3FAOA

Crystal structure of s118a mutant 3clsp of prrsv
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDAGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
total genus 39
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3faoA03
3DFLA 1GJ8B 5F8ZA 1QBOA 1ANCA 2FI3E 1RIWB 1ZTKA 1C2GA 3LGUA 2XTTB 3SUEA 1ESBA 3D65E 1P01A 3GY8A 4ABIA 1BMLA 3U8OH 3LGWA 3KQBA 3MNBA 3TH3H 1EZUC 1ZZZA 2JKHA 2G81E 1NPMA 1GVZA 2VGCB 2JH6D 3GY2A 5E0HA 1AE5A 1XXDA 1W2KH 1FLEE 4IN2A 4MLFB 2G5VA 5HM9A 1AKSB 1W0YH 1EKBB 1AVGH 1UVTH 2AS9A 4BXWA 5DGJA 1IQKA 1E35B 1O2WA 1K1MA 4A7IB 1SSXA 3O8CA 2BVRH 3A88A 1QNJA 4HI3A 1CGJE 2O9QA 4E7RG 1TLDA 2HGTH 1TNKA 1O2ZA 2QF3A 1NFYA 2V6NA 4A1VA 3UY9A 2RDLA 3ZVBA 2BLQA 4KKDA 3ATIA 4GCHG 3SGAE 1D4PB 1ELGA 4UD9H 3RDZA 4O3UA 2W3KA 1HAGE 2BVXH 2Y5FA 3L33A 1AMHA 1VJ9U 3QO6A 3RU4E 1MUEB 2Y81A 2QC2A 1TGCA 2WYGA 1HAZB 3SJKA 5DP9A 3GYLB 1B7XB 1GI9B 2ZCHP 1O2RA 3MU5A 1YPLH 2O8WA 1XUKA 3AW1A 1O2XA 3SQEE 1DXWA 3BTWE 4A1TA 4JZIA 1A2CH 1D6WA 1V2RT 4X1SU 3SI4H 3ZV9A 2ZHFH 1NO9H 2ZG0H 1UO6A 2GVFA 4ZKRU 1AO5A 2PKSB 1YCPH 3U1IB 1W10U 2QF0A 1GI4A 1KLJH 3UNRA 1RIWC 1XMNB 1DWBH 2V3OH 2VVVA 1F92A 1GHXH 3MNSA 1Y59T 1HBTH 1K1PA 2QXJA 2Y82A 1P11E 1C5QA 3RU4D 2Y6TA 5JBTA 2Q6FA 3P17H 2BQ6B 3LH1A 2OQ5A 1K1LA 2Z9GA 2VGCC 3SGBE 1E34B 3B8JA 2BLWA 2BDHA 4JYTA 1O2TA 4UFGH 3MU0A 2XC5A 1GJ4H 4I8GA 1PYTC 2RA0A 4H6SB 4NSVA 1CA8B 1BMAA 3P6ZB 4DURA 3FP8E 5ETXA 2XW9A 4ABHA 1FY4A 4JZDH 1WAYB 4X2VA 1TWXB 2TBSA 1Y5UT 4AFUA 3TGJE 1W7XH 1S0RA 2TGDA 1DY9A 1QHRB 2BY6X 2ZHWH 4K60A 2O8TA 2GT8A 2J38A 1C5YB 1RTKA 1GI1A 1JIMA 1TX6A 1O34A 3MH6A 1C2DA 1LVMA 1V2PT 4I8JA 2ILNA 4MNXA 2H9HA 5JYIA 1YPEH 2CHAB 3DT0H 3SU3A 2IJOB 1JMOH 2AGGX 1A5IA 3A86A 1BTHH 1CHOF 1P2IA 4R0IA 1NY22 3L3TA 1C1SA 2XC4A 3BTTE 4ZAEA 1O3IA 3O8DA 3GICB 3QGJA 2BD5A 1GL0E 3O8RA 1LVOA 2LPRA 2VWOA 1NC6A 6GCHF 1IQIA 1C9PA 2VH6A 3FZZA 3P92A 1SLVB 1O3OA 3M3VA 4BNRA 2FESH 3GY3A 3RXIA 1DXPA 2GMTB 1DVAH 2XWAA 2PKSC 3A80A 1SQAA 1GJDB 4NCYA 1MTNB 2FOBA 1C1UH 1ELCA 1GHVH 2CMYA 5L30H 2VINA 4B73A 2FDAA 1T31A 1ARBA 2P3FH 4YTAA 2GZ9A 3M3SA 4FXGH 1C5TA 4VGCB 2BDIA 3PMHB 1O35A 2ZGBH 4IC6A 5DO4H 3GY7A 4CREA 4DIHH 2PGQB 4DG4A 1BJVA 4X8UH 4X2WA 1GPZA 1CBWB 1K2I1 1O5AB 3F9FA 1O2JA 3U69H 1O2QA 2NU4E 2Z9JA 3ZZ9A 1YBWA 1C5OH 3A83A 3RUOA 1DDJA 1SFQB 4NIXA 3UR9A 3M61U 1TBRH 2UUKB 5A09A 1GVLA 1ZGVA 1TOMH 2VWLA 5DP8A 4B2BA 1S84A 1L4ZA 1EAXA 2BOKA 2BDBA 4ABJA 3LGTA 3W94A 1BQYA 2VIWA 4FUBA 4H4FA 1O2PA 4HFPB 1GJ9B 5HM2A 6GCHG 3RMNH 2ZC9H 1G3DA 5E2PA 5CE1A 4MPVA 6ESTA 2PV9B 2VIQA 3IWMA 3CS7A 2F9OA 1SQOA 4NWLA 3QZQA 2CHAC 5FPTA 2FS8A 1SGDE 1Y3VA 4BTTB 1SGTA 4I8KA 3K65B 3P8GA 4D9QA 4K5ZA 2YOLA 5LPFA 1TAWA 2ANMH 1SGFA 1O3BA 1AGJA 1BTWA 1T8MA 4ISNA 1F5RA 1ANEA 2WPHS 5DJ7A 1GBTA 3E8LA 2R2MB 3A87A 3RXEA 4Y6DA 2W3IA 1NRQH 1BCUH 1Q31A 5EPYA 1OSSA 3BEFB 1LVYA 1H4WA 3JZ2B 1O2MA 3ZZ3A 1QA0A 4U01A 2WV5A 1F0SA 2FM2A 1MTNC 5AVDA 1K28D 1INCA 1UTNA 3KHVA 5HMAA 1P05A 1S6HA 5C1YA 1QTFA 3GCOA 4UFFH 3ZZ8A 1NS3A 5LPEA 2FP7B 4VGCC 1KXBA 3MU8A 3TJNA 3UFAA 3UTUH 3AVZA 1WQSA 2J94A 2FTLE 1C5PA 3MHWU 1MH0A 1CBWC 1C5NH 3PLBA 1EP5A 1QURH 2CJIA 3E6PH 1DWDH 1AVXA 4OGXA 5TCCA 4X2XA 2AYWA 4B75A 2H1UA 5DP7A 3UR6A 3QZRA 1FY1A 4WVPE 2Y80A 5FBIA 1B5GH 3LGIA 3DA9B 2ZPSA 3EQ0H 1IQEA 4OS7A 2BY8X 1D3TB 2ZU4A 2HRVA 4IMQA 2BOHB 1SGRE 2FEQH 1DUEA 1FIWA 1EASA 1UTMA 2TGPZ 2FODA 3M7TA 3T28A 2A32A 3B9FH 3UREA 1C1NA 1V2KT 3TH2H 1FNIA 4Q7ZA 3MTYA 1UJ1A 1Z7KA 1J16A 1ETSH 1SR5C 1OP2A 3RXDA 2XXLA 1HFDA 1DUAA 5DG6A 1HRTH 2VVUA 2OP9A 1ZR0A 4BAQB 2G00A 1IQJA 2QCYA 3VEQB 4YO9A 3PTBA 2F3CE 5AFYH 3A85A 1GJ7B 3GYMA 1GI6A 1DOJA 1PPCE 5J4QA 5TJXA 4INKA 1AFEH 1TBZH 2RG3A 2V35A 3F9GA 3ZVFA 1KTTB 1GBFA 1HIAA 2GZ7A 3SNCA 1GI8B 1P2KA 1L0ZA 4ZHMU 4O03A 1SGPE 1HAVA 2C4FH 3TJUA 2FX6A 1EXFA 4H6TA 1DM4B 3TLOA 3V7TA 3TU7H 1TMUH 4WMDA 2OUAA 5DK1A 3FFGA 2VIDA 4NFEA 3UWIA 1O38A 5JBBS 3CENA 1O31A 2J92A 1SGQE 1GHYH 1ID5H 1GJ5H 3SNAA 1O32A 1DS2E 3M36A 1FXYA 1NN6A 2BD9A 4TY7A 4B76A 2A4GA 1BA8B 4CR9A 4X6OA 1LHEH 4ZH8A 3EA9A 3PO1B 1GJAB 5HGGA 1GHBF 1FQ3A 2ZGJA 1M9UA 3R0FA 3TVJB 5F8XA 1YPGH 1JIRA 3BIUH 1QB6A 3SN8A 4CH8B 1VCWA 1GWAA 1O39A 2Y5HA 3VXEH 3VB4A 1O3GA 2P8OB 2Z94A 4LOYH 1C5ZB 2AFQB 3GCHB 2SNWA 3LH3A 1PQ7A 1O3DA 2ZQ1A 1GI2A 1AD8H 3Q3KA 1CHGA 1LVBA 2BB4A 4FVBA 1FONA 2ALVA 1F5KU 3O8BA 3GY6A 5EOKA 1HAXB 1DSUA 3LJOA 4MTBA 1C1RA 1C5SA 2OC8A 1YPHE 1TGTA 1V2WT 1F7ZA 2THFB 9LPRA 1X7AC 4SGAE 1LHCH 1TYNA 1O2GH 1N8OB 5F03A 1IQFA 1GHAF 1MZAA 1C2HA 2AMDA 3EA8A 1F5LA 2GCHG 4X6PA 1W14U 4ABAA 3RU4T 2OC0A 1KY9A 3MU1A 1QJ1B 1MD8A 1GHBG 2PHBA 4KTUA 1O2HA 4YM9A 1BITA 4CRDA 4WY3A 1O36A 2FMJA 1S81A 1BHXF 1XUIA 1L2EA 1S83A 1CT2E 2FIRH 1TIOA 3RMMH 4Z0KA 1DWCH 1E36B 2EA3A 1RFNA 2D26C 1HYLA 2ESTE 4U32A 4FUGA 4J1YA 2AGEX 3ODDA 1BTZA 1QL9A 1G3EA 1GI0A 1VCPA 4TPYA 1IQHA 3PO1C 3U8RH 4TYDA 2V3HH 3ZZDA 1A5HA 4CRGA 1JBUH 3URCA 1Y5BT 1NZQH 1BMMH 1DFPA 1AVWA 1T8OA 3LC3A 3SHAH 1J15A 1D3PB 1BUIA 1XM1A 3I29A 3C27B 4DT7B 4YOJA 3E0PB 2P8OC 1GHAG 4IMZA 4JYUH 3GCHC 3TK5A 2BD2A 1FIZA 1Y3XA 4NGAH 4TY6A 4Q7XA 5LGOA 