3FAOA

Crystal structure of s118a mutant 3clsp of prrsv
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
197
structure length
192
Chain Sequence
b'FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDAGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
total genus 39
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3faoA03
2GX4A 3BTGE 2ZPQA 4Y8YA 3MH4A 1O3NA 1OXGA 4TWYA 3ZVAA 2OTVA 2ZHQH 5JBCS 3E3TA 5JYIA 1HAYB 4B2BA 2H9TH 2OQUA 3MU8A 1C1TA 1T8LA 5HM9A 1ARCA 2QYIA 1Y8TA 3D65E 2J92A 1GJBB 3SV9A 2FOGA 1T7CA 4E7RG 5DP3A 3U69H 4DIHH 2TGAA 1QQ4A 2FOCA 4BANB 1P2JA 1ZRKA 3DA9B 2H6MA 2UUFB 1O3OA 4D9QA 2FESH 1ZHRA 1SPJA 1V2KT 5LPEA 1FONA 3K6YA 4KTSA 3U8OH 3ZZ3A 1XUHA 2G00A 1TIOA 1BT7A 1UVSH 2OXSA 1O2OA 2FX4A 5F03A 1C5VA 5AFZH 9ESTA 1CHOF 1YF4A 3PO1B 1SL3A 1YYY1 4K69A 5LH8A 1LPGB 2W7UA 2R3YA 3TGIE 3UNRA 1GBLA 3C27B 4CH2B 2ZDLA 1AZ8A 2A4QA 1QGFA 2NU1E 2Q1JA 5E0JA 4I8KA 4U32A 1E36B 2GT8A 2J4IA 1KY9A 4ZH8A 2CMYA 3GDUA 1OWKA 4DURA 1EZSC 1C1SA 2WPKS 4GHTA 3SNAA 1KXFA 3OX7U 2Z9LA 3KQEA 2SGPE 2OQ5A 5C1YA 1V2MT 1GHBF 1C5NH 1GBDA 1MTVA 2XBYA 4X6NA 1GG6C 1P0SH 5HM2A 5K0HA 2VWNA 3PMAB 1B0FA 4OS6A 1GBCA 3A8DA 4FU8A 4H42U 1GJ4H 4X2XA 3SU3A 2HGTH 1GMHF 7GCHF 1PPZA 1VCWA 5GDSH 1V6DA 1S5SA 2W26A 2QV1A 1EX3A 3QX5H 1C9TA 4NG9H 3MWIU 2D2DA 1F7ZA 3BTTE 3TJUA 4X6OA 3KQBA 2ZO3H 3ZZ8A 2IN2A 4JZEH 1GPZA 3VPKA 2ZZUH 3FANA 2FX6A 2G51A 4FVDA 5HYOA 3B9FH 5FCKA 2JETC 1MTUA 1YPJH 1GI0A 4ISLA 5DP6A 4Z0KA 2FOAA 3MOCA 1UO6A 3ATWA 1BRBE 1DUAA 1MCVA 1BB0B 3VEQB 4TPYA 1P03A 1L0ZA 1DPOA 3SNDA 2OUAA 1OWIA 1CA8B 2ODQA 2ZECA 1MCTA 1HJ9A 1THSH 2TGTA 1ORFA 4MPWA 3U9AH 2EEKA 3MI4A 4NZLA 1DY8A 3A8CA 1A2CH 4X8SH 1QY6A 2BZ6H 1OP0A 2BX3A 3SI4H 9LPRA 1HGTH 4X2WA 5J4QA 1BMMH 2G8TA 2Y81A 1KTSB 4TWWA 1YPGH 2NU2E 2H9EH 1DX5M 1TX7A 1DOJA 1C2MA 1J9CH 1S6HA 1P2QA 1TRMA 5E2PA 1L4ZA 4HZHA 2GT7A 5EXNA 4CR5A 4K8YA 2FOBA 1GDUA 2QC2A 2F9NA 2O8WA 1GHVH 1O3MA 1F0SA 1C5WB 2GMTB 2ZDKA 1IQEA 4ISIH 1P12E 1SOTA 2BLQA 4ISOA 3BTHE 1DS2E 1Y5BT 1RTLA 1HFDA 3LJJA 3P17H 1SHHB 4GAWA 2FI4E 4YESB 1HV7A 2C93B 4AG2A 2P16A 1ABJH 1KXEA 2ZF0H 4Y6DA 1ZTKA 2B8OH 2C90B 3RXRA 1ZJDA 3ZVFA 4J2YB 3HKIB 2XBVA 4H4FA 6GCHG 1HBTH 1FI8A 1BMNH 1UHBB 2BD8A 3MH6A 1C5TA 5DJ7A 1HJAC 2OD3B 1V3XA 5EW2H 2C8ZB 3FAOA 4FVBA 5E8EH 2ZFPH 2ZU5A 4IMQA 4WH8A 1HLTH 2OBQA 1T4VH 3NUMA 1C5QA 1P3CA 5T6GA 2ZNKH 1DUEA 1HYLA 2XBWA 1L1JA 1HRTH 5E2OA 1O2WA 2A0QB 3LU9B 4RN6A 2BYAX 4LZ4B 3R3GB 4X1NU 1JRSA 4WH6A 3ZV8A 3GCNA 1O5CB 4ZHLU 4CH8B 1OKXA 2Y6TA 1SFQB 2GP9B 1BQYA 4MQAA 2ZDAH 4A7IB 2SGQE 3UUZA 4Y71A 1P02A 4VGCC 3A8AA 2IOTA 4X1SU 3F6UH 4U30A 5AHGH 4WMDA 3D62A 2BQ7B 2W3IA 1Z8JB 1SVPA 1BHXF 3BTEE 1CBWC 4FUEA 2CN0H 3E16B 2XC5A 2STAE 3NZIA 3T62A 1GDNA 3TPIZ 1Z8IB 5EODA 1LVOA 1AUJA 1WAYB 2VINA 1NN6A 3FP8E 1UTJA 1H9HE 8KME2 2YOLA 3BV9B 5FXLA 2R0KA 3ATKA 1C2IA 3QWCH 2KAIA 2ZFFH 1HDTH 2BY7X 2STBE 1PJPA 1BMLA 2JKHA 1P11E 2XRCA 1QL9A 3GCHB 4KKDA 3BTWE 2J34A 3L3TA 3A7TA 4X8VH 4NWKA 3Q77A 3VB3A 1ZOMA 3TNSA 4NSVA 5DPAA 2SNWA 1TGBA 1FPHH 1NU7B 2FI3E 5L6NH 4AFUA 2ZGXH 4CRGA 1THRH 4F4OC 1MD7A 1ZZZA 1DLEA 4WWYA 1XUJA 4ZHMU 1D6RA 3TH2H 1O2KA 3F9GA 2HNTE 3RXSA 1DXPA 1O2IA 2P3UB 4JK5A 3ZZ4A 1MMJN 2Y7XA 3BTKE 2ZCHP 4CHAC 2NU0E 5LGOA 2P95A 1C9PA 2PW8H 1QJ6B 1V2JT 4AX9H 1EZQA 1C5ZB 2NWNA 1BUIA 4INKA 5CE1A 5EXMA 3S69A 1AMHA 1NRNH 2AGGX 4K1SA 2GGVB 1BZXE 1JIRA 1PQ8A 1TBQH 1UK3A 1E38B 4UD9H 2J2UA 1NY22 2C8YB 4BXWA 1A46H 1EQ9A 1UTKA 2OC7A 5HXFA 4Y11E 1T4UH 3P8GA 3IITA 1Y59T 5C1XA 2I6QA 5I25A 3MO3A 1W13U 3P8OA 4GPGA 1TYNA 1O3FA 3M3SA 5H4IB 1FN6A 3RXPA 2Q6DA 2A5AA 3RXMA 1RTFB 3D49H 2BDYA 3U1IB 1ELFA 4ESTE 3P8NA 1HIAB 1K1LA 4I8HA 2F9UA 1ELVA 1P57B 2WPHS 1XUFA 1YPLH 1V2NT 1TRYA 1V2OT 1AVXA 1FY1A 3QZQA 4YLUA 3IG6B 3Q3XA 2ZTXA 2ZGJA 2ZFTA 2K1QA 3MFJA 4NFEA 1QR3E 1O3PB 1GI3A 1ABIH 3SI3H 3HATH 3OSYA 3RXQA 4UEHH 3BIUH 2B0FA 2HRVA 3ZZ9A 1TX8A 1ETTH 1GVKB 3SUFA 1ZSLA 3BEFB 4BTTB 1A0LA 1ZSJA 1D3TB 4YZUA 1ETSH 1XMNB 2ZQ2A 3ZZAA 3F9FA 3ATMA 1NU9A 3T5FH 2CGAA 3RLWH 3M61U 1T8NA 2BOHB 4X8TH 1V2PT 1EOJA 3GY3A 1IQLA 4B2AA 5DP8A 2VIWA 4Y79A 3GY2A 3QGNB 1MKWH 6GCHF 2WPIS 4NA8A 3A81A 3URDA 3PMHB 1QL7A 1SGIB 4DG4A 3DT0H 2ZTYA 2HVXA 3TGJE 1TMTH 4OS5A 3VGCB 1SGTA 5B6OA 1UMAH 1C1QA 3ZVBA 3CS0A 2ZDNA 1B0EA 4HI3A 5FPTA 3LONA 3F9EA 3CP7A 1ZPBA 1G36A 1JBUH 3SU2A 3VXFH 2BB4A 4ABGA 3MHWU 4JYVH 1GI1A 1LCYA 4K1TA 1M9UA 3RDZA 3B8JA 2I6SA 4ABFA 4X2VA 1GHWH 1V2UT 1RJXB 1O30A 3KQDA 1Z1JA 4YTAA 4MNWA 2Y5FA 5FCRA 1RIWB 1WV7H 3PB1E 2P8OB 1AB9B 1JIMA 2R0LA 1A3BH 2ZGHA 1BJVA 4A5TS 4JYTA 4BAOB 1OP2A 1CGIE 1EB2A 3Q3YA 2BX4A 1F5KU 3KGPA 1O5GH 3RXKA 5A8YA 3UNSA 1UTPA 3TH3H 4OGXA 1QRXA 2VWLA 1ESAA 1GBJA 1S82A 1J8AA 1Y5UT 3ODFA 2R2WU 2C8XB 1GHAG 3ZZ5A 1O3IA 1FY8E 3AASA 7LPRA 2FTMA 3H7TA 3SNEA 2HWLB 4IW4E 1S84A 2TGPZ 1XX9A 2BLVA 4DGJA 3PTNA 2GTBA 1SOZA 2FS9A 3A84A 4NFFA 1SLVB 5C1UA 2O8LA 3RLYH 1L2EA 1B5GH 2HPPH 4ZKSU 2ZTZA 1A5HA 2BDHA 3RXDA 1A7SA 1C5PA 1NTPA 1O3AA 1VZQH 2G4TA 2F9OA 3RXVA 3EDXB 1Z1IA 3RXCA 3RC4A 1DWCH 2PFEA 1O2UA 8ESTE 3T27A 4CBOA 3Q76A 1C5YB 1O5AB 4QT8C 1FUJA 2BDCA 1D3DB 2XNIA 