1WIMA

Solution structure of the ring finger domain of the human ubcm4-interacting protein 4
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
GSSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords KIAA0161 protein
publication title Solution Structure of the RING finger Domain of the human UbcM4-interacting Protein 4
rcsb
source organism Homo sapiens
total genus 15
structure length 94
sequence length 94
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wimA00
2VJEA 5AITA 5TDWA 2K1JA 2YQLA 4WZ2A 5C11A 2VJFB 2HYED 1HYIA 2XB1A 2M6MA 5D1MB 2H0DA 5LKTA 2G6QA 2CT2A 4W4UA 4B86C 2KU3A 3DPLR 4YABA 3U5MA 4A4CA 4XI1A 2K16A 4FK5A 2ZETC 2KREA 3RPGC 3U5PA 4UP5A 5LKXA 4AP4A 1WESA 2L75A 2F6JA 1WFKA 3DQVR 2C2VS 2Y1MA 2KWKA 5DKAA 2YSMA 5KH3A 3ASLA 4QF2A 3LRQA 2YREA 4V3KC 4ZQLA 1VD4A 1K2FA 2LV9A 4FIPA 2CSYA 4YC9A 5B75A 1Z2QA 5H9MA 4Q6FA 3KQIA 5LKUA 4LADB 2YSJA 4LK9A 4YBTA 2VPBA 2PNXA 2ECVA 4ZUXU 4I7CA 5C13A 3N9NA 3SOUA 4QF3A 3KV6A 3ZNIA 4IC2A 2VP7A 5KH9A 1WEEA 1MM2A 2KFTA 2KWOA 2CKLA 5EYAF 3IHPA 1JM7A 4R2YA 4LJNA 2XEUA 3M62A 2LGLA 4X3GA 2NAAA 4B7YC 4BBQA 3V43A 3O7AA 4LKAA 1E4UA 1RMDA 1WIMA 2MD8C 3KV5A 4F52B 1FBVA 4GNFA 5B76A 1DVPA 1BORA 2ECGA 4AUQB 3C6WA 2YYRA 3PUQA 4WZ3B 2G45A 1CHCA 5TDRA 3GV4A 1X4IA 2M85A 4GNEA 5B78A 3QZVA 2F42A 4YATA 2KWJA 2YQMA 2LN0A 1WEWA 2FUUA 2CSZA 2OXQC 2E6SA 3HCTA 5G05B 3PHDA 2L80A 3ZPV1 3N9LA 4FO9A 3RTRB 3MHSA 3SOXA 4R8PK 3U5NA 4UI9B 3M63A 4ZDTA 5B8DA 5B77A 2K4DA 3LQHA 2LQ6A 3SOWA 3ZYQA 3LQJA 4A0CD 2LXHC 4A49A 5B79A 2DX8A 3N9QA 1JOCA 3O36A 2JMJA 3VK6A 5H1TA 4L58A 4YADA 4WZ0A 3T6RA 2VJEB 3L1XA 2K17A 1MM3A 4WA6A 4C9ZA 2JMIA 3N9MA 4NN2A 4A4BA 4PPEA 5D1KB 2H0DB 3KNVA 5J3XA 5G0FA 2QJ0A 2YHOA 1G25A 2EGPA 4AYCA 5DINA 3L1ZB 2YT5A 5D1LB 2IDAA 5JG6A 2F6NA 1WEUA 2L43A 2MIQA 3ZTGA 2MA5A 3ZPVE 5AIUA 2QIZA 2ECNA 2RSDA 4GB0A 3I2DA 2VPGA 2MUMA 4PTBA 1WEQA 2FSAA 2JMDA 4FJCA 1F62A 2G43A 3O37A 2VJFA 1U6GB 2HDPA 4MVTA 1IYMA 2VNFA 3O34A 2ECWA 3HTKC 1XWHA 4V3LC 4AVXA 4GNDA 1LDJB 5I3LA 5FERA 2KGIA 2I50A 2KGGA 2LDRA 2YUCA 2LGKA 5LCWB 1T1HA 1WILA 2LGGA 5H1VA 4YAXA 4I7BA 3EB6A 4S3OB 2ECIA 2UZGA 1Z60A 2L0BA 4S3OC 3C5KA 1VFYA 2M3HA 2ECTA 2MD7B 1WGMA 2MT5A 2C2LA 1ZBDB 2CKLB 1JM7B 4N4FA 5FEYA 3FL2A 3O33A 4IC3A 2JRJA 5TRBA 2KWNA 4MSXA 5FB1A 2VPEA 5G04B 3ZVZB 1X4JA 4UP0A 3RPGB 5H1UA 3O70A 4I7DA 1VYXA 3HCSA 5TABA 1N87A 1WEOA 1FP0A 3HCUA 2RI7A 3MHHA 5TBNA 1LDKC 3LQIA 2LXPC 2KR4A 2YW8A 