1SG8B 2ZHEH 1ZPZA 5EPNA 2AH4X 1K1OA 1TONA 1TALA 5EW2H 1UTJA 1ELFA 2LNCA 1K22H 4R8TB 3OTJE 3IG6B 3Q3XA 3KN2A 1EQ9A 4AFZA 1BRAA 1W3CA 3EE0B 1GMDF 3SUGA 1SGYE 1NTPA 2ZFRH 2FWWA 1ELEE 1K9OE 4OS4A 5C67A 4NIWA 1LKBA 1N8OC 2OCVB 4JCNA 2ZFFH 1ZTJA 2SGEE 3QTVH 4F49A 2EI8A 4X1PU 3GY4A 3UNQA 4WH6A 4MNVA 1O3CA 7GCHG 3UQVA 3W95A 1WTGH 1BRBE 2BX3A 1XKAC 1BTUA 1NRPH 2VWNA 1YF4A 2A0QB 2WPLS 3PLPA 1V2VT 1BTPA 1GBAA 3TJOA 2ALPA 1GCDA 3VB6A 5K7RA 1A1RA 4GPGA 5T3HA 1OWIA 1QRXA 1KXDA 4D9RA 2QAAA 3PMJA 4B1TA 2K1QA 1O3JA 2VU8E 2Z6BD 1S6FA 1PQ5A 4AZ2B 1OS8A 2WPIS 4FU7A 1O3LA 1BTXA 3PLKA 1CT4E 4ABDA 1Z8RA 1D9IA 3KGPA 2R9PA 1ZHRA 1TOCB 1BZXE 1A3BH 1V2ST 1Y3WA 1SGFG 1O2SA 2ZI2H 1GMDG 3KQDA 1A5GH 4X8TH 3SW2B 3ATMA 3T26A 3ZZBA 2NU3E 3STJA 3NWUA 4KELA 3MYWA 4OS2A 2R0LA 2FOEA 1O3HA 2P59A 2H2ZA 3ZZAA 1THPB 3RC6A 5JPMH 1FUJA 1O37A 1ZMJA 4O97A 4M7GA 1O5BB 3SOSA 1P2MA 1N6XA 3MI4A 2BD7A 3QN7A 1OWJA 3PYHA 1BJUA 1O2NA 1SOTA 2G55A 2OXSA 1OXGA 2A4OA 2ZFSA 3SV2H 3SU0A 1V2TT 2FOHA 1NFUA 3DHKH 1ESTA 1VZQH 1GL1A 2A45B 5E2OA 5FX5A 1AN1E 1NU9A 2TGAA 1QJ6B 4NZLA 1EZQA 7LPRA 4X8VH 5B6OA 4NG9H 6CHAB 4ZXYH 3MNXA 1G9IE 2FPZA 3M7UA 2FLRH 5EQQA 2ZU2A 5A0AE 1ZRBA 1GCTB 1SVPA 1ZRKA 5CHAB 2GDEH 3RP2A 2ZDKA 2WUBA 3B23B 1V2UT 1UCYE 1YPKH 1AKSA 1HGTH 1TFXA 2GCTB 2TIOA 2P95A 2ZF0H 3M5MA 5I25A 1MQ6A 4DW2U 3MU4A 2C8WB 2VIVA 1GVKB 2GP9B 4Y0ZE 1E37B 1C9TA 1FDPA 1XKBC 4AFQA 5EW1H 2I6QA 2SGPE 3LU9B 2SFAA 1C1PA 1S5SA 4XBCA 2QIQA 3KCGH 2BY9X 1O3MA 2BLVA 3PMAB 4A5TS 1YCPM 2XCFA 1EAIA 1P2QA 2J9NA 1O3NA 1YM0A 2RA3A 1AWFH 2J2UA 1CU1A 2G51A 2BYAX 1RXPA 2UUJB 1K1JA 3WY8A 4THNH 4ESTE 2J95A 5G4BA 3BTEE 4WJG2 3TK6A 3SV8A 1THRH 5GPIB 1W13U 1QIXB 3M3TA 1ETTH 1HB0B 2D2DA 1D3DB 2O8LA 4ZROA 1XUHA 2A7JA 1GBBA 1O3AA 1RS0A 3S7KB 1PPEE 4ABEA 3NUMA 5T6DA 3KNXA 3BN9A 5C2ZA 2ZIQH 3A8AA 2EI7A 1SMFE 3ZZ5A 2I6SA 1S85A 3QWCH 1G30B 4H42U 2PFEA 3BG8A 4E06H 1UVSH 1KXEA 4ISIH 3DFJA 1ZSJA 3TGKE 1ACBE 3Q76A 5EG4A 3SNEA 6CHAC 4D8NA 7KMEH 2QGRA 1QBNA 3KEEA 2C3SA 1GCTC 1BBRH 2C8XB 5CHAC 1C5UA 2QN5T 3R3GB 3OY5U 2NU0E 3U98H 2GD4B 2W7UA 2ZHDA 1N6YA 4Y7AA 4ZHAA 3K2UA 2BM2A 5IDKA 4INLA 2GCTC 3QTOH 1C5LH 5JBAS 1O2OA 1GBLA 3G01A 1H8DH 3RM0H 5C20A 2ZPRA 3D49H 1EPTB 1OP8A 1ANBA 1DSTA 2ASUB 3BTFE 4FU9A 4ZKOU 5BRRE 1TNGA 3BV9B 4B74A 1O3EA 1BIOA 1LDTT 4K69A 1XUFA 1YKTA 1CHOG 3P8NA 4U30A 2GX4A 4AG1A 1G3BA 2FOCA 3SHCH 1A0LA 1UTKA 2F9UA 4BOHA 4BTUB 1VGCB 4I8HA 1TQ7B 2GDDA 3V0XA 5L2YH 4NIVA 4X1RU 2PR3A 4ASHA 4B71A 3VB3A 4K1TA 5BPEA 5A2MH 4XFQA 4FUDA 1THSH 1MU8B 2BDAA 1J14A 3LPRA 2ZU3A 1DICA 1ELTA 1DLEA 1GGDB 2SGFE 2ZO3H 1GBCA 1VCQA 1F0TA 3E0NB 1W0ZU 1XX9A 2Y7ZA 1QRZA 4HTCH 3SNBA 1G2LA 3ZVCA 1AE8H 4OGYA 1H8IH 1PPFE 1YPMH 1FAKH 3TJVA 4CBOA 1BDAA 3UOUA 3ENSB 1LKAA 1KLTA 2Q6GA 1YPJH 1TX8A 1C2KA 3UPEA 1QL7A 2DE9A 1CVWH 4AORA 5GXPA 4DGJA 1G2MA 1P09A 4Y11E 2ZEBA 1ZSLA 4TWWA 3UIRA 1GBHA 1B0FA 1UCYH 1KLIH 2FX4A 3A7VA 1AB9B 4Z6AH 3NK8A 4ZKNU 2XBYA 1G36A 1XUJA 3LONA 1IQMA 4O3TA 1GJCB 4DY7B 2BY5X 1JRSA 2GT7A 4Y76A 4UEHH 3A81A 2XRCA 1YCPK 2OD3B 3F6UH 3KIDU 3QLPH 1HAHH 2HLCA 1EPTA 3MH7A 3BTDE 1ELAA 5FPYA 1RTLA 2Y7XA 2TRMA 3TGIE 3P95A 5TCAA 1EPTC 1EZSC 3HK3B 3ODFA 4QT8C 4NZQA 1N1LA 4I32A 2WINI 1TRYA 1MKXH 3VGCB 2ZU5A 2QYIA 4MNYA 2DE8A 2ZKSA 2ZDNA 3SZNA 1GDQA 1AZ8A 4AB9A 1VGCC 1T8NA 4YLQH 5K0HA 5E8EH 1F0UA 3TIUA 2FI4E 1MKWH 1WYKA 2A5IA 4MNWA 4LZ4B 1TB6H 1TPPA 4MVNA 3TH4H 1ELDE 1FMGA 2BD3A 1UTOA 4ABBA 1A61H 2Z9KA 5EXNA 1GMHF 2PUXB 3QDZB 1GGDC 1Q3XA 2FZZA 4AFSA 2FS9A 1PPGE 4GSOA 1P9SA 3VB5A 1ARCA 3BTQE 4D7GA 2ZA5A 4K2YA 3Q3YA 2BXTH 1C2IA 2BZ6H 4YT6H 5FXLA 3E1XB 4TPIZ 3ZVGA 4MG3A 2KAIB 8KME2 3N7OA 1GDNA 1P0SH 1ZGIA 2BDYA 4FU8A 3A7XA 2H6MA 1L1JA 3M35A 1KIGH 1UK3A 2Z3DA 2OQUA 5EXMA 2HNTE 1KTSB 2D1JA 4JK5A 2WYJA 1IQLA 1HPGA 4GAWA 1AB9C 2UWOA 4FUHA 4FUCA 1AHTH 1DPOA 3Q00A 4Y8XA 3S9CA 4GHQA 1FPHH 1SB1H 1E0FD 3AAVA 3GISB 4NIYA 1SPJA 1OOKB 2R2WU 1C1VH 1MAYA 1ZOMA 2FTMA 3GCNA 5JB8S 1MAXA 1O5GH 3BG4B 1GJBB 2O8MA 2QY0B 1OKXA 1ABJH 4XBBA 5ABWA 3RC4A 1TMTH 3RXGA 1GMHG 2W26A 1GMCF 2HOBA 3K6YA 3ZVDA 2Q6DA 1PYTD 1Y8TA 5C5OA 5ESTE 1VR1H 3VGCC 1F2SE 4ABFA 1LCYA 1P06A 1H9LB 5F6MA 4WMFA 1HJ8A 3RXJA 1CE5A 2ZGCA 1C2MA 2QXGA 2SGDE 2IOTA 2HPPH 2J34A 3MWIU 3ZYEA 1D3QB 4ZMAH 3GCTF 4AGKA 1SGCA 3SO3A 3TNSA 1AZZA 4LZ1H 2XNIA 1NROH 1MBQA 2SGQE 3TITA 2CV3A 1GBDA 5FX6A 2O8UA 2W7SA 1LPZB 1CO7E 4K1EA 1S0QA 4RKJB 1O5FH 1ZMNA 2KAIA 3A7YA 4CRCA 3OX7U 4X1NU 1MTSA 4CR5A 1P3CA 3K9XB 1BMNH 1AI8H 1TE0A 3V12A 1V6DA 2HVXA 3BIVH 4Y0YE 1CGHA 1MCTA 5EU8A 2FOFA 1C5XB 3HKIB 4BTIB 4CRFA 1WQVH 4K8BA 1EJAA 4Y79A 1DLKB 1TGBA 1GMCG 4XDEA 1V2LT 1DE7H 2ZDVH 3S69A 1JOUB 1LPGB 1DT2A 1KDQB 3LC5A 1UVOA 1SFIA 2PTNA 1OWEA 4RN6A 3U1JB 2A5AA 1P04A 1A3EH 3BG4C 1IAUA 3ELAH 2G4TA 3GCTG 1A7SA 3LKWA 5GJ4B 1O2VA 1O30A 4MPWA 1IQGA 1EP6A 1GI3A 2ZFPH 3RXVA 4A6LA 3AAUA 2OBQA 3A7WA 3BTME 3ZZ6A 3HPTB 2TGTA 4ZHLU 1UK2A 4RSPA 1Q2WA 3T29A 2HWLB 1G37A 5EXLA 2BD4A 2FLBH 5C5NA 3ZVAA 1NRNH 3M5OA 1JRTA 1UVPA 5C1XA 4KP0A 1UTLM 1YLDA 2AGIX 1WCZA 1CQQA 3BTGE 1LMWB 1TMBH 4RKOB 1BRUP 3RXSA 5FPSA 4MPUA 4I31A 1AFQC 