2YT5 A;  2PUY A;  5FEY A;  5DIN A;  3M63 A;  4A4C A;  2K17 A;  2MA5 A;  1Z60 A;  1VD4 A;  4WZ2 A;  2F42 A;  3MHS A;  4NN2 A;  1WFK A;  5I3L A;  2YHN A;  2JMI A;  2LGV A;  4GNF A;  4W4U A;  2L0B A;  1WEV A;  4B86 C;  1VFY A;  4V3K C;  2KYU A;  3RPG C;  2L80 A;  2Y43 A;  4N4F A;  2CT2 A;  4LK9 A;  4X3G A;  3LQJ A;  2HYE D;  3MHH A;  1X4I A;  1IYM A;  5D1K B;  4ZDT A;  1V87 A;  1WGM A;  1ZBD B;  4L7X A;  2VNF A;  2YYR A;  2E6R A;  2XB1 A;  4Q6F A;  5TRB A;  1Z2Q A;  2K16 A;  4IC2 A;  5B79 A;  3HCT A;  5AIT A;  2VJE A;  4UI9 B;  1XWH A;  3EB5 A;  4CA1 A;  4S3O B;  3O34 A;  5H1T A;  2MUM A;  2VJE B;  4R8P K;  4FJC A;  3NG2 A;  2KGG A;  4PPE A;  1WEM A;  4BHW A;  2L75 A;  3SOW A;  2KFT A;  4YAX A;  1WEN A;  4N3W A;  4FK5 A;  5D1M B;  3U5O A;  5B77 A;  4AYC A;  1WEQ A;  3L11 A;  1VYX A;  2M6M A;  3LQI A;  5G05 B;  1U6G B;  1Z6U A;  2KRE A;  3O37 A;  4LJN A;  5G0F A;  4AYC B;  2YSM A;  4S3O C;  5B8D A;  3O36 A;  3KV5 A;  2YQL A;  3O35 A;  3GL6 A;  4I7B A;  2LDR A;  2VPE A;  4LLB A;  3IHP A;  2MIQ A;  3KQI A;  2K4D A;  4B7Y C;  2EGP A;  5EYA F;  4BBQ A;  5TDR A;  1JM7 B;  1CHC A;  2ECV A;  1FP0 A;  2MD8 C;  3SOU A;  2YUR A;  2ZET C;  2Y1N A;  5H9M A;  3HCS A;  2LGL A;  1WIM A;  3O7A A;  2QIC A;  4QF2 A;  2OXQ C;  2YUC A;  1WEU A;  3HCU A;  1G25 A;  3N9O A;  5B76 A;  4A49 A;  1E4U A;  3N9M A;  2G6Q A;  4YAD A;  5FER A;  2G45 A;  2VPB A;  2VP7 A;  4C9Z A;  2Y1M A;  2PNX A;  2LQ6 A;  1WEW A;  1HYI A;  3T7L A;  1WES A;  4UP0 A;  4F52 B;  3GV4 A;  1F62 A;  4QF3 A;  2L5U A;  3ZYQ A;  4FIP A;  1N87 A;  4LKA A;  1X4J A;  2L43 A;  2E6S A;  2YHO A;  4GB0 A;  1DVP A;  4R7E A;  2LGG A;  2XEU A;  1K2F A;  1RMD A;  3O33 A;  5FB0 A;  4MSX A;  3U5N A;  2YW8 A;  2K1J A;  2ECG A;  1WEE A;  3VK6 A;  3L1X A;  5B78 A;  3ZPV 1;  2I50 A;  2LXP C;  3DQV R;  3SHB A;  2ECN A;  2KGI A;  3LRQ A;  5H1U A;  2KWK A;  1FBV A;  4YAT A;  4P5O B;  3U5M A;  5C13 A;  1WE9 A;  2FUI A;  3EB6 A;  3N9P A;  5LCW B;  3N9L A;  2EA6 A;  2VJF A;  1MM3 A;  4PTB A;  2ECW A;  5H1V A;  2IDA A;  3M99 A;  4AVX A;  1JM7 A;  3LQH A;  3O70 A;  2VJF B;  2M85 A;  2DX8 A;  2KWJ A;  4V3L C;  2YRE A;  2RSD A;  2M1R A;  5AIU A;  3ZTG A;  4WA6 A;  4YC9 A;  5JG6 A;  4CCG X;  1MM2 A;  5TAB A;  3QZV A;  3PUR A;  2KIZ A;  2D8S A;  4FO9 A;  5C11 A;  4YBM A;  2QJ0 A;  4UP5 A;  5KH3 A;  3C6W A;  3ZVZ B;  2AN6 A;  2H0D A;  3N9N A;  3RTR B;  4YAB A;  3KNV A;  2MT5 A;  2LRI C;  4LAD B;  2JMD A;  4GND A;  5KH7 A;  2G43 A;  2MD7 B;  5LKX A;  5LKU A;  2H0D B;  2MA6 A;  1LDJ B;  2FSA A;  2KU3 A;  5TDW A;  2FUU A;  3V43 A;  2JMJ A;  5D1L B;  5FB1 A;  3PUQ A;  3C5K A;  2CSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...