5LKZA 2YURA 2FUIA 2E6RA 4N3WA 3ZVYA 5KH7A 2KIZA 3EB5A 1V87A 1WEVA 3U5OA 3GL6A 4O64A 1WENA 4R7EA 3L11A 2QICA 2PUYA 1X4UA 2YHNA 2ECJA 2Y1NA 1HYJA 1WEPA 3SHBA 1Z6UA 4GNGA 1WEMA 4TKPB 4LLBA 4YBMA 2EODA 2VPDA 2KE1A 4CA1A 1WE9A 5FB0A 2MNZA 2AN6A 3N9PA 3O35A 4P5OB 2D8SA 3PURA 2LRIC 4CCGX 4BHWA 4AYCB 4YBSA 4L7XA 2M1RA 3N9OA 3T7LA 2MA6A 2Y43A 3M99A 2L5UA 2EA6A 2KYUA 2BAYA 2YU4A 3NG2A 2MNYA 2LGVA
chains in the Genus database with same CATH superfamily
2VJEA 5AITA 2B0OE 2EGMA 5TDWA 2K1JA 2YQLA 4WZ2A 5C11A 2VJFB 2HYED 3MDBC 1HYIA 3M7KA 2XB1A 2M6MA 5D1MB 2H0DA 3PLWA 5LKTA 2G6QA 2CT2A 4W4UA 4B86C 2KU3A 3DPLR 4YABA 3U5MA 4A4CA 2CSVA 4XI1A 2K16A 4FK5A 2ZETC 2KREA 3RPGC 3U5PA 4UP5A 5LKXA 4AP4A 1WESA 2FD4A 2L75A 2F6JA 1WFKA 3DQVR 2C2VS 2Y1MA 2KWKA 5DKAA 2YSMA 2XOCA 5KH3A 3ASLA 4QF2A 3LRQA 2YREA 4V3KC 4ZQLA 1DCQA 1VD4A 1K2FA 2LV9A 2MKEA 4FIPA 2CSYA 4YC9A 5B75A 1Z2QA 5H9MA 3LJUX 4Q6FA 3KQIA 5LKUA 4LADB 2YSJA 4LK9A 4YBTA 2L7PA 2VPBA 2PNXA 2ECVA 4ZUXU 4H9DA 4I7CA 5C13A 3N9NA 3SOUA 4QF3A 3SUBA 3KV6A 3ZNIA 4IC2A 2CRWA 2VP7A 5KH9A 1WEEA 1MM2A 2KFTA 2KWOA 3T9KA 2CKLA 3IHPA 5EYAF 1JM7A 4R2YA 4LJNA 2XEUA 3M62A 2LGLA 4X3GA 2NAAA 4B7YC 5SVXA 4BBQA 3V43A 3O7AA 4LKAA 2XP0A 1E4UA 1RMDA 1WIMA 2MD8C 3KV5A 4F52B 4O62A 1FBVA 4GNFA 5B76A 1DVPA 1BORA 2ECGA 4AUQB 3C6WA 2YYRA 3JUEA 3PUQA 2IQJA 4WZ3B 2G45A 1CHCA 3H7HA 5TDRA 3GV4A 1X4IA 2M85A 4GNEA 5B78A 3QZVA 2F42A 4YATA 2KWJA 2YQMA 2CRRA 2LN0A 1WEWA 2FUUA 2CSZA 2OXQC 2E6SA 3HCTA 5G05B 2DSMA 3PHDA 2L80A 2JM3A 4Z0OA 3ZPV1 3N9LA 4FO9A 3RTRB 3MHSA 3SOXA 4R8PK 3U5NA 5SVIA 4UI9B 3FJUB 3M63A 4ZDTA 5B8DA 5B77A 2K4DA 3LQHA 3E2DA 2LQ6A 3SOWA 3O47A 3ZYQA 3LQJA 4A0CD 2LXHC 4A49A 5B79A 2DX8A 3N9QA 1JOCA 3O36A 2JMJA 3VK6A 5H1TA 4L58A 4YADA 2LAUA 4WZ0A 3T6RA 2VJEB 3L1XA 2K17A 1MM3A 4WA6A 4C9ZA 2JMIA 4Z0RA 3N9MA 4NN2A 4A4BA 4PPEA 5D1KB 2H0DB 3KNVA 2OWAA 5J3XA 5G0FA 2QJ0A 3DWDA 2YHOA 1G25A 2EGPA 4AYCA 5DINA 3L1ZB 3LVQE 2YT5A 5D1LB 1MBMA 2IDAA 5JG6A 2F6NA 1WEUA 2L43A 2MIQA 3ZTGA 2MA5A 3ZPVE 5AIUA 2QIZA 2ECNA 2RSDA 4GB0A 2XOYA 3I2DA 2VPGA 2MUMA 2KKYA 4PTBA 1WEQA 2FSAA 2JMDA 4FJCA 1F62A 2G43A 4OGCA 3O37A 2VJFA 1U6GB 2HDPA 4MVTA 1IYMA 3LVRE 2VNFA 3O34A 2ECWA 3HTKC 1XWHA 4V3LC 4AVXA 4GNDA 1LDJB 5I3LA 5FERA 2KGIA 2YVRA 2I50A 4QQ4A 2KGGA 2LDRA 2YUCA 2LGKA 5LCWB 1T1HA 1WILA 4F1PA 2LGGA 5H1VA 4YAXA 3Q1DA 4I7BA 3EB6A 4S3OB 2ECIA 3FANA 2UZGA 1Z60A 2L0BA 4S3OC 3C5KA 2M13A 2KKXA 1VFYA 2M3HA 