1RJXB 1CSOE 1ZSKA 2ZCLP 2XYAA 1XUGA 2Z3CA 1HAIH 3TNTA 3RXLA 2A7CA 1HAOH 3QUMP 8GCHF 1KXAA 1Z71A 2H9EH 1Y5AT 5A0BA 3I78A 5F8TA 3A84A 3GY5A 1Z1JA 3PWBA 4YOGA 3UNSA 2UUFB 1D6RA 3S9AA 2NU1E 4OS1A 1UVUH 1T4VH 4ABGA 2UWPA 2NU2E 1QRWA 3URDA 2R0KA 4SGBE 1XVOA 1SBWA 1FJSA 1A46H 2ZDLA 2SNVA 1ZHPA 2Z9IA 3ATLA 1YP9A 1MMJN 3EYDA 5AHGH 4E05H 1TPOA 1C5VA 2HALA 2OBOA 1MQ5A 1T32A 4YZUA 2OC7A 1W8BH 4NWKA 3RXKA 1V2JT 4XOJA 3HGNA 1HNEE 3FANA 1KXCA 4CRAA 3AW0A 5A8YA 4DCDA 3MMGA 3SJ8A 2B8OH 1J8AA 1HJ9A 1ZJDA 2ODYB 1RTFB 4LK4A 4CRBA 1K1IA 3DD2H 1EJMA 1BBRE 1NM6A 2IPHA 3KL6A 2CN0H 4IBLH 1O5CB 3D62A 3PTNA 2EEKA 1L4DA 1ZJKA 3BEIB 8GCHG 5DPAA 2R3UA 1TNHA 5JDUB 3QGNB 3ZV8A 3EAJA 2JH0D 2SGAA 4WH8A 2ZQ2A 2BMGB 1V2MT 2FOGA 5LPRA 3A82A 4FUJA 1K1NA 4ZUHA 5L6NH 1TNIA 4YESB 4UONA 3ITIA 1AUTC 2XCNA 1P2JA 4UDWH 2GV6A 4Q80A 2ZGHA 3LIWA 1EOJA 3I77A 3P70B 1TX7A 5EQRA 1QFKH 2ZWLH 1C2FA 1O2KA 2EI6A 1EOLA 1SI5H 2A31A 1P02A 2B7DH 1G32B 1MTVA 2DUCA 2VIPA 4GLYA 1O3FA 3IITA 2BX4A 1J9CH 3LT3A 2QA9E 4HZHA 3SU2A 1RD3B 1TGNA 3BSQA 1C1OA 4JZEH 3NXPA 1ABIH 3RC5A 2ODPA 1BT7A 1QR3E 1C4U2 1C4V2 1C1QA 2BDGA 4YT7H 1O3KA 5EODA 5GCHF 2G52A 1SGIB 1EJNA 2UWLA 2B9LA 3H7OA 4K8YA 1H9IE 1MCVA 1P2OA 1EZXC 1P8VC 1ZLRA 3ZZ7A 5FHTA 3SI3H 4CHAB 1YYY1 1QBVH 1ZHMA 3F68H 2ZPQA 3UWJH 2IN2A 4TWYA 1O2LA 2V0BA 4AYYB 1TGSZ 1CA0B 1FN8A 5T6GA 2BTCE 1UMAH 4WXIA 3ZZCA 3E91A 4DOQA 4DIIH 4O9VA 2XBWA 1KXFA 1TPAE 3FZDA 1C5MD 1AY6H 1TA6A 2GV7A 2WUCA 1P10A 1C1MA 2VIOA 2BD8A 5FAHA 1SLWB 1P3EA 2C8YB 1BHXB 1BOQA 5L2ZH 2XBXA 1SL3A 2H5DA 3SUFA 3UUZA 4XE4A 1MZDA 4Y71A 3RXHA 3VFEA 4JYVH 1IQNA 5E0GA 2HNTC 1C5WB 2F9VA 1YC0A 3T62A 2JETB 1HCGA 1C1TA 1O33A 2PWXA 4IS5A 5E0JA 1PQAA 4Q7YA 1H1BA 5JBCS 1Z8GA 1GG6B 1FN6A 1V2NT 5HXFA 1GBIA 3VPKA 1SGEE 5FBEA 1AUJA 2G5NA 3MFJA 1J17T 1WSSH 3JZ1B 5GCHG 5LH8A 4HGCA 1T8LA 1TRMA 4NSYA 4WWYA 3RXBA 1NFWA 3M5LA 1GBEA 1UK4A 2BZAA 5PTPA 2FYRA 1C2EA 1PPZA 2Q1JA 1V2OT 1FI8A 1EAWA 2PW8H 4WMEA 1NRRH 1O2IA 3AASA 4GUXA 2ZFQH 1WV7H 4ISLA 4Y10E 1FAXA 2CGAA 1BTYA 2AMQA 2HPQH 3E90B 4IGDA 2ZP0H 3SJIA 3U9AH 5A8ZA 4CH2B 1GBMA 3M5NA 3TK9A 4WF8A 1KSNA 2ZGXH 1Z6JH 1O2YA 3OSYA 4MDSA 5EQSA 3SV7A 1SHHB 2B0FA 1QL8A 1ANDA 1DX5M 4ZXXH 2C93B 3LGVA 1QQ4A 4CHAC 3BEUA 3GDVA 4MPXA 2CF9H 1LHGH 1QCPA 3L6PA 4X1QU 3SJOA 3ZZ4A 4AB8A 1FZZA 4BAKB 1TNJA 1VITF 5GIBA 1CA0C 3KQCA 3NZIA 4ISHH 1OP0A 1MTWA 1MU6B 4YOIA 3RXRA 5I46H 1O5DH 3K6ZA 2RCEA 3LJJA 2FXRA 1YPHC 3ZYDA 3ATKA 1LHFH 3MO9A 4XSKU 2FI5E 5AFZH 3STIA 4NA7A 1HLTH 2AERH 2M5TA 3PM3A 1EB1H 2P16A 3RMOH 1EUFA 3SUDA 3RXCA 2JETC 3NKKA 3E16B 2OLGA 1LQDB 2GTBA 1IOEA 2VJ1A 1GG6C 1C2LA 5T6FA 3RXMA 3E3TA 4DJZB 2A4RA 2Y5GA 1PPBH 2ZDAH 4CBNA 3LOXA 3M7QA 1GDUA 2YNAA 1FY8E 4UFDH 4OS6A 3KF2A 2ZTXA 2QXHA 1P57B 1FPCH 1ZMLA 1E38B 2JH5D 2PLXA 2VH0A 1ETRH 1HDTH 4NA8A 1FY5A 4B2CA 1Y3YA 2EC9H 4K3JA 3S9BA 1WOFA 1VITG 4J2YB 1PPHE 3NPSA 3F1SB 5ESBA 3ESTA 1V3XA 4BANB 3BTHE 1H9HE 2ZECA 2AMPA 1JXPA 3QX5H 4DVAU 2BY7X 5GWZA 3S7HB 2GZ8A 2GMTC 3FVFB 1QQUA 1DWEH 1W11U 2A1DB 4UE7H 4X0WU 3VB7A 1UTPA 4F4OC 1B0EA 1FV9A 1HIAB 3A7ZA 1XVMA 5DP5A 3SV9A 1DITH 2VWMA 4KTSA 2Z7FE 1HXFH 1HAVB 1QB1A 1SLXB 2VNTA 5DP4A 1ESAA 1WTHD 3A8BA 1QA7A 1SC8U 1S82A 3SQHE 7ESTE 4U2WA 1LTOA 1MTUA 1DY8A 1BRCE 3LGYA 3T27A 3SORA 4FUIA 3RMLH 2WV4A 3RM2H 3MH4A 4MQAA 4AGJA 2BLOA 3EGKH 3MNCA 1OWDA 2WPJS 1BB0B 1P2NA 3QK1A 1Z8JB 2BHGA 2TPIZ 2P93A 3M37A 1GI7B 2XC0A 2A7HA 1MBMA 2ZZUH 1P9UA 1VITH 2F83A 3V3MA 4X8SH 3FAOA 1AQ7A 3A8CA 1TBQH 2FO9A 2GKVE 5SGAE 2PSXA 1OYTH 4INHA 2BXUH 1AU8A 1NU7B 1P12E 2ANWA 1EX3A 5C3NA 2A5KA 3RXUA 1SLUB 1TPSA 3SU5A 3RLYH 2P94A 1NESE 1GJ6A 5CMXH 3LDXH 5HYOA 3CP7A 4E7NA 9ESTA 2F9NA 3H7TA 6LPRA 4IW4E 1UHBB 4ISOA 5A8XA 4I33A 1QJ7B 4JZFH 1OYQA 1IHSH 2P3UB 1OWKA 4AYVB 1HXEH 2BDCA 4LXBH 3RXAA 1DANH 2VB0A 3SNDA 1ORFA 1C1WH 1K21H 3RXTA 2CF8H 1JWTA 1BBRK 4BXSA 3SGQE 3T25A 1NRSH 2J4IA 1KYNA 4PROA 1Z6EA 5GDSH 1C5RA 1V2QT 2Z9LA 3MOCA 3RXFA 1ZPBA 2XWBI 5FCKA 2QV1A 1SHYA 1O5EH 3FP6E 2PGBB 1CT0E 1HV7A 4OS5A 5DKMA 3V13A 1IHTH 1TQ0B 3FP7E 4UFEH 2GCHF 3UQOA 4X6NA 1VJAU 2HNTF 1CGIE 4D7FA 1ZTLA 3P8OA 1RRKA 3MO6A 2ZTYA 1C4Y2 4FUFA 2R3YA 2ZFTA 1GBKA 1Z8IB 1SGNE 1W12U 3A89A 2PUQH 1YLCA 1OX1A 4IC5A 2BQWB 1AFQB 2W5EA 2PKAB 1MD7A 1TRNA 3ATWA 2FYQA 3VXFH 2C8ZB 1A4WH 1TABE 3PV4A 3OU0A 5A0CA 2CXVA 2ANYA 4Y7BA 4FUEA 2G4UA 1HJAB 1GHWH 3HK6B 3SU6A 4AX9H 2AIPA 2ZDMA 1HUTH 2A2XH 5C1UA 1QY6A 2WPMS 1O0DH 1EB2A 1YGCH 2YNBA 3F9EA 3C1KA 5J4SA 1A0JA 1UHBA 2ZU1A 2FOAA 2XBVA 3Q77A 4Y8ZA 3HGPA 3BF6H 3PB1E 3TPIZ 1L1NA 1W7GH 2A2QH 1A0HB 4K1SA 3T2NA 4FVDA 3SU4A 2OTVA 4JK6A 4AG2A 2H5CA 1LPKB 4X6MA 1F0RA 2AIQA 2A4QA 3U8TH 4I7YH 4NA9H 3SBKA 2PSYA 1QGFA 1WU1A 1T7CA 3MO3A 2ODQA 1UCYK 3PMBB 1OWHA 5JB9S 3SU1A 2F9BH 5AF9H 3GDSA 3T5FH 1LO6A 1RGQA 2ZHQH 2Z3EA 3SV6A 1HAYB 2AEIH 1SQTA 2OINA 2G8TA 1PFXC 3CS0A 4WXVA 4A1XA 2GGVB 3RXOA 2NWNA 1LQEA 2STAE 4JMYA 1WBGB 4YLUA 4XBDA 3DUXH 3HATH 1LHDH 3S0NA 5DP6A 2H9TH 4Q2KA 1SOZA 3GOVB 4ZKSU 3D23A 1P03A 3HKJB 3NCLA 2F91A 3KQEA 3PWCA 4GHTA 4D76A 5FCRA 2ULLA 3A8DA 4A92A 2VVCA 4NFFA 3RLWH 1PQ8A 2FOMB 1T4UH 1FY3A 1MKXK 1ELVA 2WPKS 2OC1A 7GCHF 1GBJA 2B5TB 4JZ1A 1OPHB 3OY6U 3RXPA 1L1GA 3ZVEA 2ZNKH 3F9HA 1AIXH 1O3PB 1EATA 2PKAA 4AN7A 1PJPA 4B2AA 1Y3UA 4Y8YA 3SJ9A 1XXFA 2STBE 1MKWK 1Z1IA 3GDUA 1O2UA 2C90B 1GI5A 4BAHB 2ANKH 1GHZA 1EAUA 1C2JA 2QXIA 4GVUA 2ZCKP 3OYPA 4BAMB 1HJAC 1AWHB 5DP3A 3RXQA 4AOQA 5EGMA 2ZTZA 3H5CB 1G3CA 2D8WA 1ZYOA 2P3TB 4X2YA 3BTKE 1ELBA 3A7TA 4I8LA 2F9PA 1NFXA 4KGAA 8LPRA 2BQ7B 1UTQA 1KDQA 2BVSH 1QB9A 5H4IB 3PROA 1NT1A 2PTCE 5IYTA 3UOPA 8ESTE 4BAOB 4IN1A 1TA2A 1U6QA 3EDXB 3P8FA 2UUYA 1WUNH 4GCHF 3MH5A 1TNLA 1HAPH 3EA7A 4KTCA 1ZPCA