4B71A 1H8DH 3OYPA 2A31A 2PKAA 5DP5A 1EJMA 2FOFA 4I8LA 1P2NA 2WUBA 1QBNA 1UCYH 1G3EA 2ZG0H 5GPIB 1GMCG 4B1TA 3HGNA 5EQQA 5TCAA 1GI8B 2ZU4A 3RXTA 3U8RH 4NSYA 2BD5A 5LPFA 1GL0E 1RS0A 1FXYA 1ID5H 3ZZCA 3BG4C 3OU0A 1CT2E 4DCDA 2G81E 4MNYA 1SGYE 3GYMA 3VXEH 3SV8A 2ZHFH 3FZDA 1N8OB 1QFKH 3M35A 3LC3A 3QZRA 4X6MA 1GJ9B 4PROA 1O2VA 1O33A 1NFUA 2BOKA 4IC6A 4JZ1A 5A8ZA 1HAVA 4MDSA 4OGYA 3RMLH 6ESTA 4DIIH 3SUEA 4AFZA 1BCUH 2EC9H 2Z3EA 3A7YA 4XSKU 2FZZA 2VGCB 3A88A 3M36A 3ZYEA 1P10A 1VGCB 2JH6D 2ZHEH 2BVSH 2V6NA 4BTUB 1AE5A 1MQ6A 1LO6A 2RA0A 1QRWA 3SQHE 1PPHE 4XDEA 1FLEE 1P8VC 1EPTB 2W3KA 2HNTC 1WYKA 4YOGA 1C1WH 4MPUA 3OY5U 1ZTJA 2PGQB 4LOYH 1OWDA 2ILNA 3W94A 4R8TB 1VITH 1C5UA 2Q6FA 3HKJB 1W7XH 5DP4A 4F49A 1GBKA 1SQOA 2KAIB 1C5OH 1MAXA 3RXBA 1P9UA 3V7TA 4O9VA 4IC5A 1NC6A 1MUEB 1WBGB 1HAIH 1ZMLA 1TBZH 3OTJE 2FXRA 5DG6A 1BHXB 1AKSA 2VIQA 4OS4A 1P01A 2V3OH 1NFXA 2VIPA 4JK6A 1XM1A 3TIUA 2Z3DA 1N1LA 3QK1A 3EE0B 1MD8A 1O3EA 1SC8U 1X7AC 1TNHA 2CXVA 4ZHAA 3W95A 4XFQA 2XC0A 4ABEA 3UWJH 4WXVA 2ZDMA 1CA0B 1F0UA 2H9HA 1F2SE 5HGGA 1KXBA 2VWMA 3D23A 1A1RA 4UFEH 1C1PA 3GOVB 3LGIA 5JBAS 2ODYB 2Y5GA 3HK3B 2QA9E 4J1YA 5G4BA 2F83A 1G3DA 2Z3CA 3MU0A 5A2MH 3TNTA 4LK4A 2SFAA 1OSSA 1PPCE 3QTVH 1OP8A 1TWXB 1K2I1 3V3MA 1KXAA 5EQSA 4DW2U 1OYTH 1YGCH 3SJ9A 1EKBB 3SUGA 1DICA 3UQOA 5EGMA 4AB9A 1CSOE 1EJAA 5EU8A 1AVWA 1LHFH 2XTTB 2Z7FE 3BEIB 1O2GH 4Q7ZA 3GY4A 2DE9A 2P93A 4Q7XA 2HOBA 5DP9A 1ACBE 2UUYA 3LGVA 1PYTC 3SJKA 3RXOA 4HTCH 1GBEA 1EAXA 2FLBH 2G52A 1ELTA 2ZC9H 3RXLA 3JZ2B 2D1JA 1GHAF 1HAPH 1ANBA 1WU1A 2BLOA 1NO9H 2ALVA 4CR9A 5C2ZA 2BDIA 1T31A 1FY3A 3M5MA 1CQQA 3PM3A 2NU3E 2O8MA 1ANEA 3SGBE 3SU4A 1D4PB 4OS7A 4BXSA 4A1TA 3T2NA 5E0GA 5BRRE 1CU1A 3BTME 4YM9A 3SOSA 1DT2A 3STJA 1GHYH 4X1RU 1QHRB 1K1IA 1AZZA 3A80A 3TJVA 2A4OA 5GIBA 1DDJA 1HB0B 2F91A 4FU7A 3MO6A 4WY3A 3SUDA 1BTWA 4THNH 4X2YA 2FOEA 5AVDA 3SO3A 2FDAA 1AGJA 2AYWA 1FPCH 4D8NA 2RCEA 1GMCF 4E05H 1KDQB 1YLDA 1ESTA 5T6DA 1IHTH 4ZKNU 3NK8A 1K1PA 2XYAA 1GCDA 1TABE 2XCNA 3GY6A 3LH1A 1KXDA 3EQ0H 2LNCA 5FHTA 2FIRH 5DO4H 1EZUC 4AYVB 3MNXA 3NWUA 2ZIQH 1MAYA 2AIPA 1LVBA 1C4Y2 3PLBA 1IOEA 3UY9A 1MKWK 2WPMS 4Y7BA 3LDXH 1J14A 5F8ZA 2RG3A 3UNQA 1G2LA 3M3TA 2BY8X 4Q7YA 1GL1A 2QXGA 1FY4A 5DK1A 2P94A 3M37A 3H5CB 1J15A 2D8WA 1DWEH 1UTOA 5JDUB 2BXTH 2OC0A 3PMBB 2OBOA 2XWAA 1O2SA 1EATA 1XUGA 2GDDA 1TNJA 2SNVA 1EXFA 2FYRA 1WSSH 5FBEA 1ZTLA 3AAUA 1XUIA 4Y8XA 4D7FA 1P04A 1SGNE 5F8TA 2LPRA 4AZ2B 1BTPA 1G3BA 3VGCC 1VJAU 2G5NA 3K9XB 1TNIA 3O8BA 4ABHA 3AVZA 1P05A 3PLKA 1GBIA 3RC5A 1E0FD 2GV7A 4MLFB 4H6TA 1EASA 2AMDA 2PLXA 2SGEE 3DFLA 1NFWA 2G5VA 4A1XA 1TE0A 2F9VA 1ETRH 5FPSA 1GBBA 3A85A 1TMUH 4B76A 1PQ5A 3UPEA 2FWWA 4RSPA 1MKXH 4UONA 1SI5H 4FUJA 4WJG2 1W11U 1YCPM 1L4DA 2AMPA 5CHAB 3BG8A 1O39A 2BD3A 3OY6U 1INCA 5DP7A 2AEIH 3UIRA 3BIVH 4MG3A 2Y5HA 2P8OC 2FYQA 1AB9C 2CHAB 1LVMA 3ZZ7A 1W14U 1LKBA 5A8XA 2TGDA 1GBHA 1XXDA 2RDLA 4NIXA 5C20A 1BRUP 2FP7B 2F3CE 2QF0A 3UTUH 3S0NA 2ZCLP 3RU4E 3NKKA 3QGJA 4K8BA 3T29A 3A8BA 2Y80A 1TGTA 4IBLH 2A4RA 2C3SA 1C4U2 5HMAA 3MU4A 1VITG 1VR1H 3M7QA 1DM4B 3JZ1B 4DT7B 5GWZA 2J9NA 3EYDA 2BQ6B 1UCYK 1XVOA 1PQ7A 3M5LA 4XE4A 3RMMH 2GCTB 1GGDC 2BXUH 3SGAE 1ELCA 3BTFE 1MU6B 1BBRE 1NFYA 1EOLA 2EI8A 4INLA 1VJ9U 1H4WA 4ISNA 2Z6BD 3VB6A 2ULLA 1A61H 4X1QU 2GZ8A 3VFEA 3O8RA 3A7XA 3AAVA 3P8FA 1UTNA 8GCHG 1C5XB 1IAUA 4NA7A 1K1MA 5CMXH 1AVGH 1LMWB 1HAGE 1P2KA 1O3CA 1Z6EA 1BJUA 1CGHA 1QB1A 1Y3UA 4IGDA 1SLWB 3EGKH 1TPAE 2C4FH 3SV7A 5GXPA 3LH3A 3VB7A 2EA3A 3BEUA 1QURH 1YPEH 1N8OC 1YC0A 2FEQH 2ZCKP 1SLUB 3MYWA 1AN1E 1UVOA 3TGKE 2BLWA 1GVZA 4TPIZ 2Y82A 3N7OA 2ANYA 2GV6A 1YP9A 1O2TA 2TRMA 2P59A 3KN2A 5JB9S 3A86A 2BY6X 3CENA 3RXJA 4NIYA 4INHA 1SGPE 2QAAA 1K28D 1HAOH 1RD3B 3ATIA 2RA3A 1FQ3A 4Q80A 1ELDE 3SV2H 1CGJE 1KLJH 3S7KB 1ZJKA 1VGCC 2FI5E 1LQEA 2OINA 2OCVB 1GJ6A 4YLQH 3RMNH 2F9BH 1BMAA 1AHTH 1K9OE 1O3BA 3IWMA 2ZEBA 5DKMA 4ASHA 1OX1A 1EPTC 1ESBA 1OWHA 2GD4B 2R3UA 1UK4A 1FAKH 2GKVE 1WTHD 1LHGH 3RM0H 1IQGA 3SNBA 1TNGA 3PO1C 3F9HA 2FOHA 1GI2A 3DHKH 4NGAH 1YKTA 1AFEH 1O5FH 2Z9IA 1ANDA 1A3EH 2VIVA 2ZHWH 4OS2A 2DE8A 1PPBH 2BHGA 2CJIA 5L2ZH 1C5MD 1V2RT 1GMDG 2H5CA 1WQVH 4GCHG 4XBCA 2A32A 2FLRH 2Z9GA 1LKAA 1TMBH 3G01A 5A0AE 3KL6A 2BTCE 4R0IA 3PWCA 2VH6A 4NIVA 3S9BA 1O2HA 2A7JA 4YT6H 4E06H 1G9IE 1HNEE 1HJAB 1W10U 3V13A 2WYJA 3I78A 1C2EA 1EP6A 2XBXA 5GCHG 4MPXA 2UWOA 2V35A 3Q3KA 4ZXXH 4JCNA 1Z8RA 1GJDB 1E37B 3RMOH 1ELGA 1O2YA 2IJOB 1BIOA 1JOUB 2ZGCA 4A1VA 3RXGA 1MTSA 1FY5A 1W0YH 1CA0C 1J16A 2WPJS 2BD7A 5A0BA 2TBSA 2ZFSA 1Z8GA 4FUBA 1DWBH 5ABWA 1SGCA 3GY5A 1KLIH 3P92A 3UFAA 4BAHB 1P09A 4ABDA 2VU8E 3I77A 2XW9A 1O2RA 3KEEA 5PTPA 2F9PA 3ZZ6A 1BRAA 4XOJA 5K7RA 4ISHH 1UHBA 1TGCA 1CVWH 3BSQA 1FIZA 2PKSB 5GJ4B 2QIQA 3U1JB 4JMYA 1G30B 2AS9A 4BOHA 1KTTB 1AIXH 1O32A 1HXFH 4UFFH 1DE7H 1SB1H 4YO9A 1NRPH 4ABIA 2XC4A 1E35B 1D9IA 1C2HA 5J4SA 4WVPE 2A45B 4ZROA 1O2ZA 1H9LB 1JMOH 1L1GA 2AFQB 2JH5D 2BY5X 4O03A 1ZPCA 4OS1A 1C4V2 1EUFA 2ODPA 5C3NA 1MBMA 1NRQH 1KYNA 1SBWA 3M5OA 2VB0A 4U2WA 1DSTA 1GI5A 1K1OA 1PYTD 1C1VH 2OC8A 1SGQE 3PMJA 4I8GA 