2ECTA 2MD7B 1WGMA 2MT5A 3FM8C 2C2LA 1ZBDB 2CKLB 1JM7B 4N4FA 3DDTA 5FEYA 3FL2A 3O33A 4IC3A 2JRJA 5TRBA 2KWNA 2XOZA 4MSXA 5FB1A 2VPEA 5G04B 3ZVZB 1X4JA 3FAOA 4UP0A 3LDYA 4OGEA 2EXUA 3RPGB 5H1UA 3O70A 4I7DA 1VYXA 3HCSA 5TABA 2P57A 2E61A 1N87A 1WEOA 1FP0A 2RR4A 3HCUA 2RI7A 3MHHA 5TBNA 1LDKC 3LQIA 2LXPC 2KR4A 3KDEC 2YW8A 3FEHA 2FFWA 5LKZA 2YURA 2FUIA 2E6RA 4N3WA 3ZVYA 5KH7A 2KIZA 3EB5A 1V87A 1WEVA 5SVIB 3U5OA 3GL6A 4O64A 5SVYA 1WENA 4R7EA 3L11A 2QICA 2PUYA 1X4UA 2YHNA 2ECJA 2Y1NA 1HYJA 1WEPA 3SHBA 1Z6UA 4GNGA 1WEMA 4TKPB 4LLBA 4YBMA 2EODA 2VPDA 2KE1A 4CA1A 1WE9A 5FB0A 2JUNA 2MNZA 2AN6A 3N9PA 3O35A 5K3QA 4P5OB 2D8SA 3PURA 2LRIC 2DJAA 4CCGX 4BHWA 2CONA 4AYCB 4YBSA 4L7XA 2M1RA 3N9OA 3T7LA 2MA6A 2Y43A 3M99A 2L5UA 2D8UA 2EA6A 2KYUA 2BAYA 2YU4A 3NG2A 2MNYA 2LGVA
chains in the Genus database with same CATH topology
2VJEA 5AITA 5TDWA 2K1JA 2YQLA 4WZ2A 5C11A 2VJFB 2HYED 1HYIA 2XB1A 2M6MA 5D1MB 2H0DA 5LKTA 2G6QA 2CT2A 4W4UA 4B86C 2KU3A 3DPLR 4YABA 3U5MA 4A4CA 4XI1A 2K16A 4FK5A 2ZETC 2KREA 3RPGC 3U5PA 4UP5A 5LKXA 4AP4A 1WESA 2L75A 2F6JA 1WFKA 3DQVR 2C2VS 2Y1MA 2KWKA 5DKAA 2YSMA 5KH3A 3ASLA 4QF2A 3LRQA 2YREA 4V3KC 4ZQLA 1VD4A 1K2FA 2LV9A 4FIPA 2CSYA 4YC9A 5B75A 1Z2QA 5H9MA 4Q6FA 3KQIA 5LKUA 4LADB 2YSJA 4LK9A 4YBTA 2VPBA 2PNXA 2ECVA 4ZUXU 4I7CA 5C13A 3N9NA 3SOUA 4QF3A 3KV6A 3ZNIA 4IC2A 2VP7A 5KH9A 1WEEA 1MM2A 2KFTA 2KWOA 2CKLA 5EYAF 3IHPA 1JM7A 4R2YA 4LJNA 2XEUA 3M62A 2LGLA 4X3GA 2NAAA 4B7YC 4BBQA 3V43A 3O7AA 4LKAA 1E4UA 1RMDA 1WIMA 2MD8C 3KV5A 4F52B 1FBVA 4GNFA 5B76A 1DVPA 1BORA 2ECGA 4AUQB 3C6WA 2YYRA 3PUQA 4WZ3B 2G45A 1CHCA 5TDRA 3GV4A 1X4IA 2M85A 4GNEA 5B78A 3QZVA 2F42A 4YATA 2KWJA 2YQMA 2LN0A 1WEWA 2FUUA 2CSZA 2OXQC 2E6SA 3HCTA 5G05B 3PHDA 2L80A 3ZPV1 3N9LA 4FO9A 3RTRB 3MHSA 3SOXA 4R8PK 3U5NA 4UI9B 3M63A 4ZDTA 5B8DA 5B77A 2K4DA 3LQHA 2LQ6A 3SOWA 3ZYQA 3LQJA 4A0CD 2LXHC 4A49A 5B79A 2DX8A 3N9QA 1JOCA 3O36A 2JMJA 3VK6A 5H1TA 4L58A 4YADA 4WZ0A 3T6RA 2VJEB 3L1XA 2K17A 1MM3A 4WA6A 4C9ZA 2JMIA 3N9MA 4NN2A 4A4BA 4PPEA 5D1KB 2H0DB 3KNVA 5J3XA 5G0FA 2QJ0A 2YHOA 1G25A 2EGPA 4AYCA 5DINA 3L1ZB 2YT5A 5D1LB 2IDAA 5JG6A 2F6NA 1WEUA 2L43A 2MIQA 3ZTGA 2MA5A 3ZPVE 5AIUA 2QIZA 2ECNA 2RSDA 4GB0A 3I2DA 2VPGA 2MUMA 4PTBA 1WEQA 2FSAA 2JMDA 4FJCA 1F62A 2G43A 3O37A 2VJFA 1U6GB 2HDPA 4MVTA 1IYMA 2VNFA 3O34A 2ECWA 3HTKC 1XWHA 4V3LC 4AVXA 4GNDA 1LDJB 5I3LA 5FERA 2KGIA 2I50A 2KGGA 2LDRA 2YUCA 2LGKA 5LCWB 1T1HA 