chains in the Genus database with same CATH superfamily
3DFLA 1GJ8B 5F8ZA 1QBOA 5B6LA 1ANCA 2FI3E 5EYAF 1RIWB 1ZTKA 1C2GA 3LGUA 2XTTB 3SUEA 2DJAA 1ESBA 3D65E 1P01A 3GY8A 4ABIA 1BORA 1BMLA 4AC9A 3U8OH 3LGWA 3KQBA 3MNBA 3TH3H 2EY4C 1EZUC 1ZZZA 2JKHA 2G81E 2KCOA 1NPMA 1GVZA 2VGCB 2JH6D 3GY2A 5E0HA 5B8DA 5AIUA 1AE5A 1XXDA 1W2KH 1FLEE 4IN2A 2KE1A 3N7DA 4L7XA 4MLFB 2G5VA 5HM9A 1AKSB 1W0YH 1EKBB 2PNXA 4R7EA 2MD8C 1AVGH 1UVTH 2AS9A 4BXWA 5DGJA 1IQKA 1E35B 1O2WA 5FL7D 1K1MA 4A7IB 1SSXA 3O8CA 2BVRH 3A88A 1QNJA 4HI3A 1CGJE 2MA5A 2O9QA 1X4UA 4E7RG 1TLDA 2HGTH 3KYFA 1TNKA 1O2ZA 2KWJA 2QF3A 1NFYA 2V6NA 5JG6A 2K17A 4A1VA 2HLDD 3UY9A 2RDLA 3ZVBA 2BLQA 2WV9A 4KKDA 3PRDA 3ATIA 4GCHG 3SGAE 2RI7A 3M63A 1D4PB 1ELGA 4UD9H 3RPGB 3RDZA 4O3UA 2W3KA 1HAGE 2BVXH 2Y5FA 4ZCNA 3L33A 1AMHA 1VJ9U 1K2FA 3QO6A 3RU4E 1MUEB 2Y81A 2QC2A 3C6WA 1TGCA 2WYGA 4Q63A 1HAZB 3SJKA 5DP9A 2M13A 3KV6A 1BMFD 2KGIA 4FIPA 3GYLB 1B7XB 1GI9B 2ZCHP 1O2RA 3MU5A 5CHBA 1YPLH 2VPBA 2O8WA 1XUKA 3AW1A 1O2XA 3SQEE 1DXWA 1WEVA 3BTWE 4A1TA 4JZIA 1A2CH 1D6WA 1V2RT 4X1SU 3SI4H 3ZV9A 2ZHFH 1NO9H 2ZG0H 1UO6A 2GVFA 4ZKRU 1AO5A 2PKSB 1YCPH 2IPQX 3U1IB 1W10U 2H0DA 2QF0A 1GI4A 1KLJH 3UNRA 1RIWC 1XMNB 1DWBH 2V3OH 2VVVA 1F92A 1GHXH 3VK6A 3MNSA 1Y59T 1HBTH 1K1PA 2JDID 2QXJA 2Y82A 1P11E 1C5QA 3RU4D 3SYJA 2Y6TA 5JBTA 2Q6FA 3P17H 2BQ6B 3LH1A 2OQ5A 1K1LA 2Z9GA 2VGCC 3SGBE 1E34B 3B8JA 2BLWA 2BDHA 4JYTA 1O2TA 2JIZD 2C2VS 4UFGH 3MU0A 2XC5A 1GJ4H 4I8GA 1PYTC 2RA0A 4H6SB 2RSDA 4NSVA 1CA8B 1BMAA 3P6ZB 4DURA 3FP8E 5ETXA 2XW9A 4ABHA 2VJEB 3N9QA 1X4IA 2J5UA 1FY4A 4JZDH 1WAYB 4X2VA 1TWXB 2TBSA 1Y5UT 4AFUA 3TGJE 1W7XH 3PHDA 1S0RA 2TGDA 4A49A 1DY9A 1QHRB 2BY6X 2ZHWH 4K60A 1U6GB 2O8TA 3N9PA 2GT8A 2J38A 1C5YB 1RTKA 1GI1A 4MSXA 3O7AA 1JIMA 1TX6A 1O34A 3MH6A 1C2DA 1LVMA 1V2PT 4I8JA 2ILNA 4MNXA 2H9HA 5JYIA 3RPGC 1YPEH 2CHAB 1WEUA 3DT0H 3SU3A 2IJOB 1JMOH 4TKPB 2AGGX 1A5IA 3A86A 3VG8A 1BTHH 1CHOF 1P2IA 4R0IA 1NY22 3L3TA 1C1SA 2XC4A 3BTTE 4ZAEA 1O3IA 3O8DA 3GICB 3QGJA 2BD5A 2JRJA 1GL0E 3O8RA 1LVOA 2LPRA 2VWOA 5G04B 1NC6A 6GCHF 1IQIA 1C9PA 2VH6A 3FZZA 3P92A 1SLVB 1O3OA 3M3VA 4I7CA 4BNRA 2FESH 3GY3A 3RXIA 2KCPA 1DXPA 1K0HA 2GMTB 1DVAH 2XWAA 2PKSC 3A80A 2L80A 1SQAA 2F43B 1WIMA 1GJDB 4NCYA 2EQNA 1MTNB 2FOBA 1C1UH 1ELCA 1GHVH 2CMYA 5L30H 5DINA 1E4UA 2VINA 4B73A 2FDAA 3FN8A 2ECTA 1T31A 1ARBA 2P3FH 4YTAA 1WESA 2GZ9A 3M3SA 4FXGH 1C5TA 4VGCB 2BDIA 1E1QD 3PMHB 1O35A 2ZGBH 4IC6A 5DO4H 3GY7A 4CREA 4DIHH 2PGQB 4DG4A 1BJVA 4X8UH 4X2WA 1GPZA 1CBWB 1K2I1 1O5AB 3F9FA 1O2JA 3U69H 1O2QA 4YBTA 2NU4E 2Z9JA 3ZZ9A 1YBWA 1C5OH 3A83A 1N87A 3RUOA 1DDJA 1SFQB 4NIXA 3UR9A 3M61U 1TBRH 2IJD1 2CKLB 2UUKB 5DN6D 5A09A 1GVLA 1ZGVA 1TOMH 2VWLA 4RT1A 5DP8A 4B2BA 1S84A 1DVPA 2KM0A 1L4ZA 1EAXA 2BOKA 2BDBA 4ABJA 3LGTA 3W94A 1BQYA 2VIWA 4FUBA 4H4FA 1O2PA 4HFPB 1GJ9B 5HM2A 6GCHG 3RMNH 2HVYB 2ZC9H 4ASUD 2L5UA 1G3DA 5E2PA 5CE1A 4MPVA 6ESTA 2PV9B 2VIQA 3IWMA 3CS7A 2F9OA 3F2HA 1SQOA 4NWLA 3QZQA 2CHAC 5FPTA 2FS8A 1SGDE 1Y3VA 4BTTB 1SGTA 2RFKC 2LP6A 4I8KA 3K65B 3P8GA 4D9QA 4K5ZA 2FD4A 2YOLA 5LPFA 1TAWA 2ANMH 1SGFA 4Q4LA 1O3BA 1AGJA 2MNZA 4O62A 4R8PK 1BTWA 1T8MA 4ISNA 1WXRA 1F5RA 1V87A 1ANEA 2WPHS 5DJ7A 1GBTA 4OGEA 4AYCA 3E8LA 2R2MB 3A87A 3RXEA 4Y6DA 2LGVA 2W3IA 1NRQH 1BCUH 1Q31A 5EPYA 1OSSA 3BEFB 1LVYA 1VKYA 1H4WA 3JZ2B 1O2MA 3ZZ3A 1QA0A 2G45A 4LK9A 4CCGX 4U01A 2WV5A 1F0SA 2FM2A 4FOUC 1HYIA 1MTNC 5AVDA 1K28D 1INCA 1UTNA 3KHVA 5HMAA 1P05A 1S6HA 5C1YA 1W0KD 1QTFA 4DT4A 5B76A 3GCOA 4UFFH 2L0BA 3ZZ8A 2W6JD 1NS3A 5LPEA 2FP7B 4VGCC 2RDEA 1KXBA 3MU8A 3TJNA 2E6RA 3KV5A 3UFAA 3UTUH 4QF2A 3AVZA 4UP5A 1HYJA 4YABA 1WQSA 5HIZA 2J94A 2FTLE 1C5PA 3MHWU 2L75A 4F1PA 1MH0A 1CBWC 1C5NH 3PLBA 2ECNA 1EP5A 1QURH 2CJIA 3E6PH 1DWDH 1AVXA 4OGXA 5TCCA 2YSMA 4X2XA 2AYWA 4B75A 2H1UA 5DP7A 3UR6A 3QZRA 1FY1A 4WVPE 2Y80A 3L1XA 5FBIA 3U5OA 1B5GH 3LGIA 3DA9B 2ZPSA 3EQ0H 1IQEA 4OS7A 2BY8X 1D3TB 2ZU4A 2HRVA 4IMQA 2BOHB 1SGRE 2FEQH 5H1TA 1DUEA 1FIWA 2YHNA 1EASA 1UTMA 2TGPZ 3AK5A 2FODA 3M7TA 3T28A 4FJCA 5D1LB 5KH7A 2A32A 3B9FH 3UREA 1C1NA 2YYRA 1V2KT 3TH2H 1FNIA 4Q7ZA 3RTRB 3MTYA 1UJ1A 2LN0A 1Z7KA 1J16A 1ETSH 1SR5C 1OP2A 3RXDA 3O70A 2XXLA 1HFDA 1DUAA 5DG6A 1HRTH 2VVUA 2OP9A 1ZR0A 4N4FA 4ZQLA 4BAQB 4MVTA 2G00A 1IQJA 2QCYA 3VEQB 4YO9A 3PTBA 2F3CE 5AFYH 5EJZA 3A85A 1GJ7B 3GYMA 1GI6A 4LKAA 3U5MA 1WEQA 1DOJA 1PPCE 5J4QA 5TJXA 4INKA 1AFEH 1TBZH 4FETA 3UAIC 2RG3A 2V35A 3F9GA 3ZVFA 1KTTB 2YU4A 1GBFA 2KFTA 1HIAA 2GZ7A 3SNCA 1GI8B 1P2KA 1L0ZA 4ZHMU 