1O0DH 3BTDE 1SGDE 2AGIX 3B23B 3PROA 1ELBA 1WTGH 1LQDB 1VITF 4FUHA 1YCPH 2A5KA 4RKJB 5EPNA 3QUMP 2Y7ZA 1C2JA 2PSXA 2PHBA 1GBAA 1O3KA 1UVTH 3A7WA 2HLCA 1AD8H 1IQMA 1QBVH 4NWLA 3MO9A 1IQNA 1NESE 1DWDH 1A5GH 3LGUA 2H5DA 1XKBC 3RC6A 4AG1A 5ESTE 2GMTC 1T8OA 1G3CA 1S81A 3PYHA 1BBRH 3GY8A 1SFIA 4M7GA 3ZV9A 2XWBI 8GCHF 2O8TA 3T25A 3URCA 4AORA 3S9CA 1O2LA 4Y7AA 2GZ9A 5EOKA 3EA7A 3K6ZA 1OYQA 1IQJA 1S83A 2WPLS 2ZU2A 1LHEH 1NM6A 4WXIA 1WUNH 1IQHA 1QJ1B 3DFJA 1GCTB 1KIGH 1YBWA 3DUXH 1PPFE 3RXFA 3SBKA 4SGAE 3GISB 5ESBA 2ZGBH 1TA6A 1O37A 2EI7A 5C5OA 1C2DA 1HUTH 1TOMH 4AOQA 3EAJA 3QDZB 3E6PH 3LT3A 2BZAA 5F6MA 1Q3XA 3SU0A 2QXJA 1A0JA 4GSOA 5F8XA 1FMGA 1MTNB 1JWTA 3A87A 3SU5A 1GJAB 3E0PB 7ESTE 1DY9A 1AFQB 3NXPA 3HK6B 3LOXA 3RXHA 1GHXH 4FXGH 2A7HA 3ZVGA 2TPIZ 1F0TA 1MKXK 3SU6A 3LC5A 4UFGH 2XCFA 1OPHB 1O35A 4FU9A 3PWBA 3O8CA 3PTBA 3O8DA 1K21H 3AW1A 2BDBA 2CF9H 3ZZBA 3ZYDA 5AFYH 1V2LT 3HPTB 5FX6A 2AGEX 3M7UA 4DOQA 3FVFB 5EQRA 2M5TA 1GMDF 1P2OA 5E0HA 1YLCA 1HIAA 1TGNA 2PWXA 4GCHF 5C5NA 4AGKA 3QN7A 1YPKH 1LPKB 2YNAA 4IN2A 1TQ0B 1QIXB 2EI6A 3SN8A 4K2YA 5CHAC 2VIDA 5JBBS 3SGQE 1WQSA 5GCHF 5AF9H 2CHAC 3BTQE 3KHVA 1O5DH 7KMEH 3MNCA 2VVUA 4I33A 3SJOA 1JXPA 1YPHE 2ZI2H 2QF3A 4D76A 4XBBA 1C2LA 1F92A 1TPPA 2V0BA 2BVXH 3TLOA 1AQ7A 4NA9H 2VJ1A 3UWIA 1AI8H 1V2TT 4Z6AH 1W0ZU 4JYUH 2P3FH 2VWOA 1QRZA 3GCHC 2OC1A 1AUTC 4O3UA 3GDVA 2ALPA 4SGBE 2THFB 2CV3A 4FUFA 1K22H 2PUQH 1QL8A 3VB4A 1Z6JH 1XUKA 3TK5A 3UOUA 1GBMA 2BD4A 3R0FA 4DY7B 1C1OA 1H1BA 1PQAA 1C1NA 4NZQA 1SGFA 1W12U 3KCGH 3SJIA 2GCTC 4X8UH 3V12A 4HGCA 1DVAH 1A5IA 2ANKH 4KELA 5SGAE 2QGRA 6LPRA 3ATLA 1Q2WA 3Q00A 1EAUA 1WOFA 4NIWA 3M5NA 4CRFA 1BTYA 1U6QA 3I29A 1V2VT 1SQTA 3M3VA 4JZDH 4D7GA 6CHAB 1C5LH 2GCHG 2HPQH 5EG4A 1SMFE 1BTXA 1NRRH 2OP9A 4KTUA 2VNTA 2ZHDA 1RFNA 1HJ8A 1AE8H 4ZXYH 1QB9A 1TPSA 1EAIA 1TFXA 4D9RA 1ZSKA 1O2PA 2HALA 3LKWA 1ELAA 4HFPB 3E91A 1FNIA 2R2MB 3E8LA 3ZVDA 4FUGA 1JRTA 4GHQA 2FODA 1A4WH 1QCPA 1CHGA 2PSYA 3UREA 1Z71A 2CF8H 1SHYA 4AFQA 2ZP0H 1ZGIA 4I32A 3TH4H 3ZZDA 2VVVA 3A82A 1O2QA 1TB6H 2ZPSA 3BF6H 1CE5A 1P2MA 5BPEA 2ANWA 3E1XB 1BTUA 5T3HA 1RXPA 3BG4B 1XXFA 3ODDA 1S0QA 1C1UH 5JBTA 1HPGA 4TY6A 1PFXC 1O5EH 2ZWLH 3VB5A 1O3HA 2Z9KA 1N6XA 3GDSA 3QTOH 3ZVCA 1O31A 1SQAA 4MNVA 1RGQA 5FBIA 2A1DB 5ETXA 1MTWA 2VIOA 3SW2B 4ZKOU 4FUDA 1N6YA 3SJ8A 4E7NA 3K65B 2FPZA 4MVNA 3QO6A 5EXLA 4Y8ZA 1AO5A 4CREA 4ZMAH 1NRSH 4ZUHA 1MBQA 1YPMH 1CT4E 2A5IA 3K2UA 4X6PA 2ZKSA 3KQCA 3PV4A 2ANMH 1ZHMA 3NPSA 1V2WT 1VCPA 3E90B 1DXWA 1GJCB 4I7YH 3WY8A 2BQWB 4ABBA 3HGPA 8LPRA 3L6PA 3MTYA 2BDGA 2PTNA 1KLTA 4X0WU 1PPEE 1TPOA 4IS5A 4WMEA 1C5RA 3MH5A 3MU5A 3T26A 2NU4E 3AW0A 4BAKB 1AY6H 1MU8B 3V0XA 1ZHPA 1D3PB 1GBTA 1MQ5A 1L1NA 1O38A 1O36A 1ZPZA 1LPZB 3SZNA 4BAQB 1UJ1A 1TNLA 4O3TA 4BNRA 1Z7KA 3A7VA 4B73A 2J38A 1QJ7B 2UUKB 3SORA 1XKAC 1UTMA 4RKOB 1O3JA 1S6FA 3SU1A 4YT7H 1RIWC 1DITH 2ESTE 1ARBA 1FAXA 3GCOA 2D26C 2ZPRA 2AIQA 5EPYA 2ZU3A 1GG6B 3SNCA 1SLXB 5C67A 2PKSC 2A7CA 1IHSH 1HAZB 3TJOA 4JZIA 1TOCB 1GWAA 3KF2A 2PKAB 2B7DH 2SGDE 1NROH 3TVJB 1LDTT 1BOQA 1QA7A 5I46H 2O9QA 1EPTA 1OOKB 3SQEE 1QQUA 1TA2A 3S7HB 4Q2KA 3DD2H 2WV5A 5FX5A 1ZYOA 2QCYA 1Y5AT 5A0CA 1GDQA 2A4GA 1O3LA 4WF8A 1GVLA 1YCPK 4A6LA 2FOMB 5EW1H 5T6FA 1OWEA 1MH0A 2PTCE 1NT1A 2BMGB 2UWLA 3C1KA 1FIWA 3UQVA 2Q6GA 3UR9A 2JETB 1G2MA 2W7SA 2P3TB 2OLGA 1OS8A 2AMQA 2BD9A 4CRDA 5FAHA 4UDWH 4DJZB 4JZFH 1G32B 2WINI 2WV4A 4TY7A 1QTFA 2AERH 1O2MA 1UCYE 1GI9B 1HAVB 4AB8A 4NCYA 1QBOA 1C2FA 1BBRK 4DVAU 3LGYA 2DUCA 2Z9JA 1C2GA 1FJSA 1MZAA 4AYYB 4ABAA 3UOPA 4YOIA 4GUXA 1DSUA 2QXIA 2BY9X 1LHDH 5TJXA 2BM2A 4K3JA 3BN9A 3H7OA 1W8BH 1Y3VA 1ZR0A 1TBRH 3GCTG 2H1UA 4Y76A 1ZGVA 3L33A 5LPRA 2ZA5A 3MNBA 2XXLA 5DGJA 1Y3WA 4Y0ZE 1O2NA 1EAWA 1H8IH 2GCHF 3SV6A 1EJNA 1C5SA 1O2JA 1IQIA 4GLYA 4Y0YE 3A89A 1YPHC 1KSNA 1J17T 4I31A 1IQKA 3LGWA 1HAHH 1BA8B 1F0RA 2YNBA 3QLPH 3RU4T 5JB8S 2WUCA 3LGTA 1GCTC 3A7ZA 2Z94A 2TIOA 1FV9A 1F5LA 1OWJA 1SGEE 2VGCC 3U98H 1KXCA 1AKSB 1S85A 1LHCH 3LJOA 1FDPA 3RM2H 4K5ZA 3EA9A 1Q31A 3RU4D 1T8MA 4CRCA 2VVCA 4CRBA 4WMFA 1ZLRA 4I8JA 1O3GA 2G4UA 1GI4A 2IPHA 1HCGA 1ZMNA 4K60A 3U8TH 2ZFQH 4U01A 1MTNC 4ABJA 3TJNA 1GJ7B 1K1NA 4GVUA 1D6WA 1HAXB 4MNXA 4IMZA 1C2KA 1CHOG 1AFQC 1P06A 4KP0A 1NPMA 5FPYA 1Y3XA 1EP5A 3P6ZB 1QA0A 2O8UA 2PV9B 4FUIA 3RUOA 4KGAA 1C1RA 3KNXA 4CRAA 1G37A 2VH0A 1UTLM 3RXIA 1SSXA 3TU7H 3MMGA 1P3EA 2W5EA 1LTOA 3F68H 3F1SB 1FN8A 2JH0D 1GHBG 2J95A 2GVFA 1KDQA 3RP2A 2WYGA 1V2ST 4IN1A 1GI6A 3KIDU 1DANH 4UFDH 1MZDA 1ZRBA 1SGFG 1O5BB 1QB6A 2QXHA 2V3HH 1C1MA 2QY0B 2PGBB 1CT0E 1GMHG 7GCHG 2FM2A 1YM0A 3TK6A 3GY7A 2BVRH 2HNTF 3MH7A 1BTHH 1SG8B 2QN5T 3GYLB 1K1JA 3FFGA 3RXEA 4TYDA 1H9IE 4ZAEA 1EZXC 1B7XB 3RXAA 1UVPA 3ENSB 1F5RA 1W7GH 2SGFE 1V2QT 1A0HB 3CS7A 5IYTA 4VGCB 1ELEE 1GJ8B 3E0NB 2R9PA 2BD2A 1BRCE 2ZQ1A 2J94A 1TNKA 2C8WB 3T28A 1IQFA 1NS3A 4AGJA 1CBWB 2A2XH 2BDAA 4H6SB 3M7TA 3MNSA 4ZKRU 3STIA 4FUCA 1BDAA 1GBFA 5JPMH 1TLDA 3LPRA 2SGAA 2GDEH 1P2IA 3GICB 1LVYA 2G55A 4Y10E 1RRKA 5L2YH 1ZMJA 1T32A 1DFPA 1W3CA 1UTQA 2ASUB 5L30H 3FZZA 1HXEH 2ZFRH 1NZQH 4XBDA 1GI7B 4B75A 2ZU1A 1TGSZ 4K1EA 1TRNA 1QNJA 3ESTA 3P95A 6CHAC 4BTIB 4B2CA 3MU1A 2FS8A 2UUJB 4MTBA 4MPVA 4UE7H 2PR3A 3UR6A 2GZ7A 1RTKA 3A83A 1EB1H 1O3DA 1GGDB 1AWHB 1TONA 4AFSA 3PLPA 2ZDVH 3ELAH 1AWFH 4KTCA 1XVMA 1BTZA 3LIWA 1UVUH 1VCQA 2H2ZA 3SHAH 3FP7E 3ITIA 3S9AA 4CHAB 1THPB 4LZ1H 5A09A 1TAWA 2FMJA 4CBNA 1WCZA 2B9LA 2FTLE 3SHCH 1PPGE 4X1PU 1TX6A 2AH4X 1E34B 2FO9A 1FZZA 4O97A 1AU8A 1GHZA 1Y3YA 5TCCA 4YOJA 1D3QB 3P70B 1UK2A 2A2QH 3GCTF 4A92A 1TQ7B 1W2KH 1CO7E 1TALA 3ZVEA 1S0RA 1SGRE 2B5TB 1O2XA 4B74A 1SR5C 4LXBH 5IDKA 1O34A 1ANCA 4AN7A 3TK9A 1DLKB 1BITA 3RXUA 1GJ5H 1P9SA 2UWPA 3NCLA 2PUXB 3FP6E 3EA8A 3TITA 4BAMB