1WILA 2LGGA 5H1VA 4YAXA 4I7BA 3EB6A 4S3OB 2ECIA 2UZGA 1Z60A 2L0BA 4S3OC 3C5KA 1VFYA 2M3HA 2ECTA 2MD7B 1WGMA 2MT5A 2C2LA 1ZBDB 2CKLB 1JM7B 4N4FA 5FEYA 3FL2A 3O33A 4IC3A 2JRJA 5TRBA 2KWNA 4MSXA 5FB1A 2VPEA 5G04B 3ZVZB 1X4JA 4UP0A 3RPGB 5H1UA 3O70A 4I7DA 1VYXA 3HCSA 5TABA 1N87A 1WEOA 1FP0A 3HCUA 2RI7A 3MHHA 5TBNA 1LDKC 3LQIA 2LXPC 2KR4A 2YW8A 5LKZA 2YURA 2FUIA 2E6RA 4N3WA 3ZVYA 5KH7A 2KIZA 3EB5A 1V87A 1WEVA 3U5OA 3GL6A 4O64A 1WENA 4R7EA 3L11A 2QICA 2PUYA 1X4UA 2YHNA 2ECJA 2Y1NA 1HYJA 1WEPA 3SHBA 1Z6UA 4GNGA 1WEMA 4TKPB 4LLBA 4YBMA 2EODA 2VPDA 2KE1A 4CA1A 1WE9A 5FB0A 2MNZA 2AN6A 3N9PA 3O35A 4P5OB 2D8SA 3PURA 2LRIC 4CCGX 4BHWA 4AYCB 4YBSA 4L7XA 2M1RA 3N9OA 3T7LA 2MA6A 2Y43A 3M99A 2L5UA 2EA6A 2KYUA 2BAYA 2YU4A 3NG2A 2MNYA 2LGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE A;  5AIT A;  5TDW A;  2K1J A;  2YQL A;  4WZ2 A;  5C11 A;  2VJF B;  2HYE D;  1HYI A;  2XB1 A;  2M6M A;  5D1M B;  2H0D A;  5LKT A;  2G6Q A;  2CT2 A;  4W4U A;  4B86 C;  2KU3 A;  3DPL R;  4YAB A;  3U5M A;  4A4C A;  4XI1 A;  2K16 A;  4FK5 A;  2ZET C;  2KRE A;  3RPG C;  3U5P A;  4UP5 A;  5LKX A;  4AP4 A;  1WES A;  2L75 A;  2F6J A;  1WFK A;  3DQV R;  2C2V S;  2Y1M A;  2KWK A;  5DKA A;  2YSM A;  5KH3 A;  3ASL A;  4QF2 A;  3LRQ A;  2YRE A;  4V3K C;  4ZQL A;  1VD4 A;  1K2F A;  2LV9 A;  4FIP A;  2CSY A;  4YC9 A;  5B75 A;  1Z2Q A;  5H9M A;  4Q6F A;  3KQI A;  5LKU A;  4LAD B;  2YSJ A;  4LK9 A;  4YBT A;  2VPB A;  2PNX A;  2ECV A;  4ZUX U;  4I7C A;  5C13 A;  3N9N A;  3SOU A;  4QF3 A;  3KV6 A;  3ZNI A;  4IC2 A;  2VP7 A;  5KH9 A;  1WEE A;  1MM2 A;  2KFT A;  2KWO A;  2CKL A;  5EYA F;  3IHP A;  1JM7 A;  4R2Y A;  4LJN A;  2XEU A;  3M62 A;  2LGL A;  4X3G A;  2NAA A;  4B7Y C;  4BBQ A;  3V43 A;  3O7A A;  4LKA A;  1E4U A;  1RMD A;  1WIM A;  2MD8 C;  3KV5 A;  4F52 B;  1FBV A;  4GNF A;  5B76 A;  1DVP A;  1BOR A;  2ECG A;  4AUQ B;  3C6W A;  2YYR A;  3PUQ A;  4WZ3 B;  2G45 A;  1CHC A;  5TDR A;  3GV4 A;  1X4I A;  2M85 A;  4GNE A;  5B78 A;  3QZV A;  2F42 A;  4YAT A;  2KWJ A;  2YQM A;  2LN0 A;  1WEW A;  2FUU A;  2CSZ A;  2OXQ C;  2E6S A;  3HCT A;  5G05 B;  3PHD A;  2L80 A;  3ZPV 1;  3N9L A;  4FO9 A;  3RTR B;  3MHS A;  3SOX A;  4R8P K;  3U5N A;  4UI9 B;  3M63 A;  4ZDT A;  5B8D A;  5B77 A;  2K4D A;  3LQH A;  2LQ6 A;  3SOW A;  3ZYQ A;  3LQJ A;  4A0C D;  2LXH C;  4A49 A;  5B79 A;  2DX8 A;  3N9Q A;  1JOC A;  3O36 A;  2JMJ A;  3VK6 A;  5H1T