4O03A 2XNDD 1SGPE 1HAVA 2C4FH 3TJUA 2FX6A 1EXFA 3ZTGA 4H6TA 1DM4B 3TLOA 3V7TA 3TU7H 1TMUH 4WMDA 2OUAA 5DK1A 2OXQC 2VJFB 3FFGA 2VIDA 4NFEA 3UWIA 1O38A 5JBBS 4XRNA 3CENA 1O31A 2J92A 1SGQE 1GHYH 1ID5H 1GJ5H 3SNAA 1O32A 1DS2E 3N9MA 1NBME 3M36A 1FXYA 1NN6A 2BD9A 4TY7A 4B76A 2MA6A 2MD7B 2A4GA 1BA8B 3C5KA 4CR9A 4X6OA 1LHEH 4ZH8A 3EA9A 5AITA 3PO1B 1GJAB 5HGGA 1GHBF 1FQ3A 2KX4A 2ZGJA 1M9UA 3R0FA 3TVJB 5KH9A 5F8XA 4LLBA 1YPGH 1JIRA 3BIUH 1QB6A 3SN8A 4CH8B 1VCWA 1GWAA 1O39A 2Y5HA 3VXEH 2KU3A 3VB4A 1O3GA 1JM7B 2P8OB 2Z94A 4LOYH 1C5ZB 2AFQB 3GCHB 2SNWA 3LH3A 2LGLA 1PQ7A 2VP7A 1O3DA 2ZQ1A 1GI2A 3FO8D 4RI0A 3GL6A 1AD8H 3Q3KA 1CHGA 1LVBA 2BB4A 4FVBA 1FONA 5K3QA 4F52B 2ALVA 1F5KU 3O8BA 3GY6A 3T7LA 5EOKA 1HAXB 1DSUA 3LJOA 4MTBA 1C1RA 1C5SA 2OC8A 1YPHE 1TGTA 3NG2A 3OTPA 1V2WT 2E6SA 1F7ZA 2THFB 9LPRA 1X7AC 4SGAE 1WEWA 1LHCH 1TYNA 1O2GH 1N8OB 1COWD 1IQFA 5F03A 1GHAF 1MZAA 1C2HA 2AMDA 4H9DA 3EA8A 1F5LA 2GCHG 4X6PA 3O35A 1W14U 4ABAA 3RU4T 2OC0A 1KY9A 3MU1A 2L43A 1QJ1B 1MD8A 2J97A 1GHBG 2PHBA 4OM9A 4KTUA 3MHHA 1O2HA 4YM9A 2P57A 1BITA 3SUBA 4CRDA 4WY3A 1O36A 2FMJA 1S81A 1BHXF 1XUIA 1L2EA 1S83A 1CT2E 2FIRH 1TIOA 3RMMH 4Z0KA 1FBVA 1DWCH 1E36B 2EA3A 1RFNA 2D26C 1HYLA 2ESTE 4U32A 4FUGA 4J1YA 2AGEX 3ODDA 1BTZA 2CRWA 4S3OB 1QL9A 1G3EA 1GI0A 1VCPA 4TPYA 4GB0A 1IQHA 3PO1C 3U8RH 4TYDA 2V3HH 3ZZDA 1A5HA 4N3WA 3N9OA 3OE7D 4CRGA 1JBUH 5SVIB 3URCA 1Y5BT 1NZQH 1BMMH 1DFPA 1AVWA 1T8OA 3LC3A 3PRBA 2F42A 3SHAH 1JM7A 5H1VA 1J15A 1D3PB 1BUIA 1XM1A 3I29A 3ZNIA 2ECVA 3C27B 4DT7B 4YOJA 3E0PB 2YMSD 2P8OC 1GHAG 4IMZA 3DDTA 4JYUH 3GCHC 3TK5A 2BD2A 1FIZA 3T9KA 1Y3XA 4NGAH 4TY6A 4Q7XA 2KKYA 5LGOA 1SG8B 2ZHEH 1ZPZA 1MM2A 5EPNA 2AH4X 1K1OA 2BAYA 1TONA 1TALA 5EW2H 1VYXA 1UTJA 1ELFA 2LNCA 1K22H 4R8TB 3OTJE 3IG6B 4L58A 3Q3XA 3KN2A 1EQ9A 4AFZA 1BRAA 1W3CA 3EE0B 1GMDF 2DSMA 3SUGA 1SGYE 1NTPA 2ZFRH 2FWWA 1ELEE 1K9OE 4OS4A 5FEYA 2EA6A 5C67A 4NIWA 1LKBA 1N8OC 2OCVB 4JCNA 2ZFFH 1ZTJA 5CDFE 1MM3A 2SGEE 3QTVH 4F49A 5TDRA 2EI8A 4X1PU 3GY4A 3UNQA 4YADA 4WH6A 4MNVA 1O3CA 7GCHG 3UQVA 3W95A 1WTGH 1BRBE 2BX3A 1XKAC 1BTUA 1NRPH 2VWNA 3OEED 1YF4A 2A0QB 4Z1MD 2WPLS 3PLPA 1V2VT 1BTPA 1GBAA 3TJOA 2ALPA 1GCDA 3VB6A 5TABA 5K7RA 3FKSD 1A1RA 4GPGA 5T3HA 3O33A 1OWIA 2ECJA 1QRXA 1KXDA 4D9RA 3ZPV1 2PP6A 2QAAA 3PMJA 4B1TA 2K1QA 1O3JA 2VU8E 2Z6BD 3HCSA 1S6FA 1PQ5A 4AZ2B 3HCTA 5H9MA 1OS8A 2WPIS 4S3OC 3O34A 2G6QA 4FU7A 1O3LA 1BTXA 3PLKA 1CT4E 4ABDA 1Z8RA 2YHOA 1D9IA 3KGPA 2R9PA 1ZHRA 2KWOA 1TOCB 1BZXE 1A3BH 1V2ST 1Y3WA 2CK3D 1SGFG 1O2SA 2ZI2H 1GMDG 3KQDA 1A5GH 4X8TH 3SW2B 3PUQA 3ATMA 4QQ4A 3T26A 3ZZBA 2NU3E 3STJA 3NWUA 4KELA 3MYWA 1QZ8A 4OS2A 2R0LA 2FOEA 1O3HA 2KIZA 2P59A 2HDPA 2H2ZA 4Z0OA 3ZZAA 1THPB 3RC6A 5JPMH 1FUJA 1O37A 1ZMJA 2WPDD 4O97A 4M7GA 1O5BB 4ZDTA 3SOSA 1P2MA 1N6XA 2J98A 3MI4A 3LRQA 2BD7A 3Q1DA 3QN7A 2NAAA 1OWJA 2YUCA 3PYHA 1BJUA 1O2NA 1SOTA 2G55A 2OXSA 1OXGA 2A4OA 2ZFSA 3SV2H 3SU0A 2CSYA 3ZPVE 1V2TT 2FOHA 1NFUA 3DHKH 1ESTA 1VZQH 1WENA 1GL1A 2A45B 5E2OA 5FX5A 1AN1E 1NU9A 2TGAA 1QJ6B 4NZLA 1EZQA 4FO9A 7LPRA 4X8VH 2D8SA 5B6OA 4NG9H 6CHAB 4ZXYH 3MNXA 1G9IE 2FPZA 3M7UA 2FLRH 5EQQA 2JUNA 2ZU2A 5A0AE 1ZRBA 1GCTB 1SVPA 1ZRKA 5CHAB 2GDEH 3RP2A 2ZDKA 2WUBA 1S6LA 3B23B 1V2UT 1UCYE 1YPKH 1AKSA 3WW7A 1HGTH 1TFXA 2GCTB 2TIOA 2P95A 4YBMA 2ZF0H 3M5MA 5I25A 1MQ6A 2CONA 4DW2U 3MU4A 2C8WB 2VIVA 1GVKB 2GP9B 4Y0ZE 1E37B 1C9TA 1FDPA 1XKBC 4AFQA 5EW1H 2I6QA 2SGPE 3V43A 2KZ4A 3LU9B 2SFAA 1C1PA 1S5SA 4XBCA 2QIQA 3KCGH 2BY9X 3NRLA 1O3MA 2BLVA 3PMAB 4A5TS 2LQ6A 1YCPM 4IC2A 2XCFA 1EAIA 1P2QA 2J9NA 5DKAA 1O3NA 3PLWA 1YM0A 2RA3A 1AWFH 2J2UA 1CU1A 2G51A 2BYAX 5I3LA 1RXPA 5LCWB 2UUJB 1K1JA 3WY8A 4THNH 4ESTE 2J95A 5G4BA 3BTEE 4WJG2 3TK6A 1WFKA 3SV8A 3LQIA 5FERA 1THRH 3EE7A 5GPIB 1W13U 1QIXB 3M3TA 2KGGA 1ETTH 1HB0B 2D2DA 1D3DB 3OEHD 2O8LA 4ZROA 1XUHA 2A7JA 1GBBA 1O3AA 1RS0A 3S7KB 1PPEE 4ABEA 3NUMA 5T6DA 4XI1A 3MDBC 2YMSB 3KNXA 3BN9A 5C2ZA 2ZIQH 3A8AA 2EI7A 1SMFE 3ZZ5A 2XEUA 2I6SA 1S85A 3QWCH 1G30B 3LDYA 4H42U 2PFEA 3BG8A 4E06H 1UVSH 1KXEA 4ISIH 3DFJA 5EJLA 1ZSJA 3TGKE 1ACBE 3Q76A 5EG4A 3SNEA 6CHAC 4D8NA 7KMEH 2LXHC 2QGRA 4YXWD 2Y1MA 1QBNA 3KEEA 2C3SA 1GCTC 1BBRH 2C8XB 4YBSA 5CHAC 1C5UA 2QN5T 2PUYA 3R3GB 3OY5U 2NU0E 3U98H 2GD4B 2W7UA 2LAUA 2ZHDA 1N6YA 4GNEA 4Y7AA 4GNGA 2XB1A 2M1RA 4ZHAA 3K2UA 2BM2A 5IDKA 4INLA 2GCTC 4P00A 3QTOH 1C5LH 5JBAS 1O2OA 1GBLA 3G01A 1H8DH 3RM0H 5C20A 2ZPRA 3D49H 1EPTB 1OP8A 1ANBA 1DSTA 2ASUB 3BTFE 4FU9A 4ZKOU 5BRRE 2KKXA 2LDRA 2VJEA 5LKXA 5C0TA 1TNGA 3BV9B 4B74A 3F2FA 1O3EA 1BIOA 1LDTT 4K69A 4R2YA 1XUFA 1YKTA 1CHOG 3P8NA 4U30A 2GX4A 3ZYQA 4AG1A 4YC9A 1G3BA 3ZVZB 2FOCA 3SHCH 1A0LA 1UTKA 2ZETC 2VPEA 2F9UA 4BOHA 4BTUB 1VGCB 4I8HA 1TQ7B 2GDDA 3V0XA 5L2YH 4NIVA 4X1RU 2PR3A 4ASHA 2KR7A 4B71A 4WZ3B 3VB3A 4K1TA 2F6NA 1E1RD 5BPEA 5A2MH 4XFQA 4FUDA 1THSH 1MU8B 2BDAA 1J14A 2EODA 4V3KC 3LPRA 2ZU3A 1DICA 1ELTA 1DLEA 1GGDB 2SGFE 2ZO3H 2Y43A 1GBCA 1VCQA 1F0TA 3E0NB 1W0ZU 1XX9A 2Y7ZA 1QRZA 4HTCH 3SNBA 1G2LA 3ZVCA 1AE8H 4OGYA 1H8IH 1PPFE 1YPMH 1VFYA 1FAKH 3SOWA 3TJVA 4CBOA 3DSOA 1BDAA 3UOUA 