chains in the Genus database with same CATH superfamily
2GX4A 2YMSC 3BTGE 2ZPQA 4Y8YA 3MH4A 1O3NA 1OXGA 4TWYA 3ZVAA 2OTVA 2ZHQH 4UP5A 5JBCS 2HVYB 3E3TA 5JYIA 1HAYB 4B2BA 2H9TH 2OQUA 2KFTA 3MU8A 1C1TA 1T8LA 5HM9A 1ARCA 2QYIA 1Y8TA 3D65E 2J92A 1WEWA 1GJBB 3OTPA 2H0DA 3SV9A 2FOGA 4QF3A 4F1PA 1T7CA 4E7RG 5DP3A 3U69H 4DIHH 2TGAA 3N99A 1X4UA 3O36A 1QQ4A 2FOCA 4BANB 4LLBA 1P2JA 1ZRKA 3ZNIA 4OGEA 3DA9B 2H6MA 1H8ED 2UUFB 1O3OA 2K8IA 2FESH 4D9QA 1ZHRA 1SPJA 4RI0A 1V2KT 2KWOA 5LPEA 1FONA 3K6YA 3WWBA 4KTSA 3U8OH 5TBNA 3ZZ3A 1XUHA 2G00A 5GNDA 1TIOA 4H9DA 1BT7A 1UVSH 2OXSA 1O2OA 2FX4A 5F03A 1C5VA 5AFZH 9ESTA 1CHOF 1YF4A 3PO1B 1SL3A 1YYY1 4K69A 5LH8A 1LPGB 2W7UA 2R3YA 3TGIE 3UNRA 1GBLA 3C27B 4CH2B 2ZDLA 1AZ8A 2A4QA 1QGFA 2NU1E 2Q1JA 5E0JA 4I8KA 4U32A 1E36B 2GT8A 2J4IA 1KY9A 4ZH8A 2CMYA 3N7DA 3GDUA 1OWKA 4DURA 1EZSC 1C1SA 2WPKS 3CNRA 4GHTA 3SNAA 1KXFA 3OX7U 2Z9LA 3KQEA 2SGPE 2OQ5A 5C1YA 4S3OB 1V2MT 3DPLR 1GHBF 1C5NH 1GBDA 1MTVA 2XBYA 4X6NA 2V7QD 1GG6C 1P0SH 5HM2A 5K0HA 2KWJA 2VWNA 3PMAB 1B0FA 4OS6A 1GBCA 3KV5A 3A8DA 4FU8A 5C0TA 4H42U 1GJ4H 4X2XA 1WEEA 5CDFE 3SU3A 2HGTH 2KCOA 1GMHF 7GCHF 1PPZA 1VCWA 5GDSH 1V6DA 1S5SA 2W26A 2QV1A 1EX3A 3QX5H 3WWFA 1C9TA 3T7LA 5TDRA 4NG9H 3MWIU 2D2DA 1F7ZA 1QZ8A 3BTTE 3TJUA 2XOKD 4X6OA 3KQBA 2ZO3H 3ZZ8A 2IN2A 4JZEH 1GPZA 3VPKA 2ZZUH 3FANA 2FX6A 2G51A 2MA5A 4FVDA 5K3QA 5HYOA 5C17A 1ZBDB 3B9FH 5FCKA 2JETC 3Q1DA 1MTUA 1YPJH 2L75A 1GI0A 4ISLA 5DP6A 4Z0KA 3O33A 2FOAA 5G05B 4F55A 3MOCA 1UO6A 1G25A 2KKYA 2AN6A 4XD7D 3ATWA 1BRBE 1DUAA 2LQ6A 1MCVA 1BB0B 3VEQB 4TPYA 1P03A 4ACAA 1L0ZA 1DPOA 3SNDA 2OUAA 1OWIA 2J98B 4BHWA 1CA8B 2ODQA 2ZECA 1MCTA 1HJ9A 1THSH 2TGTA 1ORFA 4MPWA 3U9AH 2EEKA 3MI4A 4NZLA 1DY8A 3A8CA 1A2CH 4X8SH 1QY6A 2BZ6H 4O62A 1MABB 3FN8A 1OP0A 2BX3A 3SI4H 1E1RD 1HGTH 9LPRA 2ZETC 2JMDA 4X2WA 5J4QA 5C94A 5TDWA 1BMMH 1VYXA 2G8TA 2Y81A 1KTSB 4TWWA 1YPGH 2NU2E 2H9EH 1DX5M 1TX7A 1DOJA 1C2MA 1J9CH 1S6HA 4F52B 1P2QA 1TRMA 5E2PA 1L4ZA 4HZHA 2GT7A 5EXNA 4CR5A 4K8YA 2KYUA 2FOBA 1GDUA 2QC2A 2F9NA 2O8WA 1GHVH 1O3MA 3I2DA 1F0SA 1C5WB 2GMTB 2ZDKA 2KU3A 1IQEA 4ISIH 1P12E 1SOTA 2BLQA 4ISOA 3BTHE 1DS2E 1Y5BT 4MSXA 2CKLB 1RTLA 1HFDA 3LJJA 3P17H 3F2HA 1SHHB 4GAWA 2FI4E 4YESB 1HV7A 2MKEA 2C93B 1FX0B 4AG2A 2P16A 1ABJH 1KXEA 1COWD 2ZF0H 4Y6DA 5I3LA 1ZTKA 2B8OH 2C90B 3RXRA 1ZJDA 5EYAF 3ZVFA 2VJFB 4J2YB 3HKIB 2XBVA 4H4FA 6GCHG 1HBTH 1FI8A 3DDTA 1BMNH 1UHBB 2KWKA 2UZGA 2BD8A 3MH6A 1C5TA 5DJ7A 3L1ZB 1HJAC 2OD3B 1V3XA 5EW2H 2C8ZB 3FAOA 4FVBA 5C13A 5E8EH 4BBQA 2ZFPH 3SHBA 2ZU5A 4IMQA 4WH8A 1HLTH 2OBQA 1T4VH 3NUMA 1C5QA 1P3CA 5T6GA 2ZNKH 1DUEA 1HYLA 2XBWA 1L1JA 1HRTH 5E2OA 1O2WA 2A0QB 3M7KA 4AYCA 4YBSA 3LU9B 3LRQA 3U5PA 4RN6A 2BYAX 4LZ4B 3R3GB 4X1NU 1JRSA 4WH6A 5H1UA 1YY3A 3ZV8A 3GCNA 1O5CB 4ZHLU 4CH8B 1OKXA 4CA1A 2Y6TA 1SFQB 2GP9B 1BQYA 4MQAA 2ZDAH 4A7IB 2SGQE 3UUZA 4Y71A 2QF5A 1P02A 4VGCC 2LGKA 3A8AA 2IOTA 4X1SU 3F6UH 4U30A 5AHGH 4WMDA 3D62A 2BQ7B 2W3IA 1Z8JB 1SVPA 1BHXF 3BTEE 1CBWC 4FUEA 3T9KA 2CN0H 3E16B 2JJ1D 2XC5A 2STAE 3NZIA 3T62A 1GDNA 3TPIZ 4A4CA 1Z8IB 5EODA 1LVOA 1AUJA 2G6QA 1WAYB 2VINA 1NN6A 3FP8E 4DT4A 3KNVA 1UTJA 1H9HE 8KME2 2YOLA 2ECVA 3BV9B 2VNFA 5FXLA 2R0KA 3ATKA 4I86A 5HIZA 1C2IA 3QWCH 2KAIA 3GS9A 2ZFFH 1HDTH 2BY7X 2STBE 4HG6A 1PJPA 1BMLA 2JKHA 1P11E 2XRCA 4P02A 1QL9A 3GCHB 4KKDA 2EODA 3BTWE 2J34A 3L3TA 3A7TA 3N7EA 4X8VH 5G0FA 4NWKA 3Q77A 3VB3A 1ZOMA 2LAUA 3TNSA 4NSVA 5DPAA 2K1JA 2SNWA 1TGBA 1FPHH 1NU7B 2FI3E 5L6NH 4CCGX 4AFUA 2ZGXH 4CRGA 4A49A 1THRH 4F4OC 5H9MA 1MD7A 2LGGA 1ZZZA 1DLEA 4WWYA 1XUJA 3VG8A 4ZHMU 1D6RA 3TH2H 1O2KA 3F9GA 2HNTE 3RXSA 1FBVA 2J5UA 2E6SA 4LK9A 1DXPA 1O2IA 2P3UB 4JK5A 3ZZ4A 1MMJN 2EXUA 3WW7A 2Y7XA 3BTKE 2ZCHP 4CHAC 2NU0E 5LGOA 2P95A 1C9PA 2PW8H 1QJ6B 1V2JT 2ECTA 4AX9H 1EZQA 1C5ZB 2NWNA 1BUIA 5KGOA 4INKA 5CE1A 5EXMA 3S69A 2F43B 1AMHA 1NRNH 2AGGX 4K1SA 2GGVB 1BZXE 1JIRA 1PQ8A 1TBQH 1UK3A 1E38B 4UD9H 4WA6A 2J2UA 1NY22 3RPGC 2C8YB 4BXWA 5EIYA 1A46H 1EQ9A 1UTKA 2OC7A 5HXFA 1WILA 1Z60A 4Y11E 1T4UH 3P8GA 2CRRA 3IITA 1Y59T 2KKXA 5C1XA 2I6QA 5I25A 3MO3A 1W13U 2Y43A 3P8OA 4GPGA 1TYNA 1O3FA 3PRDA 5TRBA 3M3SA 5H4IB 1FN6A 3RXPA 2Q6DA 2A5AA 3RXMA 4B6FA 2W6ID 1RTFB 3D49H 2BDYA 3U1IB 1ELFA 4ESTE 3P8NA 1HIAB 1K1LA 4I8HA 2F9UA 1ELVA 1P57B 2WPHS 1XUFA 2VPDA 1YPLH 2YMSD 2LXHC 1V2NT 1TRYA 3T6RA 1V2OT 1AVXA 1FY1A 3QZQA 4YLUA 3IG6B 3Q3XA 2ZTXA 2ZGJA 2ZFTA 2K1QA 3MFJA 4NFEA 1QR3E 1O3PB 1GI3A 1ABIH 2DJAA 3SI3H 