A;  4L58 A;  4YAD A;  4WZ0 A;  3T6R A;  2VJE B;  3L1X A;  2K17 A;  1MM3 A;  4WA6 A;  4C9Z A;  2JMI A;  3N9M A;  4NN2 A;  4A4B A;  4PPE A;  5D1K B;  2H0D B;  3KNV A;  5J3X A;  5G0F A;  2QJ0 A;  2YHO A;  1G25 A;  2EGP A;  4AYC A;  5DIN A;  3L1Z B;  2YT5 A;  5D1L B;  2IDA A;  5JG6 A;  2F6N A;  1WEU A;  2L43 A;  2MIQ A;  3ZTG A;  2MA5 A;  3ZPV E;  5AIU A;  2QIZ A;  2ECN A;  2RSD A;  4GB0 A;  3I2D A;  2VPG A;  2MUM A;  4PTB A;  1WEQ A;  2FSA A;  2JMD A;  4FJC A;  1F62 A;  2G43 A;  3O37 A;  2VJF A;  1U6G B;  2HDP A;  4MVT A;  1IYM A;  2VNF A;  3O34 A;  2ECW A;  3HTK C;  1XWH A;  4V3L C;  4AVX A;  4GND A;  1LDJ B;  5I3L A;  5FER A;  2KGI A;  2I50 A;  2KGG A;  2LDR A;  2YUC A;  2LGK A;  5LCW B;  1T1H A;  1WIL A;  2LGG A;  5H1V A;  4YAX A;  4I7B A;  3EB6 A;  4S3O B;  2ECI A;  2UZG A;  1Z60 A;  2L0B A;  4S3O C;  3C5K A;  1VFY A;  2M3H A;  2ECT A;  2MD7 B;  1WGM A;  2MT5 A;  2C2L A;  1ZBD B;  2CKL B;  1JM7 B;  4N4F A;  5FEY A;  3FL2 A;  3O33 A;  4IC3 A;  2JRJ A;  5TRB A;  2KWN A;  4MSX A;  5FB1 A;  2VPE A;  5G04 B;  3ZVZ B;  1X4J A;  4UP0 A;  3RPG B;  5H1U A;  3O70 A;  4I7D A;  1VYX A;  3HCS A;  5TAB A;  1N87 A;  1WEO A;  1FP0 A;  3HCU A;  2RI7 A;  3MHH A;  5TBN A;  1LDK C;  3LQI A;  2LXP C;  2KR4 A;  2YW8 A;  5LKZ A;  2YUR A;  2FUI A;  2E6R A;  4N3W A;  3ZVY A;  5KH7 A;  2KIZ A;  3EB5 A;  1V87 A;  1WEV A;  3U5O A;  3GL6 A;  4O64 A;  1WEN A;  4R7E A;  3L11 A;  2QIC A;  2PUY A;  1X4U A;  2YHN A;  2ECJ A;  2Y1N A;  1HYJ A;  1WEP A;  3SHB A;  1Z6U A;  4GNG A;  1WEM A;  4TKP B;  4LLB A;  4YBM A;  2EOD A;  2VPD A;  2KE1 A;  4CA1 A;  1WE9 A;  5FB0 A;  2MNZ A;  2AN6 A;  3N9P A;  3O35 A;  4P5O B;  2D8S A;  3PUR A;  2LRI C;  4CCG X;  4BHW A;  4AYC B;  4YBS A;  4L7X A;  2M1R A;  3N9O A;  3T7L A;  2MA6 A;  2Y43 A;  3M99 A;  2L5U A;  2EA6 A;  2KYU A;  2BAY A;  2YU4 A;  3NG2 A;  2MNY A;  2LGV A; 
#chains in the Genus database with same CATH topology
 2VJE A;  5AIT A;  2B0O E;  2EGM A;  5TDW A;  2K1J A;  2YQL A;  4WZ2 A;  5C11 A;  2VJF B;  2HYE D;  3MDB C;  1HYI A;  3M7K A;  2XB1 A;  2M6M A;  5D1M B;  2H0D A;  3PLW A;  5LKT A;  2G6Q A;  2CT2 A;  4W4U A;  4B86 C;  2KU3 A;  3DPL R;  4YAB A;  3U5M A;  4A4C A;  2CSV A;  4XI1 A;  2K16 A;  4FK5 A;  2ZET C;  2KRE A;  3RPG C;  3U5P A;  4UP5 A;  5LKX A;  4AP4 A;  1WES A;  2FD4 A;  2L75 A;  2F6J A;  1WFK A;  3DQV R;  2C2V S;  2Y1M A;  2KWK A;  5DKA A;  