3ENSB 1LKAA 2YMSC 4I86A 1KLTA 2Q6GA 1YPJH 1TX8A 1C2KA 3UPEA 3KQIA 3SOXA 1QL7A 2DE9A 1CVWH 3N99A 4AORA 5GXPA 4DGJA 1G2MA 1P09A 4Y11E 2ZEBA 1ZSLA 4TWWA 3UIRA 4A4CA 1GBHA 1B0FA 3LVRE 1UCYH 1KLIH 2FX4A 3A7VA 3LJUX 2K8IA 2KFWA 2MIQA 1EFRD 1AB9B 4Z6AH 3NK8A 4ZKNU 2XBYA 1G36A 1XUJA 5B79A 3LONA 1IQMA 4O3TA 1GJCB 4DY7B 2BY5X 1JRSA 2GT7A 4Y76A 4UEHH 3A81A 2XRCA 1YCPK 2OD3B 3F6UH 3KIDU 3QLPH 1HAHH 2HLCA 1YY3A 1EPTA 3MH7A 3BTDE 1ELAA 5FPYA 1RTLA 2Y7XA 2TRMA 5C13A 4AUQB 3TGIE 3P95A 4A0CD 4B6EA 5TCAA 2YQLA 1EPTC 1EZSC 3HK3B 3ODFA 4QT8C 4NZQA 1N1LA 2CKLA 4I32A 1Z6UA 2WINI 4YAXA 1TRYA 2QE7D 1MKXH 2LGGA 3U5NA 2G43A 3VGCB 2ZU5A 2QYIA 4MNYA 2DE8A 2ZKSA 1IYMA 1LDKC 2ZDNA 3SZNA 1GDQA 1AZ8A 4AB9A 1VGCC 1T8NA 4GNFA 4YLQH 4BHWA 5K0HA 2V3MA 5E8EH 1F0UA 3TIUA 2FI4E 1MKWH 1WYKA 2A5IA 4MNWA 4LZ4B 1TB6H 1TPPA 4MVNA 3TH4H 1ELDE 1FMGA 2BD3A 3O36A 1UTOA 4ABBA 1A61H 2Z9KA 5EXNA 1GMHF 3PURA 2K1JA 2PUXB 3QDZB 1GGDC 1MABB 1Q3XA 2FZZA 4AFSA 2FS9A 1PPGE 4GSOA 1P9SA 3FJUB 3VB5A 1ARCA 3BTQE 4D7GA 2ZA5A 4K2YA 3Q3YA 2BXTH 2JJ2D 1C2IA 2OK5A 2BZ6H 2CSVA 5DSFA 4YT6H 5FXLA 3E1XB 4TPIZ 3ZVGA 4MG3A 2KAIB 3F2GA 8KME2 2QF4A 3N7OA 1GDNA 1P0SH 1ZGIA 2BDYA 4FU8A 3A7XA 5EJ1A 2H6MA 1L1JA 3M35A 1KIGH 1UK3A 2Z3DA 2OQUA 5EXMA 2HNTE 1KTSB 2D1JA 4JK5A 2WYJA 1IQLA 1HPGA 4GAWA 1AB9C 2UWOA 4FUHA 4FUCA 1AHTH 1DPOA 3Q00A 4Y8XA 3S9CA 4GHQA 1FPHH 1SB1H 1E0FD 3AAVA 3GISB 5KGOA 4NIYA 1SPJA 1DCQA 1OOKB 2R2WU 1C1VH 1MAYA 3LQHA 1ZOMA 2CRRA 2FTMA 3DQVR 3GCNA 5JB8S 1MAXA 2QIZA 1O5GH 2M6MA 1T1HA 3BG4B 1GJBB 2O8MA 2QY0B 5IK2D 1OKXA 1ABJH 4XBBA 5ABWA 3RC4A 1TMTH 5KECA 3RXGA 1GMHG 2W26A 1GMCF 2HOBA 3K6YA 3ZVDA 2Q6DA 1PYTD 1Y8TA 5C5OA 4WZ2A 2EXUA 5ESTE 1VR1H 3VGCC 1F2SE 4ABFA 2MUMA 1LCYA 1P06A 3LVQE 1H9LB 5F6MA 4WMFA 1HJ8A 3RXJA 1CE5A 2ZGCA 3KNVA 1C2MA 2QXGA 2SGDE 2IOTA 2HPPH 2J34A 3MWIU 5C94A 4A4BA 3ZYEA 1D3QB 4ZMAH 3GCTF 1H8ED 4AGKA 2D8UA 1SGCA 4C9ZA 3SO3A 3TNSA 1AZZA 4LZ1H 2XNIA 1NROH 1MBQA 2SGQE 3TITA 3DPLR 3F0OA 2CV3A 1GBDA 2M2AA 5FX6A 4F55A 2O8UA 2W7SA 1LPZB 1CO7E 2FUUA 2YW8A 4K1EA 1S0QA 2VPDA 4RKJB 1O5FH 1ZMNA 2KAIA 3A7YA 4CRCA 3OX7U 2YURA 4X1NU 1MTSA 4CR5A 4V3LC 1P3CA 3K9XB 1BMNH 1AI8H 1F62A 1TE0A 3V12A 3H7HA 1V6DA 2HVXA 3BIVH 4Y0YE 1CGHA 1MCTA 5EU8A 2FOFA 2LELA 1C5XB 3HKIB 4BTIB 4CRFA 1WQVH 4K8BA 1EJAA 4Y79A 1DLKB 1TGBA 1CHCA 1GMCG 2VJFA 4XDEA 1V2LT 3F0PA 1DE7H 2ZDVH 3S69A 1JOUB 1LPGB 1DT2A 1KDQB 3LC5A 1UVOA 1SFIA 2PTNA 1OWEA 4RN6A 3U1JB 2A5AA 1P04A 1A3EH 3BG4C 1IAUA 3ELAH 3O37A 2G4TA 3GCTG 1A7SA 3LKWA 2VPGA 5GJ4B 1O2VA 1O30A 4GNDA 4MPWA 1IQGA 1EP6A 1GI3A 2ZFPH 3RXVA 4A6LA 3AAUA 2OBQA 3A7WA 3BTME 3ZZ6A 3HPTB 2TGTA 4ZHLU 2XOCA 1UK2A 4RSPA 2LRIC 1Q2WA 3T29A 2LGKA 2HWLB 1G37A 5EXLA 2BD4A 2FLBH 5C5NA 3ZVAA 1NRNH 2HYED 3M5OA 1JRTA 1UVPA 5C1XA 2QJ0A 4KP0A 5LKTA 1UTLM 1YLDA 2AGIX 1WCZA 2VBCA 4OGCA 3DSGA 1CQQA 5C17A 3BTGE 1WDIA 1LMWB 1TMBH 4RKOB 1WILA 1BRUP 2E61A 3RXSA 5FPSA 4MPUA 5KEDA 4I31A 1AFQC 1RJXB 1CSOE 1ZSKA 2ZCLP 2XYAA 3WWBA 1XUGA 2Z3CA 1HAIH 3TNTA 3RXLA 2A7CA 1HAOH 3QUMP 8GCHF 1KXAA 1WEEA 1Z71A 2H9EH 1Y5AT 2KWKA 5A0BA 3I78A 2YQMA 5F8TA 3A84A 2F4LA 3GY5A 1Z1JA 3PWBA 4YOGA 3UNSA 2UUFB 1D6RA 3S9AA 2NU1E 3CNRA 5C0UA 4OS1A 1UVUH 5G0FA 1T4VH 3FEHA 4ABGA 2C2LA 2UWPA 2NU2E 1QRWA 3URDA 2R0KA 3IHPA 4SGBE 1XVOA 1SBWA 5EIYA 1FJSA 1A46H 2ZDLA 4TT3D 2V7QD 2SNVA 1ZHPA 2Z9IA 3ATLA 1YP9A 1MMJN 3EYDA 5AHGH 5D1MB 4E05H 1TPOA 1C5VA 2HALA 2OBOA 1MQ5A 1T32A 4YZUA 2OC7A 1W8BH 4NWKA 3RXKA 1V2JT 4XOJA 4IC3A 3HGNA 1HNEE 3FANA 1KXCA 4CRAA 4PPEA 3AW0A 5A8YA 2RR4A 4DCDA 4QF3A 3MMGA 3SJ8A 2B8OH 3KYGA 1J8AA 1HJ9A 1ZJDA 2H0DB 2YREA 1RTFB 2ODYB 4LK4A 4CRBA 1K1IA 3DD2H 1WE9A 1EJMA 1BBRE 3JUEA 1NM6A 5FB1A 2IPHA 5TBNA 2CSZA 3KL6A 5SVIA 2CN0H 4IBLH 1O5CB 3D62A 4WZ0A 3PTNA 2EEKA 1L4DA 1ZJKA 3BEIB 8GCHG 5DPAA 2R3UA 1TNHA 5JDUB 3QGNB 3ZV8A 3EAJA 2JH0D 2SGAA 1H8HD 4WH8A 2LV9A 2ZQ2A 2BMGB 1V2MT 4BBQA 2FOGA 5LPRA 3A82A 4FUJA 1K1NA 4ZUHA 5L6NH 1TNIA 4NN2A 4YESB 4UONA 4UI9B 3ITIA 1WEMA 1AUTC 2XCNA 1P2JA 4UDWH 3M99A 2CT2A 2GV6A 4Q80A 3DCLA 2ZGHA 2K16A 4I7DA 3LIWA 2WHXA 1EOJA 3I77A 3P70B 1TX7A 3MQKC 5EQRA 1QFKH 2ZWLH 1C2FA 1O2KA 3ZVYA 2EI6A 3WWFA 1EOLA 1SI5H 2A31A 1P02A 2B7DH 1G32B 1MTVA 3PV5A 2DUCA 3FOAA 2AHME 2VIPA 4GLYA 1O3FA 3IITA 2BX4A 1J9CH 3LT3A 2QA9E 4HZHA 3SU2A 1RD3B 3N9LA 1TGNA 3BSQA 5TDWA 1C1OA 4JZEH 3NXPA 1ABIH 3RC5A 2ODPA 1BT7A 1QR3E 1C4U2 1X4JA 1C4V2 1C1QA 2BDGA 4YT7H 1O3KA 5EODA 5GCHF 2G52A 1SGIB 1EJNA 2UWLA 4B7YC 2B9LA 3H7OA 4K8YA 1H9IE 2YVRA 1MCVA 1P2OA 1EZXC 1P8VC 1ZLRA 3ZZ7A 5FHTA 3SI3H 4CHAB 1WEPA 1YYY1 1QBVH 1ZHMA 3F68H 1JOCA 2ZPQA 3UWJH 2IN2A 4TWYA 1O2LA 5GNDA 2V0BA 2FFWA 4AYYB 1TGSZ 1CA0B 2XP0A 1FN8A 5T6GA 2BTCE 1UMAH 4WXIA 3ZZCA 3E91A 4DOQA 4DIIH 4O9VA 2XBWA 1KXFA 5LKZA 1TPAE 1UW7A 3FZDA 1C5MD 2JMDA 1AY6H 2QF5A 2YT5A 2EGMA 1TA6A 4WA6A 2GV7A 2WUCA 4O64A 1P10A 1C1MA 2VIOA 2BD8A 5FAHA 1SLWB 1P3EA 2C8YB 1BHXB 1BOQA 5L2ZH 2XBXA 3O47A 1SL3A 2H5DA 3SUFA 3UUZA 4XE4A 1MZDA 4Y71A 3RXHA 3VFEA 4JYVH 1IQNA 4RT0A 2ECGA 5E0GA 2HNTC 1C5WB 2F9VA 2Y1NA 1YC0A 3F3BA 3T62A 2JETB 1HCGA 1C1TA 1O33A 2PWXA 4IS5A 