3HATH 3OSYA 3RXQA 4UEHH 3BIUH 2B0FA 2HRVA 3ZZ9A 1TX8A 1ETTH 1GVKB 3OE7D 3SUFA 1ZSLA 3BEFB 4BTTB 2JUNA 1A0LA 1ZSJA 1D3TB 4WZ0A 4YZUA 1ETSH 1XMNB 2ZQ2A 1E79D 3ZZAA 3F9FA 3ATMA 3LVQE 1V87A 1NU9A 2KCPA 3T5FH 2CGAA 2Y1NA 3RLWH 2FD4A 3M61U 1T8NA 2BOHB 4X8TH 1V2PT 1EOJA 3GY3A 1IQLA 4B2AA 5DP8A 2I50A 2VIWA 4Y79A 3GY2A 3QGNB 1MKWH 6GCHF 2MNYA 3ZPVE 3ZTGA 2WPIS 4NA8A 3A81A 3URDA 3PMHB 4YADA 1QL7A 1SGIB 4DG4A 3DT0H 2ZTYA 2HVXA 3TGJE 2XOCA 1TMTH 5D1KB 4OM9A 4OS5A 3VGCB 1SGTA 5B6OA 1UMAH 1C1QA 2YQLA 3ZVBA 3CS0A 2ZDNA 1B0EA 4HI3A 4S3OC 5FPTA 3LONA 3F9EA 3M62A 2KZ4A 3CP7A 1ZPBA 1G36A 1JBUH 3SU2A 3VXFH 2BB4A 4ABGA 3MHWU 4JYVH 2L80A 1GI1A 1LCYA 4K1TA 3O37A 1M9UA 3RDZA 3B8JA 2HDPA 2I6SA 4ABFA 4X2VA 1GHWH 1V2UT 1RJXB 1O30A 3KQDA 1Z1JA 4YTAA 2QE7D 4MNWA 2Y5FA 2YSMA 3H7HA 5FCRA 2YU4A 1RIWB 1WV7H 3PB1E 5F53A 2P8OB 1AB9B 1JIMA 2R0LA 1A3BH 2ZGHA 1BJVA 4A5TS 4JYTA 4BAOB 1OP2A 2WV9A 1CGIE 1EB2A 3Q3YA 2KWNA 3HCSA 4FETA 2BX4A 1IYMA 1F5KU 3KGPA 1O5GH 3RXKA 5A8YA 3UNSA 1UTPA 3TH3H 4OGXA 1QRXA 2VWLA 1ESAA 1GBJA 1S82A 1J8AA 1SKYE 1Y5UT 3ODFA 2R2WU 3KDEC 2C8XB 1GHAG 3ZZ5A 1O3IA 1FY8E 3AASA 7LPRA 2FTMA 3H7TA 3SNEA 2HWLB 4IW4E 1S84A 2TGPZ 4C9ZA 3PV2A 1XX9A 2BLVA 4DGJA 2OWAA 3PTNA 2K0QA 2GTBA 4Z1MD 1SOZA 2FS9A 3A84A 4NFFA 1SLVB 4E06H 5C1UA 2O8LA 3RLYH 1L2EA 4I7CA 1B5GH 1HYIA 2HPPH 4ZKSU 2L7PA 2ZTZA 1A5HA 3OAAD 2BDHA 3RXDA 1A7SA 1C5PA 1NTPA 3MDBC 1O3AA 1VZQH 2G4TA 2F9OA 3RXVA 3EDXB 5KH3A 1Z1IA 5TABA 3RXCA 3RC4A 1DWCH 2PFEA 1O2UA 8ESTE 3T27A 4CBOA 3Q76A 1C5YB 1O5AB 4QT8C 1FUJA 2BDCA 1D3DB 2XNIA 3FOAA 4B71A 1H8DH 2YQMA 3OYPA 1WEOA 2A31A 2PKAA 5DP5A 1EJMA 2FOFA 3MHSA 4I8LA 1P2NA 2WUBA 2B0OE 1QBNA 1UCYH 1G3EA 2ZG0H 5GPIB 1GMCG 4B1TA 2XOZA 3HGNA 2EY4C 5EQQA 2D8SA 3ZVZB 5TCAA 1GI8B 2ZU4A 3RXTA 4L58A 3U8RH 4NSYA 4Q6FA 2BD5A 5LPFA 4P5OB 1GL0E 2P57A 1RS0A 1FXYA 1ID5H 3ZZCA 3BG4C 3OU0A 1CT2E 4DCDA 2G81E 4MNYA 1SGYE 3GYMA 3VXEH 3SV8A 2ZHFH 3FZDA 1N8OB 1QFKH 3N9OA 3M35A 3LC3A 3QZRA 4X6MA 4Z0OA 1GJ9B 4PROA 1O2VA 1O33A 1NFUA 2BOKA 4IC6A 4JZ1A 5A8ZA 1HAVA 4MDSA 4OGYA 3RMLH 6ESTA 3O34A 4DIIH 3SUEA 4AFZA 1BCUH 2GJGA 5C0UA 2EC9H 2Z3EA 3A7YA 2MUMA 4XSKU 2FZZA 2VGCB 3U5OA 3A88A 4L7XA 3M36A 3ZYEA 1P10A 2VJEA 1VGCB 2JH6D 2ZHEH 2BVSH 2V6NA 4BTUB 1AE5A 1MQ6A 1LO6A 2RA0A 1QRWA 3SQHE 1PPHE 4XDEA 2L5UA 1FLEE 1P8VC 5D1LB 2JMJA 1EPTB 2W3KA 2HNTC 1WYKA 4YOGA 1C1WH 4MPUA 3OY5U 1ZTJA 2PGQB 4LOYH 1OWDA 2ILNA 1WXRA 3FM8C 4Q63A 2QJ0A 3W94A 4R8TB 1VITH 1C5UA 2Q6FA 3HKJB 1W7XH 5DP4A 4F49A 5SVIB 1GBKA 1SQOA 2KAIB 1C5OH 1MAXA 3RXBA 1P9UA 3V7TA 4O9VA 4IC5A 1NC6A 1MUEB 1WBGB 2JM3A 1HAIH 1ZMLA 1TBZH 3OTJE 2FXRA 5DG6A 1BHXB 3U5MA 1AKSA 2VIQA 4OS4A 1P01A 2V3OH 1NFXA 2VIPA 4JK6A 1XM1A 3V43A 1JM7A 3TIUA 2Z3DA 1N1LA 3QK1A 3EE0B 1MD8A 1O3EA 1SC8U 1X7AC 5SVXA 3FEHA 4OGCA 1TNHA 2CXVA 4ZHAA 3W95A 4XFQA 2XC0A 4ABEA 3UWJH 4WXVA 2RFKC 2ZDMA 1CA0B 2KR4A 1F0UA 2H9HA 1F2SE 5HGGA 1KXBA 2VWMA 3D23A 1A1RA 4UFEH 1C1PA 3GOVB 3LGIA 4TT3D 5JBAS 2ODYB 2DSMA 2Y5GA 3HK3B 2QA9E 4ZUXU 4J1YA 5G4BA 2F83A 1G3DA 2Z3CA 3MU0A 5A2MH 4FJCA 2MIQA 3TNTA 1CHCA 4LK4A 2SFAA 1OSSA 1PPCE 3QTVH 2K4DA 1OP8A 4FK5A 1TWXB 3LQIA 1K2I1 3V3MA 1KXAA 5EQSA 4DW2U 4YC9A 1OYTH 1YGCH 3SJ9A 1EKBB 3SUGA 1DICA 3UQOA 5EGMA 4W4UA 4GNDA 4AB9A 1CSOE 1EJAA 5EU8A 1AVWA 1LHFH 2XTTB 2Z7FE 3BEIB 1O2GH 4Q7ZA 3GY4A 2DE9A 2P93A 2YREA 4Q7XA 4ACBA 2HOBA 5DP9A 1ACBE 4GNGA 2UUYA 3LGVA 1PYTC 3SJKA 3RXOA 4HTCH 1GBEA 3N9NA 1EAXA 2FLBH 2G52A 2YT5A 3FJUB 1ELTA 2ZC9H 2JDID 3RXLA 3JZ2B 5B6LA 2D1JA 1GHAF 2FUUA 2KFWA 1HAPH 1ANBA 1WU1A 2BLOA 3KYGA 1NO9H 2ALVA 4CR9A 5C2ZA 2BDIA 1T31A 3FL2A 5B76A 1FY3A 3M5MA 4LJNA 1CQQA 3PM3A 2NU3E 2O8MA 1ANEA 3SGBE 3SU4A 1D4PB 4OS7A 2HLDD 4BXSA 4A1TA 3T2NA 5E0GA 5BRRE 4V3LC 1CU1A 3BTME 4YM9A 3SOSA 1DT2A 4YXWD 3STJA 5LCWB 1GHYH 4X1RU 1QHRB 1K1IA 1AZZA 3A80A 1H8HD 3TJVA 2A4OA 5GIBA 1DDJA 1HB0B 2F91A 4FU7A 3FKSD 3MO6A 4WY3A 3SUDA 1BTWA 4THNH 3M63A 2F42A 4X2YA 2FOEA 2IDAA 5AVDA 3SO3A 2FDAA 1AGJA 2AYWA 1FPCH 4D8NA 2RCEA 1GMCF 4E05H 1KDQB 1YLDA 1ESTA 5T6DA 1IHTH 4ZKNU 3NK8A 1K1PA 2XYAA 1GCDA 1TABE 2XCNA 3GY6A 3LH1A 1KXDA 3EQ0H 2LNCA 5FHTA 2FIRH 5KH9A 5DO4H 1EZUC 5IK2D 4AYVB 3MNXA 3NWUA 4Q4LA 3HCUA 2ZIQH 3H09A 4YATA 1MAYA 2AIPA 1LVBA 2YYRA 1C4Y2 3PLBA 1IOEA 2JIZD 3UY9A 1MKWK 2WPMS 4Y7BA 3LDXH 4IC3A 1J14A 2CK3D 2YMSB 5F8ZA 2RI7A 2RG3A 3UNQA 1G2LA 5B78A 2G43A 2M85A 3M3TA 2BY8X 4Q7YA 1GL1A 2QXGA 1FY4A 2CSYA 5DK1A 2P94A 3M37A 3H5CB 1J15A 2D8WA 2LP6A 1DWEH 2ECIA 1UTOA 5JDUB 2BXTH 2OC0A 3PMBB 2OBOA 2XWAA 3EB6A 3DSOA 1O2SA 1EATA 1XUGA 2GDDA 1TNJA 2SNVA 1EXFA 2FYRA 1WSSH 5FBEA 1ZTLA 3AAUA 4Z0RA 1XUIA 1NBME 2W6JD 4Y8XA 4D7FA 1P04A 1SGNE 5F8TA 2LPRA 4AZ2B 1K2FA 4R8PK 1BTPA 2G45A 1G3BA 2IJD1 3VGCC 1VJAU 2G5NA 3K9XB 1TNIA 3O8BA 4ABHA 3AVZA 1P05A 2KCYA 3PLKA 1GBIA 3RC5A 1E0FD 2GV7A 4MLFB 4H6TA 4UI9B 1EASA 2AMDA 2PLXA 2SGEE 3DFLA 1NFWA 3L11A 2G5VA 3C5KA 4A1XA 1TE0A 2F9VA 3KQIA 1ETRH 5FPSA 1GBBA 3A85A 1TMUH 4B76A 1PQ5A 3GL6A 3UPEA 2FWWA 4RSPA 1MKXH 4UONA 1SI5H 4FUJA 4WJG2 1W11U 1YCPM 1L4DA 2AMPA 5CHAB 3BG8A 1O39A 3QZVA 2BD3A 3NRLA 3OY6U 1WENA 1INCA 1OHHD 