3FAOA

Crystal structure of s118a mutant 3clsp of prrsv
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDAGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
molecule keywords Non-structural protein
total genus 39
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3faoA03
1H1BA 7KMEH 1TMTH 1P9SA 1TBZH 2CHAC 3TGKE 2PKAA 1CGIE 3GCHC 3RXBA 3BTHE 1LKAA 1O3CA 4I8JA 1WSSH 2ZDAH 1TX6A 1PPCE 2F9UA 2PSYA 1HLTH 3SOSA 2JH0D 2V0BA 5EOKA 1RTLA 1V2VT 1SLXB 5K0HA 1ESAA 4YT7H 2ZI2H 3M7UA 4AGKA 1GHAG 3L33A 1SGTA 3TJNA 1WQSA 2Z9IA 1P01A 2F9VA 3KCGH 1A5IA 4CH2B 1TB6H 3UPEA 1O3DA 3C27B 4K2YA 4WH6A 1RS0A 2TPIZ 3P95A 1WTGH 1GHAF 4IW4E 5F8TA 1S85A 1XUHA 1KXFA 4NG9H 3RP2A 4H4FA 1ESTA 2ZZUH 1VJAU 3BEIB 2EC9H 2G55A 2ZDLA 4AFSA 2QIQA 2ZECA 1C5TA 4IC5A 3ATIA 3V12A 5FPSA 1BTWA 4ZHMU 2XBVA 1W12U 1RTKA 3P8GA 2FI4E 2A32A 4ISHH 1QTFA 1CHOG 2PV9B 3R0FA 1CA8B 1MTWA 4MPVA 1AN1E 4Y6DA 4YT6H 3SV2H 2QYIA 1O32A 5K7RA 4A6LA 3TLOA 1A0LA 4MTBA 1LKBA 5A09A 1C2LA 2JETC 1CHOF 2HWLB 1SMFE 2XBWA 2BD5A 1J16A 2PKSB 2O8MA 1YPEH 2J9NA 1YC0A 3T27A 3BTEE 1P9UA 4YLUA 3NKKA 1OWKA 4MQAA 1OP0A 2W26A 1AWFH 2CV3A 4IN2A 1KXCA 1VZQH 3SJKA 4D7GA 4O3UA 4IMZA 1TQ0B 5DG6A 4NFFA 2BXTH 4JZ1A 2GDEH 1RJXB 4XSKU 3U69H 1CU1A 1AE8H 5EG4A 1EXFA 1P57B 4I8HA 1EP6A 1BT7A 2OBQA 3E90B 3KEEA 1F0TA 1TGBA 1MKWK 1H9LB 5EQSA 3ZYDA 1INCA 2QA9E 1ELAA 1A4WH 3SU6A 3RM2H 2ZGJA 1ZMNA 1ABIH 5IYTA 2PSXA 3SQEE 1T8LA 2W7UA 4WJG2 2AIPA 1V3XA 1Y59T 1E36B 2ZHQH 3ZZBA 2GV7A 3GCTF 3ZVAA 2ZCKP 1NTPA 1MBMA 5DP7A 5FAHA 1K9OE 2Q1JA 2GCTC 3SNBA 3Q76A 4WVPE 3EYDA 2BY9X 1GBLA 2IOTA 3PMJA 2B8OH 3MH5A 1RXPA 1P2OA 3OTJE 1O2KA 2Y5GA 4K1EA 1HAVB 2TBSA 1AI8H 4AG1A 4B1TA 2F83A 3AVZA 1KXAA 1O2XA 1MZAA 1EOJA 2CGAA 1DE7H 1SGDE 2ZHWH 1TOCB 3MNBA 2W3IA 3ZYEA 2FOBA 1WAYB 1BOQA 3GCTG 1A0HB 1OKXA 3M5LA 2P94A 4KP0A 2FIRH 3W95A 1D6RA 1QRZA 2ANWA 2BX3A 1EX3A 3UR9A 1FY8E 1C5RA 4Y10E 3GYLB 3ELAH 3F9EA 5FCRA 