5E0JA 3FM8C 1PQAA 4Q7YA 1H1BA 5JBCS 1Z8GA 1GG6B 1FN6A 1V2NT 5HXFA 1GBIA 3VPKA 1SGEE 5FBEA 1AUJA 2G5NA 2EGPA 3MFJA 1J17T 1WEOA 3PV2A 4AP4A 1WSSH 3JZ1B 5GCHG 5LH8A 4HGCA 1T8LA 1TRMA 2K0QA 4NSYA 4WWYA 3RXBA 3HCUA 1NFWA 1W0JD 3M5LA 1GBEA 1UK4A 2BZAA 5PTPA 2FYRA 1C2EA 1PPZA 2Q1JA 1V2OT 2KR4A 1FI8A 1EAWA 2PW8H 4WMEA 1NRRH 1O2IA 3AASA 4GUXA 3EB6A 2ZFQH 1WV7H 2XOKD 4ISLA 4Y10E 1FAXA 2UZGA 3N9NA 2CGAA 1BTYA 2AMQA 2HPQH 3E90B 4IGDA 2ZP0H 3H09A 3SJIA 3T6RA 3U9AH 5A8ZA 4Z0RA 4CH2B 1GBMA 3M5NA 3TK9A 3QZVA 4WF8A 1KSNA 1SKYE 2ZGXH 1Z6JH 2F6JA 1O2YA 3OSYA 4MDSA 5EQSA 3ASLA 5HKKD 2L6OA 3SV7A 1SHHB 2B0FA 2JMJA 1QL8A 4AYCB 4UP0A 1ANDA 1DX5M 4ZXXH 2C93B 3LGVA 1QQ4A 5KH3A 4CHAC 3BEUA 4XD7D 3GDVA 4MPXA 2CF9H 1LHGH 2IQJA 1QCPA 3L6PA 4X1QU 3SJOA 3ZZ4A 4AB8A 1FZZA 4BAKB 1TNJA 1VITF 5GIBA 1CA0C 3KQCA 3NZIA 4ISHH 1OP0A 1MTWA 1XWHA 1MU6B 4YOIA 3RXRA 5I46H 1O5DH 3K6ZA 2IDAA 2RCEA 3LJJA 1E79D 2FXRA 1YPHC 3ZYDA 3ATKA 1LHFH 3MO9A 4XSKU 1Z2QA 4AVXA 2FI5E 3SZEA 5AFZH 3STIA 5F53A 4NA7A 2JMIA 5H1UA 3FL2A 1HLTH 2AERH 2M5TA 2ECWA 4ACAA 3PM3A 1EB1H 2P16A 3OAAD 3RMOH 1EUFA 3SUDA 3RXCA 2JETC 3NKKA 3E16B 4B86C 2OLGA 1LQDB 3I2DA 2GTBA 1IOEA 1RMDA 2FUIA 2VJ1A 1GG6C 1C2LA 5T6FA 3RXMA 3E3TA 4DJZB 2A4RA 2Y5GA 1PPBH 2ZDAH 4CBNA 3LOXA 3M7QA 1GDUA 2YNAA 1FY8E 4UFDH 4OS6A 3KF2A 3UB0A 2ZTXA 2QXHA 1P57B 2FSAA 1WGMA 1FPCH 1ZMLA 1E38B 2JH5D 2PLXA 2VH0A 1ETRH 1Z60A 1SQRA 1HDTH 4NA8A 1FY5A 4B2CA 1Y3YA 2EC9H 2MT5A 2YSJA 4K3JA 3S9BA 1WOFA 1VITG 4J2YB 1PPHE 3NPSA 3F1SB 5ESBA 2KYUA 3ESTA 2LXPC 1V3XA 4BANB 3BTHE 1H9HE 2ZECA 2AMPA 1JXPA 3QX5H 4DVAU 2BY7X 5GWZA 3S7HB 2GZ8A 2GMTC 2QICA 3FVFB 4M9FA 1QQUA 1DWEH 2JJ1D 1W11U 2A1DB 4UE7H 4X0WU 3VB7A 1UTPA 4F4OC 1FX0B 2XOYA 1B0EA 1FV9A 1HIAB 3A7ZA 1XVMA 4P02A 5DP5A 3SV9A 1DITH 2VWMA 4KTSA 2DX8A 2Z7FE 1HXFH 1HAVB 1QB1A 1SLXB 2VNTA 5DP4A 1ESAA 1WTHD 1KMHB 3A8BA 1QA7A 1SC8U 1S82A 3SQHE 7ESTE 4U2WA 1FP0A 1LTOA 1MTUA 1DY8A 1BRCE 3LGYA 3T27A 3SORA 4FUIA 4TSFD 3RMLH 4PTBA 1YLNA 2ECIA 2WV4A 2AN6A 3RM2H 5C11A 3MH4A 4MQAA 4AGJA 2BLOA 3EGKH 3MNCA 2OWAA 1OWDA 2WPJS 1BB0B 1P2NA 3QK1A 1Z8JB 2KWNA 2BHGA 2M85A 2TPIZ 4ZUXU 2P93A 3M37A 1GI7B 2XC0A 2A7HA 1MBMA 2ZZUH 1P9UA 1VITH 2F83A 3V3MA 4X8SH 3GV4A 2KCAA 1AQ7A 3FAOA 3A8CA 1TBQH 2FO9A 2GKVE 5SGAE 2PSXA 1OYTH 2WSSD 4INHA 3KDEC 2BXUH 1AU8A 1NU7B 1P12E 2ANWA 1EX3A 2KREA 5C3NA 2A5KA 3RXUA 1SLUB 1TPSA 3SU5A 5B77A 3RLYH 2P94A 1NESE 1GJ6A 5CMXH 3LDXH 5HYOA 3CP7A 4E7NA 9ESTA 2F9NA 3H7TA 3E2DA 3U28C 6LPRA 4IW4E 1UHBB 2K4DA 4ISOA 2JM3A 5A8XA 1ZBDB 4I33A 3SOUA 1QJ7B 4JZFH 1OYQA 1IHSH 2P3UB 1OWKA 4AYVB 1HXEH 2BDCA 4LXBH 3RXAA 1DANH 2VB0A 3SNDA 1ORFA 1C1WH 4ACBA 1K21H 3RXTA 2CF8H 3M7KA 1JWTA 1BBRK 4BXSA 3SGQE 3T25A 1NRSH 2J4IA 1KYNA 2GJGA 1Z6EA 4PROA 3M62A 5GDSH 5B78A 1C5RA 1V2QT 2Z9LA 4LADB 5SVYA 3MOCA 3RXFA 1ZPBA 2XWBI 5FCKA 2MNYA 2QV1A 1SHYA 1O5EH 3FP6E 2PGBB 1CT0E 1HV7A 4OS5A 5DKMA 3V13A 1IHTH 1TQ0B 3FP7E 2W6ID 2GCHF 4UFEH 3UQOA 3DWDA 4X6NA 3OFND 3U5PA 1VJAU 2HNTF 1CGIE 4D7FA 1ZTLA 3P8OA 1RRKA 3MO6A 1YWUA 2ZTYA 1C4Y2 4FUFA 2R3YA 2ZFTA 2B0OE 1GBKA 1Z8IB 1SGNE 4I7BA 3KQ5A 1W12U 3A89A 1VD4A 2PUQH 1YLCA 1OX1A 4IC5A 2BQWB 1AFQB 2MKEA 2W5EA 1LDJB 2PKAB 1MD7A 1TRNA 3ATWA 2FYQA 3VXFH 2C8ZB 1A4WH 1TABE 3PV4A 3HTKC 3OU0A 5A0CA 2CXVA 4FK5A 2ANYA 4Y7BA 4FUEA 2G4UA 4HG6A 3EB5A 1HJAB 1GHWH 3HK6B 3SU6A 4AX9H 2AIPA 2ZDMA 1HUTH 2A2XH 5C1UA 5TRBA 1QY6A 2WPMS 1NBMD 1O0DH 1EB2A 1YGCH 2YNBA 2L7PA 3F9EA 3C1KA 5J4SA 1A0JA 3W1EA 1UHBA 2ZU1A 2FOAA 2XBVA 3GS9A 3Q77A 3HGPA 3BF6H 3PB1E 4Y8ZA 3TPIZ 1L1NA 1W7GH 2A2QH 1A0HB 4K1SA 3T2NA 4FVDA 3SU4A 2OTVA 4JK6A 5B75A 4AG2A 2H5CA 1LPKB 4X6MA 1F0RA 2AIQA 2A4QA 3U8TH 4I7YH 2XOZA 4NA9H 3SBKA 2PSYA 1QGFA 1WU1A 1T7CA 5D1KB 5G05B 3MO3A 2ODQA 1UCYK 3PMBB 1OWHA 5JB9S 3SU1A 2F9BH 4F48B 5AF9H 1G25A 2L74A 3GDSA 3T5FH 1LO6A 1RGQA 2ZHQH 3N7EA 2M3HA 2Z3EA 3SV6A 1HAYB 2AEIH 4X3GA 1SQTA 2OINA 2G8TA 1PFXC 3CS0A 4WXVA 4A1XA 2I50A 2GGVB 3RXOA 2NWNA 1LQEA 2STAE 4JMYA 4YATA 1WBGB 4YLUA 4XBDA 3DUXH 3HATH 1LHDH 3S0NA 5DP6A 2H9TH 4Q2KA 1SOZA 3GOVB 4ZKSU 5FB0A 3D23A 1P03A 3HKJB 3L1ZB 3NCLA 2F91A 3KQEA 3PWCA 4GHTA 4D76A 5FCRA 3SHBA 2ULLA 3A8DA 4A92A 2VVCA 3LQJA 4NFFA 3RLWH 1PQ8A 2FOMB 1T4UH 1FY3A 1MKXK 1ELVA 5LKUA 2WPKS 2OC1A 4Q6FA 5SVXA 7GCHF 1GBJA 2B5TB 4JZ1A 1OPHB 3OY6U 5T1VA 3RXPA 1L1GA 3ZVEA 2ZNKH 3F9HA 1AIXH 1O3PB 1EATA 2PKAA 2WZQA 4AN7A 5HIYA 1PJPA 4B2AA 1Y3UA 4Y8YA 3SJ9A 1XXFA 2STBE 1MKWK 1OHHD 1Z1IA 3DSPA 2VNFA 3GDUA 1O2UA 2C90B 1GI5A 4BAHB 3MHSA 2ANKH 1GHZA 1EAUA 1C2JA 4LJNA 2QXIA 4GVUA 3L11A 2ZCKP 3OYPA 4BAMB 1HJAC 1AWHB 5DP3A 3RXQA 4AOQA 5EGMA 2ZTZA 3H5CB 1G3CA 2D8WA 1ZYOA 4CA1A 2P3TB 4X2YA 3BTKE 1ELBA 3A7TA 4I8LA 4W4UA 2F9PA 1NFXA 3ZIAD 2KCYA 4KGAA 8LPRA 2BQ7B 1UTQA 1KDQA 2BVSH 4P5OB 1QB9A 5H4IB 3PROA 1NT1A 2J98B 2PTCE 5IYTA 3UOPA 8ESTE 4BAOB 5J3XA 4IN1A 1TA2A 1U6QA 3EDXB 3P8FA 2UUYA 1WUNH 4GCHF 3MH5A 1TNLA 1HAPH 4B6FA 3EA7A 4KTCA 1ZPCA
chains in the Genus database with same CATH topology