2D8UA 5DP7A 2AEIH 3UIRA 2IQJA 4B7YC 3BIVH 4MG3A 2Y5HA 2P8OC 2FYQA 1AB9C 2CHAB 1LVMA 2IPQX 3ZZ7A 1W14U 1LKBA 3LVRE 5A8XA 2TGDA 1GBHA 4LADB 1XXDA 2RDLA 4NIXA 5C20A 2ECGA 1BRUP 2FP7B 2F3CE 2QF0A 3UTUH 3S0NA 2ZCLP 3RU4E 3O35A 3NKKA 3QGJA 3OEED 4K8BA 3T29A 3A8BA 1K0HA 5H1VA 2Y80A 1TGTA 4IBLH 2A4RA 2C3SA 2YVRA 1C4U2 5HMAA 3MU4A 1VITG 3PV5A 1VR1H 3M7QA 1DM4B 3KYFA 3JZ1B 4DT7B 5GWZA 2J9NA 3EYDA 2BQ6B 4TSFD 1UCYK 1XVOA 3DCLA 1PQ7A 3M5LA 4XE4A 3RMMH 2GCTB 1GGDC 2BXUH 3SGAE 1ELCA 3BTFE 1MU6B 1BBRE 1NFYA 2FUIA 1EOLA 2EI8A 3PUQA 4INLA 1VJ9U 1H4WA 4ISNA 2Z6BD 3VB6A 2ULLA 1A61H 4X1QU 2GZ8A 3VFEA 3O8RA 2WSSD 2H0DB 3A7XA 1EFRD 2V3MA 2KM0A 3AAVA 3P8FA 1UTNA 8GCHG 1C5XB 1IAUA 4NA7A 2ECNA 1K1MA 5CMXH 1WEQA 1AVGH 1LMWB 2M6MA 1HAGE 3PHDA 1P2KA 1O3CA 5KECA 1Z6EA 1BJUA 1CGHA 1QB1A 1Y3UA 4IGDA 1SQRA 1SLWB 2MD7B 3EGKH 1TPAE 2C4FH 3SV7A 5GXPA 3LH3A 3VB7A 2EA3A 4ZQLA 3DWDA 3BEUA 1QURH 1YPEH 1N8OC 1YC0A 2FEQH 2ZCKP 3ZYQA 1SLUB 3MYWA 3SOWA 1AN1E 1UVOA 3TGKE 2BLWA 3W1EA 1GVZA 4TPIZ 2Y82A 3N7OA 2ANYA 2M3HA 5B77A 2GV6A 1YP9A 1O2TA 2TRMA 2P59A 3KN2A 5JB9S 3A86A 2BY6X 3CENA 3RXJA 2J98A 4NIYA 4INHA 1SGPE 2QAAA 5H1TA 1K28D 1HAOH 1RD3B 4ASUD 3ATIA 2RA3A 1WDIA 1FQ3A 1MM2A 4Q80A 5EJLA 1ELDE 3SV2H 1CGJE 1KLJH 3S7KB 1ZJKA 1VGCC 4A0CD 2FI5E 1LQEA 2OINA 2OCVB 1GJ6A 4YLQH 4X3GA 3RMNH 2F9BH 1BMAA 1AHTH 1K9OE 1O3BA 3IWMA 2ZEBA 5DKMA 2KREA 2M13A 4ASHA 1OX1A 1EPTC 1ESBA 1OWHA 2GD4B 2R3UA 4GNEA 1UK4A 1FAKH 2GKVE 1WTHD 1LHGH 3RM0H 2YURA 1IQGA 3OFND 3SNBA 1TNGA 3PO1C 3F9HA 4AVXA 2FOHA 4YBMA 1GI2A 3DHKH 4NGAH 1YKTA 1AFEH 1O5FH 2CRWA 2Z9IA 1ANDA 5KH7A 1A3EH 2VIVA 2ZHWH 4OS2A 2DE8A 1PPBH 2BHGA 2CJIA 5L2ZH 1C5MD 1V2RT 1GMDG 2H5CA 1WQVH 1LDJB 4GCHG 4XBCA 2A32A 2FLRH 2Z9GA 1LKAA 1TMBH 3G01A 5A0AE 3KL6A 2BTCE 4R0IA 3PWCA 2VH6A 4NIVA 2EGPA 3S9BA 2FFWA 1O2HA 2A7JA 4YT6H 3F0PA 1G9IE 1HNEE 1HJAB 1W10U 2PP6A 2WYJA 3I78A 1C2EA 1EP6A 3UAIC 3V13A 2XBXA 5GCHG 1BMFD 4MPXA 2UWOA 2V35A 3Q3KA 1FP0A 4ZXXH 4JCNA 1Z8RA 2PUYA 1GJDB 1E37B 5AITA 3RMOH 1ELGA 1O2YA 2IJOB 2QIZA 1BIOA 1JOUB 2ZGCA 4MVTA 4A1VA 3RXGA 1MTSA 1FY5A 1W0YH 1CA0C 1J16A 2WPJS 2BD7A 5A0BA 2TBSA 2ZFSA 1Z8GA 4FUBA 1DWBH 5ABWA 1SGCA 3GY5A 1KLIH 3P92A 4FO9A 2WZQA 3UFAA 4BAHB 2VJFA 1P09A 4ABDA 2VU8E 3SUBA 3I77A 2WHXA 2XW9A 1O2RA 3KEEA 5PTPA 2LXPC 2F9PA 3ZZ6A 1BRAA 4XOJA 1N87A 5K7RA 4ISHH 1UHBA 2JJ2D 1TGCA 2VBCA 1CVWH 3BSQA 1FIZA 2PKSB 5GJ4B 2QIQA 3C6WA 3U1JB 4JMYA 1G30B 1X4IA 2AS9A 4BOHA 1KTTB 1AIXH 3F2FA 1O32A 1HXFH 4UFFH 1DE7H 1SB1H 4YO9A 1NRPH 4ABIA 2XC4A 1E35B 1D9IA 1C2HA 5J4SA 4WVPE 2A45B 4ZROA 1O2ZA 1MM3A 1H9LB 1JMOH 1L1GA 2AFQB 2JH5D 2BY5X 4O03A 1ZPCA 4OS1A 4RT0A 1C4V2 2NAAA 1EUFA 2ODPA 2CSZA 5C3NA 1MBMA 2L43A 1NRQH 1KYNA 1SBWA 2YSJA 3M5OA 2VB0A 4U2WA 1DSTA 1VKYA 1GI5A 1K1OA 1PYTD 1C1VH 2OC8A 1SGQE 3PMJA 2VPEA 3N9MA 4I8GA 1O0DH 3BTDE 1SGDE 2AGIX 2LGVA 3B23B 3PROA 1ELBA 1WTGH 3MHHA 1LQDB 1VITF 4FUHA 5LKZA 1YCPH 2A5KA 4RKJB 5EPNA 3QUMP 3F3BA 2Y7ZA 1C2JA 2PSXA 2PHBA 3SOXA 1DCQA 1GBAA 1O3KA 1UVTH 3A7WA 2HLCA 1AD8H 1IQMA 1QBVH 3KQ5A 4NWLA 3MO9A 1IQNA 1NESE 1DWDH 2L0BA 1A5GH 3LGUA 2H5DA 3AK5A 1XKBC 3RC6A 4AG1A 5ESTE 2GMTC 2Y1MA 1T8OA 1G3CA 1S81A 3PYHA 1E4UA 1BBRH 3GY8A 1SFIA 4M7GA 3ZV9A 2XWBI 8GCHF 2O8TA 3T25A 3URCA 4AORA 3S9CA 1O2LA 2L74A 4Y7AA 2GZ9A 5EOKA 2M2AA 3EA7A 2F6NA 3K6ZA 1OYQA 1IQJA 1S83A 2WPLS 2ZU2A 1LHEH 4B6EA 2BAYA 1NM6A 4WXIA 1WUNH 4N3WA 1IQHA 4AYCB 1QJ1B 3DFJA 1RMDA 1GCTB 1KIGH 1YBWA 2YUCA 2C2LA 3DUXH 3O7AA 2MT5A 1PPFE 3RXFA 3SBKA 4SGAE 3GISB 5ESBA 3N9PA 2ZGBH 1TA6A 2FSAA 1O37A 2EI7A 5C5OA 1C2DA 1HUTH 1TOMH 4AOQA 3EAJA 5EJZA 3QDZB 3E6PH 3LT3A 2BZAA 5F6MA 1Q3XA 3SU0A 2CONA 2QXJA 1A0JA 4GSOA 5F8XA 1FMGA 1MTNB 1JWTA 2LN0A 5T1VA 3A87A 3SU5A 1GJAB 2YHNA 3E0PB 7ESTE 1DY9A 1AFQB 3NXPA 3HK6B 3LOXA 2CT2A 3RXHA 1GHXH 4FXGH 2A7HA 2KGGA 2KIZA 3ZVGA 3SOUA 4ZCNA 2TPIZ 1F0TA 1MKXK 3SU6A 1WEUA 2EGMA 3LC5A 4UFGH 2XCFA 1OPHB 1O35A 5HKKD 4FU9A 3PWBA 3O8CA 2DX8A 3PTBA 3O8DA 2MD8C 1K21H 3AW1A 2BDBA 2CF9H 3SYJA 3ZZBA 3ZYDA 5AFYH 1V2LT 3HPTB 5FX6A 2AGEX 3M7UA 4DOQA 3FVFB 5EQRA 2M5TA 1GMDF 1P2OA 5E0HA 2J97A 1YLCA 1HIAA 1TGNA 2PWXA 4GCHF 5C5NA 3DSGA 4AGKA 3QN7A 1DVPA 1YPKH 1LPKB 2YNAA 4IN2A 1TQ0B 2ECWA 1QIXB 2EI6A 2JRJA 3SN8A 4K2YA 5CHAC 3GV4A 4LKAA 2VIDA 5FERA 5JBBS 3SGQE 4PPEA 1WQSA 5GCHF 5AF9H 2CHAC 3BTQE 3LDYA 3KHVA 1O5DH 7KMEH 3MNCA 2VVUA 4I33A 3SJOA 1JXPA 5FB1A 1YPHE 2ZI2H 2QF3A 4D76A 4XBBA 1C2LA 1F92A 1YWUA 1TPPA 2V0BA 2BVXH 3TLOA 1AQ7A 4NA9H 2VJ1A 3UWIA 1AI8H 1V2TT 4Z6AH 1W0ZU 4JYUH 2P3FH 1XWHA 2VWOA 1QRZA 1W0KD 3GCHC 2OC1A 3UB0A 1AUTC 4O3UA 4RT1A 3GDVA 2ALPA 4SGBE 2THFB 2CV3A 4FUFA 1K22H 2PUQH 1QL8A 3VB4A 2KX4A 3U28C 1Z6JH 5CHBA 1XUKA 5B75A 3TK5A 3ZIAD 3UOUA 1GBMA 2BD4A 3R0FA 4DY7B 1C1OA 1H1BA 1PQAA 1C1NA 3EE7A 1SGFA 1W12U 4NZQA 3KCGH 1WIMA 3SJIA 2GCTC 4X8UH 3V12A 4HGCA 2K16A 1DVAH 1A5IA 2ANKH 4KELA 5SGAE 2QGRA 3ZVYA 6LPRA 4AP4A 3ATLA 1Q2WA 3Q00A 1EAUA 1WOFA 4NIWA 3M5NA 4CRFA 1BTYA 1U6QA 3I29A 1V2VT 4XI1A 1SQTA 3M3VA 2VP7A 4JZDH 4D7GA 6CHAB 1C5LH 2GCHG 2HPQH 2MNZA 5EG4A 1Z6UA 4TKPB 1SMFE 1BTXA 1NRRH 2OP9A 4KTUA 2VNTA 2ZHDA 