3SNAA 4MVNA 4GCHF 2ZU2A 1YPHC 1P3EA 4A7IB 1AMHA 2BY6X 2CHAB 1OOKB 1Z1IA 1Z8GA 3LC5A 1SGPE 1W7XH 4B75A 1FQ3A 2SGAA 2Y7ZA 1Y5AT 2QGRA 1D9IA 3BN9A 2BQWB 1EZSC 1RIWC 1OS8A 1P0SH 2TRMA 1PPFE 5BPEA 1O5DH 1OYQA 2GCHF 2ZFPH 1L1GA 3SU3A 1BRBE 1ELTA 1F5KU 3B23B 5EU8A 2BLQA 1HJ9A 1J9CH 2OTVA 1XUFA 1L4DA 1K1JA 1KLTA 1HGTH 3RXLA 1IAUA 4DCDA 1Y3XA 1QIXB 2CF8H 2ZGXH 1ACBE 3AW0A 1A7SA 5E8EH 4WF8A 3ZZ6A 2ZDNA 1TONA 1D6WA 2J4IA 2G5NA 2NU2E 3A7WA 6GCHF 1GHWH 3GYMA 1O2IA 2DUCA 3RXAA 3C1KA 1WYKA 4GPGA 2FZZA 1GCDA 3FFGA 4K8YA 2TIOA 3UIRA 4B2CA 2GCHG 2SNWA 4B73A 3ZZAA 7GCHF 1P05A 1TX8A 2A31A 1O2JA 2R3YA 1O3OA 1GJ5H 2VGCB 1AUTC 4X6OA 1PQ7A 1P3CA 3TH3H 3E16B 3RC4A 3T29A 3VFEA 2HGTH 1ZLRA 1SFIA 1N1LA 1C4Y2 1W0YH 1O3HA 3NWUA 1GBKA 1BRUP 1N6XA 3P70B 3PV4A 1D3DB 2QN5T 1O2GH 4B74A 4JK6A 1T7CA 1EP5A 2WPHS 1C9TA 1O36A 1YF4A 2A2QH 1H9IE 3V3MA 5CE1A 5JB8S 3MO9A 3RXPA 1AFEH 2PGQB 1QB9A 1LVMA 1ELVA 2FX4A 1QL7A 2K1QA 4D9RA 5AF9H 1ELFA 4DY7B 1DSUA 3FANA 1SHYA 3T28A 1HJ8A 1TMUH 2DE9A 5C1UA 2VWOA 3TJUA 3BTQE 3S0NA 1HJAC 2QXIA 1SPJA 2BD9A 4I8GA 1JBUH 4Y8YA 3SO3A 2Y82A 2ZGHA 1G37A 1GI5A 1RGQA 3A7TA 1TNLA 1ZYOA 4Y7BA 2ZP0H 4OGYA 3ZVFA 3A87A 2ZQ2A 3JZ2B 5C20A 1Y3UA 1XX9A 1O3KA 5JB9S 1J15A 4JCNA 2FO9A 1GCTB 5HMAA 4DIHH 4NIVA 4NIYA 1BBRH 1A2CH 1PYTC 1WBGB 4NGAH 3MNCA 3KQDA 3SNEA 1SLWB 2P3TB 3O8CA 3A86A 4F49A 4CHAC 1U6QA 2VB0A 1P8VC 2XTTB 1C1QA 1MD8A 1QRWA 1X7AC 1VCQA 1DWBH 3ODDA 4Y8XA 2FTLE 4GLYA 5EXMA 5HM2A 2GT7A 1QJ1B 4FU9A 4E7RG 2KAIA 2FM2A 1XMNB 2I6SA 3ZVBA 3KNXA 2P95A 3B9FH 2A2XH 4I8LA 4ISLA 3TJOA 3RXMA 1NROH 1NFUA 1GJCB 1T4VH 4O03A 3UNRA 4ZMAH 4AFQA 3SHAH 1FPHH 3ZZDA 3A7ZA 1O2QA 2P3UB 1MTVA 2WUCA 3ZZ5A 1AB9B 2A5KA 3D65E 4D76A 1Z7KA 3HGNA 3S69A 1O2OA 1V2JT 4Q7ZA 2AMDA 5DO4H 3RXGA 5A0BA 4FU8A 4AGJA 3SW2B 3MTYA 3ZV8A 2V6NA 1GI9B 1MTNB 4NFEA 4Q2KA 3U1JB 2D26C 4FUEA 1XKAC 2Z9GA 3M5MA 3EA7A 1S83A 1MTUA 1LMWB 1TBRH 3TJVA 3MH4A 5T6GA 1HUTH 8LPRA 