2YSM A;  2XOC A;  5KH3 A;  3ASL A;  4QF2 A;  3LRQ A;  2YRE A;  4V3K C;  4ZQL A;  1DCQ A;  1VD4 A;  1K2F A;  2LV9 A;  2MKE A;  4FIP A;  2CSY A;  4YC9 A;  5B75 A;  1Z2Q A;  5H9M A;  3LJU X;  4Q6F A;  3KQI A;  5LKU A;  4LAD B;  2YSJ A;  4LK9 A;  4YBT A;  2L7P A;  2VPB A;  2PNX A;  2ECV A;  4ZUX U;  4H9D A;  4I7C A;  5C13 A;  3N9N A;  3SOU A;  4QF3 A;  3SUB A;  3KV6 A;  3ZNI A;  4IC2 A;  2CRW A;  2VP7 A;  5KH9 A;  1WEE A;  1MM2 A;  2KFT A;  2KWO A;  3T9K A;  2CKL A;  3IHP A;  5EYA F;  1JM7 A;  4R2Y A;  4LJN A;  2XEU A;  3M62 A;  2LGL A;  4X3G A;  2NAA A;  4B7Y C;  5SVX A;  4BBQ A;  3V43 A;  3O7A A;  4LKA A;  2XP0 A;  1E4U A;  1RMD A;  1WIM A;  2MD8 C;  3KV5 A;  4F52 B;  4O62 A;  1FBV A;  4GNF A;  5B76 A;  1DVP A;  1BOR A;  2ECG A;  4AUQ B;  3C6W A;  2YYR A;  3JUE A;  3PUQ A;  2IQJ A;  4WZ3 B;  2G45 A;  1CHC A;  3H7H A;  5TDR A;  3GV4 A;  1X4I A;  2M85 A;  4GNE A;  5B78 A;  3QZV A;  2F42 A;  4YAT A;  2KWJ A;  2YQM A;  2CRR A;  2LN0 A;  1WEW A;  2FUU A;  2CSZ A;  2OXQ C;  2E6S A;  3HCT A;  5G05 B;  2DSM A;  3PHD A;  2L80 A;  2JM3 A;  4Z0O A;  3ZPV 1;  3N9L A;  4FO9 A;  3RTR B;  3MHS A;  3SOX A;  4R8P K;  3U5N A;  5SVI A;  4UI9 B;  3FJU B;  3M63 A;  4ZDT A;  5B8D A;  5B77 A;  2K4D A;  3LQH A;  3E2D A;  2LQ6 A;  3SOW A;  3O47 A;  3ZYQ A;  3LQJ A;  4A0C D;  2LXH C;  4A49 A;  5B79 A;  2DX8 A;  3N9Q A;  1JOC A;  3O36 A;  2JMJ A;  3VK6 A;  5H1T A;  4L58 A;  4YAD A;  2LAU A;  4WZ0 A;  3T6R A;  2VJE B;  3L1X A;  2K17 A;  1MM3 A;  4WA6 A;  4C9Z A;  2JMI A;  4Z0R A;  3N9M A;  4NN2 A;  4A4B A;  4PPE A;  5D1K B;  2H0D B;  3KNV A;  2OWA A;  5J3X A;  5G0F A;  2QJ0 A;  3DWD A;  2YHO A;  1G25 A;  2EGP A;  4AYC A;  5DIN A;  3L1Z B;  3LVQ E;  2YT5 A;  5D1L B;  1MBM A;  2IDA A;  5JG6 A;  2F6N A;  1WEU A;  2L43 A;  2MIQ A;  3ZTG A;  2MA5 A;  3ZPV E;  5AIU A;  2QIZ A;  2ECN A;  2RSD A;  4GB0 A;  2XOY A;  3I2D A;  2VPG A;  2MUM A;  2KKY A;  4PTB A;  1WEQ A;  2FSA A;  2JMD A;  4FJC A;  1F62 A;  2G43 A;  4OGC A;  3O37 A;  2VJF A;  1U6G B;  2HDP A;  4MVT A;  1IYM A;  3LVR E;  2VNF A;  3O34 A;  2ECW A;  3HTK C;  1XWH A;  4V3L C;  4AVX A;  4GND A;  1LDJ B;  5I3L A;  5FER A;  2KGI A;  2YVR A;  2I50 A;  4QQ4 A;  2KGG A;  2LDR A;  2YUC A;  2LGK A;  5LCW B;  1T1H A;  1WIL A;  4F1P A;  2LGG A;  5H1V A;  4YAX A;  3Q1D A;  4I7B A;  3EB6 A;  4S3O B;  2ECI A;  3FAN A;  2UZG A;  1Z60 A;  2L0B A;  4S3O C;  3C5K A;  