3DFLA 1GJ8B 5F8ZA 1QBOA 1ANCA 2FI3E 1RIWB 1ZTKA 1C2GA 3LGUA 2XTTB 3SUEA 1ESBA 3D65E 1P01A 3GY8A 4ABIA 1BMLA 3U8OH 3LGWA 3KQBA 3MNBA 3TH3H 1EZUC 1ZZZA 2JKHA 2G81E 1NPMA 1GVZA 2VGCB 2JH6D 3GY2A 5E0HA 1AE5A 1XXDA 1W2KH 1FLEE 4IN2A 4MLFB 2G5VA 5HM9A 1AKSB 1W0YH 1EKBB 1AVGH 1UVTH 2AS9A 4BXWA 5DGJA 1IQKA 1E35B 1O2WA 1K1MA 4A7IB 1SSXA 3O8CA 2BVRH 3A88A 1QNJA 4HI3A 1CGJE 2O9QA 4E7RG 1TLDA 2HGTH 1TNKA 1O2ZA 2QF3A 1NFYA 2V6NA 4A1VA 3UY9A 2RDLA 3ZVBA 2BLQA 4KKDA 3ATIA 4GCHG 3SGAE 1D4PB 1ELGA 4UD9H 3RDZA 4O3UA 2W3KA 1HAGE 2BVXH 2Y5FA 3L33A 1AMHA 1VJ9U 3QO6A 3RU4E 1MUEB 2Y81A 2QC2A 1TGCA 2WYGA 1HAZB 3SJKA 5DP9A 3GYLB 1B7XB 1GI9B 2ZCHP 1O2RA 3MU5A 1YPLH 2O8WA 1XUKA 3AW1A 1O2XA 3SQEE 1DXWA 3BTWE 4A1TA 4JZIA 1A2CH 1D6WA 1V2RT 4X1SU 3SI4H 3ZV9A 2ZHFH 1NO9H 2ZG0H 1UO6A 2GVFA 4ZKRU 1AO5A 2PKSB 1YCPH 3U1IB 1W10U 2QF0A 1GI4A 1KLJH 3UNRA 1RIWC 1XMNB 1DWBH 2V3OH 2VVVA 1F92A 1GHXH 3MNSA 1Y59T 1HBTH 1K1PA 2QXJA 2Y82A 1P11E 1C5QA 3RU4D 2Y6TA 5JBTA 2Q6FA 3P17H 2BQ6B 3LH1A 2OQ5A 1K1LA 2Z9GA 2VGCC 3SGBE 1E34B 3B8JA 2BLWA 2BDHA 4JYTA 1O2TA 4UFGH 3MU0A 2XC5A 1GJ4H 4I8GA 1PYTC 2RA0A 4H6SB 4NSVA 1CA8B 1BMAA 3P6ZB 4DURA 3FP8E 5ETXA 2XW9A 4ABHA 1FY4A 4JZDH 1WAYB 4X2VA 1TWXB 2TBSA 1Y5UT 4AFUA 3TGJE 1W7XH 1S0RA 2TGDA 1DY9A 1QHRB 2BY6X 2ZHWH 4K60A 2O8TA 2GT8A 2J38A 1C5YB 1RTKA 1GI1A 1JIMA 1TX6A 1O34A 3MH6A 1C2DA 1LVMA 1V2PT 4I8JA 2ILNA 4MNXA 2H9HA 5JYIA 1YPEH 2CHAB 3DT0H 3SU3A 2IJOB 1JMOH 2AGGX 1A5IA 3A86A 1BTHH 1CHOF 1P2IA 4R0IA 1NY22 3L3TA 1C1SA 2XC4A 3BTTE 4ZAEA 1O3IA 3O8DA 3GICB 3QGJA 2BD5A 1GL0E 3O8RA 1LVOA 2LPRA 2VWOA 1NC6A 6GCHF 1IQIA 1C9PA 2VH6A 3FZZA 3P92A 1SLVB 1O3OA 3M3VA 4BNRA 2FESH 3GY3A 3RXIA 1DXPA 2GMTB 1DVAH 2XWAA 2PKSC 3A80A 1SQAA 1GJDB 4NCYA 1MTNB 2FOBA 1C1UH 1ELCA 1GHVH 2CMYA 5L30H 2VINA 4B73A 2FDAA 1T31A 1ARBA 2P3FH 4YTAA 2GZ9A 3M3SA 4FXGH 1C5TA 4VGCB 2BDIA 3PMHB 1O35A 2ZGBH 4IC6A 5DO4H 3GY7A 4CREA 4DIHH 2PGQB 4DG4A 1BJVA 4X8UH 4X2WA 1GPZA 1CBWB 1K2I1 1O5AB 3F9FA 1O2JA 3U69H 1O2QA 2NU4E 2Z9JA 3ZZ9A 1YBWA 1C5OH 3A83A 3RUOA 1DDJA 1SFQB 4NIXA 3UR9A 3M61U 1TBRH 2UUKB 5A09A 1GVLA 1ZGVA 1TOMH 2VWLA 5DP8A 4B2BA 1S84A 1L4ZA 1EAXA 2BOKA 2BDBA 4ABJA 3LGTA 3W94A 1BQYA 2VIWA 4FUBA 4H4FA 1O2PA 4HFPB 1GJ9B 5HM2A 6GCHG 3RMNH 2ZC9H 1G3DA 5E2PA 5CE1A 4MPVA 6ESTA 2PV9B 2VIQA 3IWMA 3CS7A 2F9OA 1SQOA 4NWLA 3QZQA 2CHAC 5FPTA 2FS8A 1SGDE 1Y3VA 4BTTB 1SGTA 4I8KA 3K65B 3P8GA 4D9QA 4K5ZA 2YOLA 5LPFA 1TAWA 2ANMH 1SGFA 1O3BA 1AGJA 1BTWA 1T8MA 4ISNA 1F5RA 1ANEA 2WPHS 5DJ7A 1GBTA 3E8LA 2R2MB 3A87A 3RXEA 4Y6DA 2W3IA 1NRQH 1BCUH 1Q31A 5EPYA 1OSSA 3BEFB 1LVYA 1H4WA 3JZ2B 1O2MA 3ZZ3A 1QA0A 4U01A 2WV5A 1F0SA 2FM2A 1MTNC 5AVDA 1K28D 1INCA 1UTNA 3KHVA 5HMAA 1P05A 1S6HA 5C1YA 1QTFA 3GCOA 4UFFH 3ZZ8A 1NS3A 5LPEA 2FP7B 4VGCC 1KXBA 3MU8A 3TJNA 3UFAA 3UTUH 3AVZA 1WQSA 2J94A 2FTLE 1C5PA 3MHWU 1MH0A 1CBWC 1C5NH 3PLBA 1EP5A 1QURH 2CJIA 3E6PH 1DWDH 1AVXA 4OGXA 5TCCA 4X2XA 2AYWA 4B75A 2H1UA 5DP7A 3UR6A 3QZRA 1FY1A 4WVPE 2Y80A 5FBIA 1B5GH 3LGIA 3DA9B 2ZPSA 3EQ0H 1IQEA 4OS7A 2BY8X 1D3TB 2ZU4A 2HRVA 4IMQA 2BOHB 1SGRE 2FEQH 1DUEA 1FIWA 1EASA 1UTMA 2TGPZ 2FODA 3M7TA 3T28A 2A32A 3B9FH 3UREA 1C1NA 1V2KT 3TH2H 1FNIA 4Q7ZA 3MTYA 1UJ1A 1Z7KA 1J16A 1ETSH 1SR5C 1OP2A 3RXDA 2XXLA 1HFDA 1DUAA 5DG6A 1HRTH 2VVUA 2OP9A 1ZR0A 4BAQB 2G00A 1IQJA 2QCYA 3VEQB 4YO9A 3PTBA 2F3CE 5AFYH 3A85A 1GJ7B 3GYMA 1GI6A 1DOJA 1PPCE 5J4QA 5TJXA 4INKA 1AFEH 1TBZH 2RG3A 2V35A 3F9GA 3ZVFA 1KTTB 1GBFA 1HIAA 2GZ7A 3SNCA 1GI8B 1P2KA 1L0ZA 4ZHMU 4O03A 1SGPE 1HAVA 2C4FH 3TJUA 2FX6A 1EXFA 4H6TA 1DM4B 3TLOA 3V7TA 3TU7H 1TMUH 4WMDA 2OUAA 5DK1A 3FFGA 2VIDA 4NFEA 3UWIA 1O38A 5JBBS 3CENA 1O31A 2J92A 1SGQE 1GHYH 1ID5H 1GJ5H 3SNAA 1O32A 1DS2E 3M36A 1FXYA 1NN6A 2BD9A 4TY7A 4B76A 2A4GA 1BA8B 4CR9A 4X6OA 1LHEH 4ZH8A 3EA9A 3PO1B 1GJAB 5HGGA 1GHBF 1FQ3A 2ZGJA 1M9UA 3R0FA 3TVJB 5F8XA 1YPGH 1JIRA 3BIUH 1QB6A 3SN8A 4CH8B 1VCWA 1GWAA 1O39A 2Y5HA 3VXEH 3VB4A 1O3GA 2P8OB 2Z94A 4LOYH 1C5ZB 2AFQB 3GCHB 2SNWA 3LH3A 1PQ7A 1O3DA 2ZQ1A 1GI2A 1AD8H 3Q3KA 1CHGA 1LVBA 2BB4A 4FVBA 1FONA 2ALVA 1F5KU 3O8BA 3GY6A 5EOKA 1HAXB 1DSUA 3LJOA 4MTBA 1C1RA 1C5SA 2OC8A 1YPHE 1TGTA 1V2WT 1F7ZA 2THFB 9LPRA 1X7AC 4SGAE 1LHCH 1TYNA 1O2GH 1N8OB 5F03A 1IQFA 1GHAF 1MZAA 1C2HA 2AMDA 3EA8A 1F5LA 2GCHG 4X6PA 1W14U 4ABAA 3RU4T 2OC0A 1KY9A 3MU1A 1QJ1B 1MD8A 1GHBG 2PHBA 4KTUA 1O2HA 4YM9A 1BITA 4CRDA 4WY3A 1O36A 2FMJA 1S81A 1BHXF 1XUIA 1L2EA 1S83A 1CT2E 2FIRH 1TIOA 3RMMH 4Z0KA 1DWCH 1E36B 2EA3A 1RFNA 2D26C 1HYLA 2ESTE 4U32A 4FUGA 4J1YA 2AGEX 3ODDA 1BTZA 1QL9A 1G3EA 1GI0A 1VCPA 4TPYA 1IQHA 3PO1C 3U8RH 4TYDA 2V3HH 3ZZDA 1A5HA 4CRGA 1JBUH 3URCA 1Y5BT 1NZQH 1BMMH 1DFPA 1AVWA 1T8OA 3LC3A 3SHAH 1J15A 1D3PB 1BUIA 1XM1A 3I29A 3C27B 4DT7B 4YOJA 3E0PB 2P8OC 1GHAG 4IMZA 4JYUH 3GCHC 3TK5A 2BD2A 1FIZA 1Y3XA 4NGAH 4TY6A 4Q7XA 5LGOA 1SG8B 2ZHEH 1ZPZA 5EPNA 2AH4X 1K1OA 1TONA 1TALA 5EW2H 1UTJA 1ELFA 2LNCA 1K22H 4R8TB 3OTJE 3IG6B 3Q3XA 3KN2A 1EQ9A 4AFZA 1BRAA 1W3CA 3EE0B 1GMDF 3SUGA 1SGYE 1NTPA 2ZFRH 2FWWA 1ELEE 1K9OE 4OS4A 5C67A 4NIWA 1LKBA 1N8OC 2OCVB 4JCNA 2ZFFH 1ZTJA 2SGEE 3QTVH 4F49A 2EI8A 4X1PU 3GY4A 3UNQA 4WH6A 4MNVA 1O3CA 7GCHG 3UQVA 3W95A 1WTGH 1BRBE 2BX3A 1XKAC