1RFNA 1HJ8A 1AE8H 4ZXYH 2CSVA 1QB9A 1TPSA 5G04B 1EAIA 1VFYA 1TFXA 2XP0A 4D9RA 1ZSKA 3N9LA 1O2PA 2HALA 3LKWA 1ELAA 4HFPB 3E91A 1FNIA 2R2MB 3E8LA 3ZVDA 4FUGA 1JRTA 4GHQA 2FODA 1A4WH 1QCPA 3LQJA 1CHGA 2PSYA 2LGLA 1HYJA 5DSFA 3O47A 3UREA 1Z71A 2CF8H 1SHYA 4AFQA 3PLWA 2ZP0H 1ZGIA 4I32A 4B86C 3TH4H 3ZZDA 2VVVA 3A82A 1O2QA 1TB6H 2ZPSA 3BF6H 4I7DA 1CE5A 1P2MA 4M9FA 5BPEA 2ANWA 3E1XB 2LELA 2KCAA 1Z2QA 1BTUA 2RSDA 5T3HA 1RXPA 3BG4B 1XXFA 3ODDA 1S0QA 1C1UH 5JBTA 1HPGA 4TY6A 1PFXC 1O5EH 2LV9A 2ZWLH 4R7EA 3VB5A 1O3HA 4GB0A 2Z9KA 1N6XA 3GDSA 3QTOH 3ZVCA 4WZ2A 1O31A 1SQAA 4MNVA 1RGQA 5FBIA 2A1DB 5ETXA 1MTWA 2VIOA 3SW2B 3PRBA 4ZKOU 4FUDA 1N6YA 3SJ8A 4E7NA 3K65B 2FPZA 4MVNA 3QO6A 2OK5A 5EXLA 4Y8ZA 4XRNA 1AO5A 4CREA 4A4BA 4ZMAH 1NRSH 4ZUHA 1MBQA 1YPMH 1CT4E 2A5IA 3K2UA 4X6PA 2ZKSA 3KQCA 3PV4A 2KGIA 2ANMH 1ZHMA 3NPSA 1V2WT 1VCPA 3E90B 2PNXA 1DXWA 1GJCB 4I7YH 3WY8A 2BQWB 4ABBA 3HGPA 8LPRA 3L6PA 1W0JD 3MTYA 2BDGA 2PTNA 3M99A 1KLTA 4X0WU 1PPEE 1TPOA 4IS5A 4WMEA 1C5RA 3MH5A 3MU5A 1UW7A 2NU4E 3T26A 3AW0A 4BAKB 1AY6H 1MU8B 3V0XA 1ZHPA 1D3PB 1GBTA 1MQ5A 4YABA 1L1NA 1VD4A 1O38A 1O36A 1ZPZA 1LPZB 3SZNA 2OXQC 4BAQB 1UJ1A 1TNLA 4O3TA 4BNRA 1Z7KA 2QF4A 3A7VA 5EJ1A 5DINA 4B73A 2J38A 1QJ7B 2L6OA 2F6JA 2UUKB 3SORA 1XKAC 4YBTA 1UTMA 4RKOB 1O3JA 1S6FA 3SU1A 4YT7H 1RIWC 1DITH 2ESTE 1ARBA 1FAXA 3GCOA 2D26C 2ZPRA 2VPGA 5LKXA 2AIQA 5DKAA 5EPYA 2ZU3A 1GG6B 3SNCA 1SLXB 5C67A 2PKSC 5FB0A 2A7CA 1IHSH 1HAZB 3TJOA 4JZIA 1TOCB 1GWAA 3KF2A 2PKAB 2B7DH 2SGDE 1NROH 3TVJB 1LDTT 1BOQA 1QA7A 5I46H 2O9QA 5D1MB 3OEHD 1EPTA 3FO8D 1OOKB 3SQEE 1QQUA 1TA2A 3S7HB 2YHOA 4Q2KA 3DD2H 3HTKC 5LKTA 2WV5A 5FX5A 1ZYOA 4NN2A 2QCYA 1Y5AT 4FOUC 4AUQB 5A0CA 1GDQA 2A4GA 1O3LA 4WF8A 1GVLA 1YCPK 4FIPA 4A6LA 2FOMB 5EW1H 5T6FA 1OWEA 1MH0A 2PTCE 5SVIA 1NT1A 2BMGB 2UWLA 3C1KA 1FIWA 3UQVA 2Q6GA 5C11A 3IHPA 3UR9A 2JETB 1G2MA 2W7SA 4N4FA 2P3TB 2OLGA 1OS8A 2AMQA 2BD9A 4CRDA 5FAHA 4UDWH 4DJZB 4JZFH 1G32B 3MQKC 2LRIC 2WINI 2AHME 2WV4A 4TY7A 1QTFA 2AERH 1NBMD 4O64A 1O2MA 1UCYE 1GI9B 1WEPA 1HAVB 2XNDD 4AB8A 4NCYA 1QBOA 3SZEA 1C2FA 1BBRK 4DVAU 3LGYA 2M1RA 2DUCA 2Z9JA 3F2GA 1C2GA 1FJSA 3JUEA 1MZAA 4AYYB 4ABAA 4UP0A 3UOPA 2XB1A 4YOIA 4GUXA 1DSUA 2E6RA 2QXIA 2BY9X 1LHDH 2VJEB 5TJXA 2BM2A 2WPDD 2KE1A 2EQNA 4K3JA 3BN9A 3H7OA 1W8BH 1Y3VA 1ZR0A 1TBRH 3GCTG 2H1UA 3RTRB 4Y76A 4F48B 2HYED 1ZGVA 3L33A 5LPRA 2ZA5A 3MNBA 2XXLA 5DGJA 1Y3WA 4Y0ZE 1O2NA 4QF2A 1EAWA 2KR7A 1H8IH 2GCHF 3SV6A 1EJNA 1C5SA 1O2JA 1IQIA 4GLYA 4Y0YE 3U5NA 3A89A 2F4LA 3KV6A 1YPHC 1KSNA 1J17T 4I31A 1IQKA 3PURA 3LGWA 1HAHH 1BA8B 1F0RA 2YNBA 3QLPH 3RU4T 5JB8S 1WEVA 2WUCA 3LGTA 1GCTC 3A7ZA 4GNFA 2Z94A 2TIOA 1FV9A 1F5LA 3VK6A 1OWJA 1SGEE 2VGCC 3U98H 1KXCA 1AKSB 1S85A 2RDEA 1LHCH 3LJOA 1FDPA 1JM7B 5SVYA 3RM2H 4K5ZA 3EA9A 1Q31A 1WGMA 3RU4D 1T8MA 4CRCA 3O70A 2VVCA 4CRBA 1YLNA 4WMFA 1ZLRA 4I8JA 1O3GA 2LDRA 2G4UA 1GI4A 2IPHA 1HCGA 1ZMNA 4V3KC 4K60A 4P00A 3U8TH 5LKUA 2ZFQH 4U01A 1MTNC 2ECJA 4ABJA 3TJNA 1GJ7B 1K1NA 4GVUA 1D6WA 1HAXB 4MNXA 4IMZA 1C2KA 1CHOG 2YW8A 1AFQC 4ZDTA 3L1XA 1P06A 4KP0A 1NPMA 5FPYA 1Y3XA 1EP5A 3P6ZB 1QA0A 5KEDA 2O8UA 2PV9B 4FUIA 3RUOA 5HIYA 4KGAA 5FEYA 1C1RA 3KNXA 4CRAA 1WEMA 1G37A 2VH0A 1UTLM 3RXIA 1SSXA 3TU7H 3MMGA 1X4JA 1P3EA 2W5EA 1LTOA 3EB5A 3F68H 3F1SB 1FN8A 2JH0D 2XOYA 1GHBG 2J95A 2GVFA 1KDQA 3RP2A 2WYGA 1V2ST 4IN1A 5DN6D 1GI6A 3KIDU 1DANH 4UFDH 1S6LA 2CKLA 1MZDA 1ZRBA 1SGFG 1O5BB 1QB6A 2QXHA 2V3HH 1C1MA 2QY0B 2PGBB 1CT0E 3LQHA 1GMHG 7GCHG 2FM2A 1YM0A 3TK6A 3GY7A 2BVRH 2HNTF 3MH7A 1BTHH 3ZPV1 1SG8B 2QN5T 3GYLB 1K1JA 3FFGA 3RXEA 4TYDA 2VPBA 4PTBA 1H9IE 4ZAEA 1EZXC 1B7XB 3RXAA 1UVPA 3ENSB 1F5RA 1W7GH 2SGFE 1V2QT 1A0HB 3DQVR 3CS7A 5IYTA 4VGCB 1ELEE 1GJ8B 3E0NB 2R9PA 2XEUA 2BD2A 1BRCE 2ZQ1A 2J94A 3LJUX 1TNKA 2C8WB 3T28A 1IQFA 1NS3A 4AGJA 1CBWB 2A2XH 5JG6A 2BDAA 2RR4A 4H6SB 4R2YA 3F0OA 3M7TA 3MNSA 4ZKRU 2C2VS 4QQ4A 1U6GB 3STIA 4FUCA 1BDAA 3N9QA 1GBFA 1BORA 4IC2A 5JPMH 2JMIA 1TLDA 3LPRA 2EA6A 5B8DA 2SGAA 2GDEH 1P2IA 3GICB 5FL7D 1LVYA 2G55A 4Y10E 1RRKA 5L2YH 1WE9A 1T1HA 1ZMJA 5J3XA 1T32A 1DFPA 1W3CA 1UTQA 2ASUB 5L30H 5AIUA 3FZZA 1HXEH 2ZFRH 1NZQH 4XBDA 1GI7B 4B75A 1JOCA 2ZU1A 1TGSZ 4YAXA 3E2DA 1F62A 4K1EA 1TRNA 1QNJA 3ESTA 3P95A 6CHAC 2QICA 4BTIB 4B2CA 3HCTA 3MU1A 2FS8A 2UUJB 4MTBA 2E61A 4MPVA 4UE7H 4AC9A 2PR3A 3UR6A 2GZ7A 1RTKA 3A83A 1EB1H 1O3DA 1GGDB 1AWHB 1TONA 4AFSA 3PLPA 2ZDVH 3ELAH 5B79A 1AWFH 3NG2A 4KTCA 1XVMA 1BTZA 2K17A 3LIWA 1UVUH 3ASLA 1VCQA 2H2ZA 3SHAH 3FP7E 3ITIA 3S9AA 4CHAB 1THPB 4LZ1H 5A09A 1TAWA 2MA6A 1LDKC 2FMJA 4CBNA 1WCZA 2B9LA 2FTLE 3SHCH 1PPGE 4X1PU 1TX6A 4I7BA 1E1QD 2AH4X 1E34B 2FO9A 1FZZA 1WESA 1KMHB 4O97A 1AU8A 1GHZA 1Y3YA 5TCCA 4YOJA 1D3QB 3P70B 1UK2A 3RPGB 2A2QH 3GCTF 4A92A 1TQ7B 1W2KH 1CO7E 1TALA 3DSPA 3ZVEA 1S0RA 1SGRE 2B5TB 1O2XA 4B74A 1SR5C 4LXBH 5IDKA 1O34A 1ANCA 4WZ3B 4AN7A 3TK9A 1DLKB 1BITA 3RXUA 1GJ5H 1P9SA 2UWPA 3NCLA 2PUXB 3FP6E 3EA8A 3TITA 4BAMB 1WFKA
chains in the Genus database with same CATH topology