1T8MA 5FCKA 1HRTH 1FONA 1TNKA 1GGDB 1ELBA 4UFFH 1W0ZU 4MPUA 1A3BH 3RMMH 2D2DA 4Y8ZA 4GVUA 1AFQB 4Y7AA 2A5AA 1SQOA 4CR5A 3PLPA 1FY1A 4IS5A 3SUGA 2BDAA 2CN0H 1C1UH 4A1VA 1GMHF 2VIPA 3QTOH 1GBFA 9ESTA 5J4SA 3A7YA 1K1OA 3U98H 4Y76A 3GY5A 1MBQA 2A7HA 1QFKH 3HKIB 1YLCA 2ZWLH 3FAOA 4CRDA 1K1NA 3M5OA 1AO5A 2QY0B 1SQAA 2UUKB 1NY22 1SI5H 1V2PT 1D3PB 2AH4X 1O3GA 1Z1JA 5T6DA 4AN7A 1AZZA 1F7ZA 2QAAA 1MU8B 4XBCA 3LH3A 1AUJA 4Y71A 3RXHA 1JWTA 3PTBA 1OWIA 1SGFG 4ISNA 1TYNA 1THRH 4Q7XA 4AZ2B 4LXBH 3GCOA 4UFEH 4R8TB 1XXFA 3SJIA 1YGCH 3AW1A 1TGNA 3M7TA 1UTQA 1WOFA 3BTME 3V13A 1DSTA 1HNEE 1PQAA 4K3JA 1O5AB 1GI6A 2OC8A 3TH2H 1V2MT 3HK6B 2QXHA 3O8RA 3A88A 5FBEA 2AGGX 1IQHA 4CHAB 2P16A 4JZDH 4X1NU 3DUXH 3URCA 6ESTA 2PR3A 1K2I1 3U8TH 3H5CB 2BD7A 1A61H 1TRNA 4SGBE 2UWLA 3D49H 2NU0E 1BTXA 1ZRKA 2FPZA 1IOEA 1THSH 3S7KB 1ORFA 1HJAB 1CGJE 1O31A 1LO6A 4I32A 4ABGA 1GVKB 5T6FA 2STBE 2ZPRA 3ODFA 2VH6A 4BTUB 1XUJA 4NA9H 3SV9A 1UVSH 4JYTA 3TU7H 4U2WA 2ALVA 1IQFA 1AU8A 2VGCC 4YO9A 2QXJA 1DT2A 1O2UA 4NA7A 1YPJH 1ZPZA 4A1TA 1DY8A 3SU0A 1E37B 1IHSH 1KSNA 4NWKA 1B7XB 1S84A 3MU5A 2AGIX 3A89A 1KLJH 3MU8A 1EAIA 2R2MB 1BHXB 3MU4A 4ESTE 4DG4A 4ABFA 1G2LA 1H9HE 1ZTKA 3IG6B 1CBWB 1TBQH 2XCFA 1GI7B 1GBHA 1BMLA 4KGAA 1P2QA 2ZDMA 3E1XB 3GY4A 2G00A 5FPTA 1ZOMA 1UVTH 1CQQA 1O2LA 4Z6AH 4FXGH 5FX6A 1BMAA 3EA8A 1Z6EA 8KME2 1BTPA 1O2NA 2OQ5A 2CMYA 1MQ5A 1Y3YA 3PLBA 5BRRE 4X6PA 2R0KA 2WINI 3TK6A 1MMJN 4YOJA 1DLEA 1BQYA 3F68H 3BIUH 2AIQA 2Z9JA 3WY8A 1Q3XA 3SV6A 2Q6GA 2VVUA 1AVWA 1O3LA 4X8UH 4WMEA 2A4OA 2H5DA 3CENA 2W7SA 2ZPQA 4Y11E 1QR3E 1YPKH 2Z3DA 1HV7A 1NRSH 2ZHDA 1KTTB 1GBCA 1CO7E 2OBOA 4JK5A 4WMDA 1V2UT 5JYIA 4X1RU 2Y81A 3BTWE 3BG4B 2J92A 4Y0ZE 2FP7B 3RXTA 2ILNA 2FLRH 2PLXA 1GDUA 1FAXA 1GDNA 1OXGA 1KDQA 1CSOE 3IWMA 4NIXA 1GBMA 2EI6A 1MUEB 2HLCA 1WU1A 2G5VA 3QLPH 1NM6A 1FI8A 1G3BA 1DWEH 1S82A 3MFJA 3QUMP 3A81A 2BHGA 3VB3A 3TH4H 2FMJA 2ZFFH 6LPRA 