2M13 A;  2KKX A;  1VFY A;  2M3H A;  2ECT A;  2MD7 B;  1WGM A;  2MT5 A;  3FM8 C;  2C2L A;  1ZBD B;  2CKL B;  1JM7 B;  4N4F A;  3DDT A;  5FEY A;  3FL2 A;  3O33 A;  4IC3 A;  2JRJ A;  5TRB A;  2KWN A;  2XOZ A;  4MSX A;  5FB1 A;  2VPE A;  5G04 B;  3ZVZ B;  1X4J A;  3FAO A;  4UP0 A;  3LDY A;  4OGE A;  2EXU A;  3RPG B;  5H1U A;  3O70 A;  4I7D A;  1VYX A;  3HCS A;  5TAB A;  2P57 A;  2E61 A;  1N87 A;  1WEO A;  1FP0 A;  2RR4 A;  3HCU A;  2RI7 A;  3MHH A;  5TBN A;  1LDK C;  3LQI A;  2LXP C;  2KR4 A;  3KDE C;  2YW8 A;  3FEH A;  2FFW A;  5LKZ A;  2YUR A;  2FUI A;  2E6R A;  4N3W A;  3ZVY A;  5KH7 A;  2KIZ A;  3EB5 A;  1V87 A;  1WEV A;  5SVI B;  3U5O A;  3GL6 A;  4O64 A;  5SVY A;  1WEN A;  4R7E A;  3L11 A;  2QIC A;  2PUY A;  1X4U A;  2YHN A;  2ECJ A;  2Y1N A;  1HYJ A;  1WEP A;  3SHB A;  1Z6U A;  4GNG A;  1WEM A;  4TKP B;  4LLB A;  4YBM A;  2EOD A;  2VPD A;  2KE1 A;  4CA1 A;  1WE9 A;  5FB0 A;  2JUN A;  2MNZ A;  2AN6 A;  3N9P A;  3O35 A;  5K3Q A;  4P5O B;  2D8S A;  3PUR A;  2LRI C;  2DJA A;  4CCG X;  4BHW A;  2CON A;  4AYC B;  4YBS A;  4L7X A;  2M1R A;  3N9O A;  3T7L A;  2MA6 A;  2Y43 A;  3M99 A;  2L5U A;  2D8U A;  2EA6 A;  2KYU A;  2BAY A;  2YU4 A;  3NG2 A;  2MNY A;  2LGV A; 
#chains in the Genus database with same CATH homology
 2VJE A;  5AIT A;  5TDW A;  2K1J A;  2YQL A;  4WZ2 A;  5C11 A;  2VJF B;  2HYE D;  1HYI A;  2XB1 A;  2M6M A;  5D1M B;  2H0D A;  5LKT A;  2G6Q A;  2CT2 A;  4W4U A;  4B86 C;  2KU3 A;  3DPL R;  4YAB A;  3U5M A;  4A4C A;  4XI1 A;  2K16 A;  4FK5 A;  2ZET C;  2KRE A;  3RPG C;  3U5P A;  4UP5 A;  5LKX A;  4AP4 A;  1WES A;  2L75 A;  2F6J A;  1WFK A;  3DQV R;  2C2V S;  2Y1M A;  2KWK A;  5DKA A;  2YSM A;  5KH3 A;  3ASL A;  4QF2 A;  3LRQ A;  2YRE A;  4V3K C;  4ZQL A;  1VD4 A;  1K2F A;  2LV9 A;  4FIP A;  2CSY A;  4YC9 A;  5B75 A;  1Z2Q A;  5H9M A;  4Q6F A;  3KQI A;  5LKU A;  4LAD B;  2YSJ A;  4LK9 A;  4YBT A;  2VPB A;  2PNX A;  2ECV A;  4ZUX U;  4I7C A;  5C13 A;  3N9N A;  3SOU A;  4QF3 A;  3KV6 A;  3ZNI A;  4IC2 A;  2VP7 A;  5KH9 A;  1WEE A;  1MM2 A;  2KFT A;  2KWO A;  2CKL A;  5EYA F;  3IHP A;  1JM7 A;  4R2Y A;  4LJN A;  2XEU A;  3M62 A;  2LGL A;  4X3G A;  2NAA A;  4B7Y C;  4BBQ A;  3V43 A;  3O7A A;  4LKA A;  1E4U A;  1RMD A;  1WIM A;  2MD8 C;  3KV5 A;  4F52 B;  1FBV A;  4GNF A;  5B76 A;  1DVP A;  1BOR A;  2ECG A;  4AUQ B;  3C6W A;  2YYR A;  3PUQ A;  4WZ3 B;  2G45 A;  1CHC