2GX4A 3BTGE 2ZPQA 4Y8YA 3MH4A 1O3NA 1OXGA 4TWYA 3ZVAA 2OTVA 2ZHQH 5JBCS 3E3TA 5JYIA 1HAYB 4B2BA 2H9TH 2OQUA 3MU8A 1C1TA 1T8LA 5HM9A 1ARCA 2QYIA 1Y8TA 3D65E 2J92A 1GJBB 3SV9A 2FOGA 1T7CA 4E7RG 5DP3A 3U69H 4DIHH 2TGAA 1QQ4A 2FOCA 4BANB 1P2JA 1ZRKA 3DA9B 2H6MA 2UUFB 1O3OA 4D9QA 2FESH 1ZHRA 1SPJA 1V2KT 5LPEA 1FONA 3K6YA 4KTSA 3U8OH 3ZZ3A 1XUHA 2G00A 1TIOA 1BT7A 1UVSH 2OXSA 1O2OA 2FX4A 5F03A 1C5VA 5AFZH 9ESTA 1CHOF 1YF4A 3PO1B 1SL3A 1YYY1 4K69A 5LH8A 1LPGB 2W7UA 2R3YA 3TGIE 3UNRA 1GBLA 3C27B 4CH2B 2ZDLA 1AZ8A 2A4QA 1QGFA 2NU1E 2Q1JA 5E0JA 4I8KA 4U32A 1E36B 2GT8A 2J4IA 1KY9A 4ZH8A 2CMYA 3GDUA 1OWKA 4DURA 1EZSC 1C1SA 2WPKS 4GHTA 3SNAA 1KXFA 3OX7U 2Z9LA 3KQEA 2SGPE 2OQ5A 5C1YA 1V2MT 1GHBF 1C5NH 1GBDA 1MTVA 2XBYA 4X6NA 1GG6C 1P0SH 5HM2A 5K0HA 2VWNA 3PMAB 1B0FA 4OS6A 1GBCA 3A8DA 4FU8A 4H42U 1GJ4H 4X2XA 3SU3A 2HGTH 1GMHF 7GCHF 1PPZA 1VCWA 5GDSH 1V6DA 1S5SA 2W26A 2QV1A 1EX3A 3QX5H 1C9TA 4NG9H 3MWIU 2D2DA 1F7ZA 3BTTE 3TJUA 4X6OA 3KQBA 2ZO3H 3ZZ8A 2IN2A 4JZEH 1GPZA 3VPKA 2ZZUH 3FANA 2FX6A 2G51A 4FVDA 5HYOA 3B9FH 5FCKA 2JETC 1MTUA 1YPJH 1GI0A 4ISLA 5DP6A 4Z0KA 2FOAA 3MOCA 1UO6A 3ATWA 1BRBE 1DUAA 1MCVA 1BB0B 3VEQB 4TPYA 1P03A 1L0ZA 1DPOA 3SNDA 2OUAA 1OWIA 1CA8B 2ODQA 2ZECA 1MCTA 1HJ9A 1THSH 2TGTA 1ORFA 4MPWA 3U9AH 2EEKA 3MI4A 4NZLA 1DY8A 3A8CA 1A2CH 4X8SH 1QY6A 2BZ6H 1OP0A 2BX3A 3SI4H 9LPRA 1HGTH 4X2WA 5J4QA 1BMMH 2G8TA 2Y81A 1KTSB 4TWWA 1YPGH 2NU2E 2H9EH 1DX5M 1TX7A 1DOJA 1C2MA 1J9CH 1S6HA 1P2QA 1TRMA 5E2PA 1L4ZA 4HZHA 2GT7A 5EXNA 4CR5A 4K8YA 2FOBA 1GDUA 2QC2A 2F9NA 2O8WA 1GHVH 1O3MA 1F0SA 1C5WB 2GMTB 2ZDKA 1IQEA 4ISIH 1P12E 1SOTA 2BLQA 4ISOA 3BTHE 1DS2E 1Y5BT 1RTLA 1HFDA 3LJJA 3P17H 1SHHB 4GAWA 2FI4E 4YESB 1HV7A 2C93B 4AG2A 2P16A 1ABJH 1KXEA 2ZF0H 4Y6DA 1ZTKA 2B8OH 2C90B 3RXRA 1ZJDA 3ZVFA 4J2YB 3HKIB 2XBVA 4H4FA 6GCHG 1HBTH 1FI8A 1BMNH 1UHBB 2BD8A 3MH6A 1C5TA 5DJ7A 1HJAC 2OD3B 1V3XA 5EW2H 2C8ZB 3FAOA 4FVBA 5E8EH 2ZFPH 2ZU5A 4IMQA 4WH8A 1HLTH 2OBQA 1T4VH 3NUMA 1C5QA 1P3CA 5T6GA 2ZNKH 1DUEA 1HYLA 2XBWA 1L1JA 1HRTH 5E2OA 1O2WA 2A0QB 3LU9B 4RN6A 2BYAX 4LZ4B 3R3GB 4X1NU 1JRSA 4WH6A 3ZV8A 3GCNA 1O5CB 4ZHLU 4CH8B 1OKXA 2Y6TA 1SFQB 2GP9B 1BQYA 4MQAA 2ZDAH 4A7IB 2SGQE 3UUZA 4Y71A 1P02A 4VGCC 3A8AA 2IOTA 4X1SU 3F6UH 4U30A 5AHGH 4WMDA 3D62A 2BQ7B 2W3IA 1Z8JB 1SVPA 1BHXF 3BTEE 1CBWC 4FUEA 2CN0H 3E16B 2XC5A 2STAE 3NZIA 3T62A 1GDNA 3TPIZ 1Z8IB 5EODA 1LVOA 1AUJA 1WAYB 2VINA 1NN6A 3FP8E 1UTJA 1H9HE 8KME2 2YOLA 3BV9B 5FXLA 2R0KA 3ATKA 1C2IA 3QWCH 2KAIA 2ZFFH 1HDTH 2BY7X 2STBE 1PJPA 1BMLA 2JKHA 1P11E 2XRCA 1QL9A 3GCHB 4KKDA 3BTWE 2J34A 3L3TA 3A7TA 4X8VH 4NWKA 3Q77A 3VB3A 1ZOMA 3TNSA 4NSVA 5DPAA 2SNWA 1TGBA 1FPHH 1NU7B 2FI3E 5L6NH 4AFUA 2ZGXH 4CRGA 1THRH 4F4OC 1MD7A 1ZZZA 1DLEA 4WWYA 1XUJA 4ZHMU 1D6RA 3TH2H 1O2KA 3F9GA 2HNTE 3RXSA 1DXPA 1O2IA 2P3UB 4JK5A 3ZZ4A 1MMJN 2Y7XA 3BTKE 2ZCHP 4CHAC 2NU0E 5LGOA 2P95A 1C9PA 2PW8H 1QJ6B 1V2JT 4AX9H 1EZQA 1C5ZB 2NWNA 1BUIA 4INKA 5CE1A 5EXMA 3S69A 1AMHA 1NRNH 2AGGX 4K1SA 2GGVB 1BZXE 1JIRA 1PQ8A 1TBQH 1UK3A 1E38B 4UD9H 2J2UA 1NY22 2C8YB 4BXWA 1A46H 1EQ9A 1UTKA 2OC7A 5HXFA 4Y11E 1T4UH 3P8GA 3IITA 1Y59T 5C1XA 2I6QA 5I25A 3MO3A 1W13U 3P8OA 4GPGA 1TYNA 1O3FA 3M3SA 5H4IB 1FN6A 3RXPA 2Q6DA 2A5AA 3RXMA 1RTFB 3D49H 2BDYA 3U1IB 1ELFA 4ESTE 3P8NA 1HIAB 1K1LA 4I8HA 2F9UA 1ELVA 1P57B 2WPHS 1XUFA 1YPLH 1V2NT 1TRYA 1V2OT 1AVXA 1FY1A 3QZQA 4YLUA 3IG6B 3Q3XA 2ZTXA 2ZGJA 2ZFTA 2K1QA 3MFJA 4NFEA 1QR3E 1O3PB 1GI3A 1ABIH 3SI3H 3HATH 3OSYA 3RXQA 4UEHH 3BIUH 2B0FA 2HRVA 3ZZ9A 1TX8A 1ETTH 1GVKB 3SUFA 1ZSLA 3BEFB 4BTTB 1A0LA 1ZSJA 1D3TB 4YZUA 1ETSH 1XMNB 2ZQ2A 3ZZAA 3F9FA 3ATMA 1NU9A 3T5FH 2CGAA 3RLWH 3M61U 1T8NA 2BOHB 4X8TH 1V2PT 1EOJA 3GY3A 1IQLA 4B2AA 5DP8A 2VIWA 4Y79A 3GY2A 3QGNB 1MKWH 6GCHF 2WPIS 4NA8A 3A81A 3URDA 3PMHB 1QL7A 1SGIB 4DG4A 3DT0H 2ZTYA 2HVXA 3TGJE 1TMTH 4OS5A 3VGCB 1SGTA 5B6OA 1UMAH 1C1QA 3ZVBA 3CS0A 2ZDNA 1B0EA 4HI3A 5FPTA 3LONA 3F9EA 3CP7A 1ZPBA 1G36A 1JBUH 3SU2A 3VXFH 2BB4A 4ABGA 3MHWU 4JYVH 1GI1A 1LCYA 4K1TA 1M9UA 3RDZA 3B8JA 2I6SA 4ABFA 4X2VA 1GHWH 1V2UT 1RJXB 1O30A 3KQDA 1Z1JA 4YTAA 4MNWA 2Y5FA 5FCRA 1RIWB 1WV7H 3PB1E 2P8OB 1AB9B 1JIMA 2R0LA 1A3BH 2ZGHA 1BJVA 4A5TS 4JYTA 4BAOB 1OP2A 1CGIE 1EB2A 3Q3YA 2BX4A 1F5KU 3KGPA 1O5GH 3RXKA 5A8YA 3UNSA 1UTPA 3TH3H 4OGXA 1QRXA 2VWLA 1ESAA 1GBJA 1S82A 1J8AA 1Y5UT 3ODFA 2R2WU 2C8XB 1GHAG 3ZZ5A 1O3IA 1FY8E 3AASA 7LPRA 2FTMA 3H7TA 3SNEA 2HWLB 4IW4E 1S84A 2TGPZ 1XX9A 2BLVA 4DGJA 3PTNA 2GTBA 1SOZA 2FS9A 3A84A 4NFFA 1SLVB 5C1UA 2O8LA 3RLYH 1L2EA 1B5GH 2HPPH 4ZKSU 2ZTZA 1A5HA 2BDHA 3RXDA 1A7SA 1C5PA 1NTPA 1O3AA 1VZQH 2G4TA 2F9OA 3RXVA 3EDXB 1Z1IA 3RXCA 3RC4A 1DWCH 2PFEA 1O2UA 8ESTE 3T27A 4CBOA 3Q76A 1C5YB 1O5AB 4QT8C 1FUJA 2BDCA 1D3DB 2XNIA 4B71A 1H8DH 3OYPA 2A31A 2PKAA 5DP5A 1EJMA 2FOFA 4I8LA 1P2NA 2WUBA 1QBNA 1UCYH 1G3EA 2ZG0H 5GPIB 1GMCG 4B1TA 3HGNA 5EQQA 5TCAA 1GI8B 2ZU4A 3RXTA 3U8RH 4NSYA 2BD5A 5LPFA 1GL0E 1RS0A 1FXYA 1ID5H 3ZZCA 3BG4C 3OU0A 1CT2E 4DCDA 2G81E 4MNYA 1SGYE 3GYMA 3VXEH 3SV8A 2ZHFH 3FZDA 1N8OB 1QFKH 3M35A 3LC3A 3QZRA 4X6MA 1GJ9B 4PROA 1O2VA 1O33A 1NFUA 2BOKA 4IC6A 4JZ1A 5A8ZA 1HAVA 4MDSA 4OGYA 3RMLH 6ESTA 4DIIH 3SUEA 4AFZA 1BCUH 2EC9H 2Z3EA