A;  5TDR A;  3GV4 A;  1X4I A;  2M85 A;  4GNE A;  5B78 A;  3QZV A;  2F42 A;  4YAT A;  2KWJ A;  2YQM A;  2LN0 A;  1WEW A;  2FUU A;  2CSZ A;  2OXQ C;  2E6S A;  3HCT A;  5G05 B;  3PHD A;  2L80 A;  3ZPV 1;  3N9L A;  4FO9 A;  3RTR B;  3MHS A;  3SOX A;  4R8P K;  3U5N A;  4UI9 B;  3M63 A;  4ZDT A;  5B8D A;  5B77 A;  2K4D A;  3LQH A;  2LQ6 A;  3SOW A;  3ZYQ A;  3LQJ A;  4A0C D;  2LXH C;  4A49 A;  5B79 A;  2DX8 A;  3N9Q A;  1JOC A;  3O36 A;  2JMJ A;  3VK6 A;  5H1T A;  4L58 A;  4YAD A;  4WZ0 A;  3T6R A;  2VJE B;  3L1X A;  2K17 A;  1MM3 A;  4WA6 A;  4C9Z A;  2JMI A;  3N9M A;  4NN2 A;  4A4B A;  4PPE A;  5D1K B;  2H0D B;  3KNV A;  5J3X A;  5G0F A;  2QJ0 A;  2YHO A;  1G25 A;  2EGP A;  4AYC A;  5DIN A;  3L1Z B;  2YT5 A;  5D1L B;  2IDA A;  5JG6 A;  2F6N A;  1WEU A;  2L43 A;  2MIQ A;  3ZTG A;  2MA5 A;  3ZPV E;  5AIU A;  2QIZ A;  2ECN A;  2RSD A;  4GB0 A;  3I2D A;  2VPG A;  2MUM A;  4PTB A;  1WEQ A;  2FSA A;  2JMD A;  4FJC A;  1F62 A;  2G43 A;  3O37 A;  2VJF A;  1U6G B;  2HDP A;  4MVT A;  1IYM A;  2VNF A;  3O34 A;  2ECW A;  3HTK C;  1XWH A;  4V3L C;  4AVX A;  4GND A;  1LDJ B;  5I3L A;  5FER A;  2KGI A;  2I50 A;  2KGG A;  2LDR A;  2YUC A;  2LGK A;  5LCW B;  1T1H A;  1WIL A;  2LGG A;  5H1V A;  4YAX A;  4I7B A;  3EB6 A;  4S3O B;  2ECI A;  2UZG A;  1Z60 A;  2L0B A;  4S3O C;  3C5K A;  1VFY A;  2M3H A;  2ECT A;  2MD7 B;  1WGM A;  2MT5 A;  2C2L A;  1ZBD B;  2CKL B;  1JM7 B;  4N4F A;  5FEY A;  3FL2 A;  3O33 A;  4IC3 A;  2JRJ A;  5TRB A;  2KWN A;  4MSX A;  5FB1 A;  2VPE A;  5G04 B;  3ZVZ B;  1X4J A;  4UP0 A;  3RPG B;  5H1U A;  3O70 A;  4I7D A;  1VYX A;  3HCS A;  5TAB A;  1N87 A;  1WEO A;  1FP0 A;  3HCU A;  2RI7 A;  3MHH A;  5TBN A;  1LDK C;  3LQI A;  2LXP C;  2KR4 A;  2YW8 A;  5LKZ A;  2YUR A;  2FUI A;  2E6R A;  4N3W A;  3ZVY A;  5KH7 A;  2KIZ A;  3EB5 A;  1V87 A;  1WEV A;  3U5O A;  3GL6 A;  4O64 A;  1WEN A;  4R7E A;  3L11 A;  2QIC A;  2PUY A;  1X4U A;  2YHN A;  2ECJ A;  2Y1N A;  1HYJ A;  1WEP A;  3SHB A;  1Z6U A;  4GNG A;  1WEM A;  4TKP B;  4LLB A;  4YBM A;  2EOD A;  2VPD A;  2KE1 A;  4CA1 A;  1WE9 A;  5FB0 A;  2MNZ A;  2AN6 A;  3N9P A;  3O35 A;  4P5O B;  2D8S A;  3PUR A;  2LRI C;  4CCG X;  4BHW A;  4AYC B;  4YBS A;  4L7X A;  2M1R A;  3N9O A;  3T7L A;  2MA6 A;  2Y43 A;  3M99 A;  2L5U A;  2EA6 A;  2KYU A;  2BAY A;  2YU4 A;  3NG2 A;  2MNY A;  2LGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...