1UJ1A 1C5MD 4D9QA 3SNCA 1AQ7A 2XRCA 2HRVA 1LPGB 2AMQA 1Q2WA 3KQBA 1FMGA 4U30A 3I29A 1BIOA 3V0XA 1S5SA 2F9OA 4DGJA 1SLVB 2VWNA 4MNVA 1H8DH 3QGJA 4K69A 5TCCA 3HPTB 1C2HA 1DOJA 2F9PA 2FI5E 2ZKSA 3D62A 4I33A 3MOCA 5GDSH 2BTCE 1C5SA 1XKBC 1V2KT 1UTKA 1G3EA 5EW1H 1XXDA 3UNQA 2BY8X 2SGFE 1W7GH 3S9AA 4ZXYH 1QB6A 4ABBA 1Y3WA 2ZFTA 1C1VH 1SGYE 1HAGE 2UUJB 2D1JA 1HAPH 2VNTA 1LVOA 2C8YB 1W10U 5LPRA 5DKMA 1CA0B 5LPEA 2Q6DA 2G52A 1FUJA 2AFQB 1K1PA 2F91A 5ESBA 4NIWA 4FUGA 1QBOA 1L1JA 2ZU4A 1QQ4A 1TWXB 2O8WA 4I7YH 1ZTLA 4LK4A 3NXPA 5FHTA 1OX1A 1LHEH 2C8XB 2Z94A 2UUYA 3QDZB 3QWCH 3OU0A 2J94A 1KYNA 2FOGA 3E91A 5I46H 3JZ1B 1OWDA 2WPMS 5CMXH 2GZ9A 3ZZ9A 4A1XA 4FU7A 1IHTH 2R2WU 1C1TA 1OWEA 1LHDH 2OQUA 1O33A 3TNSA 3F9HA 2XBYA 1C5LH 4ISOA 1LPKB 4RN6A 3U1IB 4Q80A 4UEHH 4AORA 2ZA5A 2AEIH 3SNDA 3L3TA 3A7XA 3GDUA 1ARBA 5AHGH 1EB1H 3D23A 1B0EA 1NS3A 1UVOA 5TCAA 3SUDA 3HKJB 3QZRA 1HPGA 4AX9H 1VITF 2H6MA 1PPZA 2GT8A 4D7FA 2VIWA 5FBIA 2TGPZ 4KTCA 1HAVA 5E2OA 3FP8E 2PKAB 2RDLA 4UONA 1OSSA 5E0HA 1YLDA 4ABDA 4H6SB 1P2IA 2C93B 2QXGA 2ZF0H 5B6OA 3M5NA 2Y5HA 3E0NB 1BZXE 1WUNH 2J34A 3TK5A 1OPHB 1W13U 2ZC9H 2BVXH 4K1TA 3VEQB 2SGDE 3HGPA 4XDEA 1QY6A 2JETB 3DA9B 3QK1A 3OY5U 3ESTA 3SQHE 3SJ8A 3SGBE 1LPZB 1V2RT 3UNSA 1QA7A 3ZVDA 4K60A 1P2MA 5DP8A 5HGGA 3MMGA 3P6ZB 1P09A 3GCHB 2BD3A 4NZLA 2ZU3A 4YOGA 4ZKOU 1JRSA 4MPWA 5EODA 4CREA 3MU1A 4ZKNU 4PROA 1AVGH 1BBRE 2GZ7A 4X1PU 3P8NA 4BOHA 4X1QU 1BITA 1ETRH 2ODQA 3NUMA 3LKWA 5JPMH 3RLWH 1UK3A 1O3EA 4RSPA 3NPSA 2G51A 5FX5A 1Y8TA 2Z3EA 2ZGBH 2C90B 3A85A 1HAYB 5AFZH 1C1NA 5EPYA 3MWIU 2OC0A 1GJAB 3RXVA 4B2AA 3FP7E 1G3CA 5ETXA 2RCEA 1UTMA 3TGJE 2BLOA 2I6QA 4OS1A 1GDQA 4DIIH 3BTFE 1N6YA 4WXIA 1C2EA 3BSQA 4LOYH 3PWCA 2FOMB 1VJ9U 2ZU5A 1DXPA 1MCVA 3KF2A 1KXDA 5GPIB 3RUOA 4WY3A 2CJIA 1TFXA 1XVMA 1UTOA 2VIQA 3SORA 3LGIA 4YLQH 4AFUA 1FV9A 2QF0A 1UMAH 1HB0B 1O0DH 1EAXA 1SFQB 1TALA 1EJAA 2H9EH 1QL9A 3L6PA 2EI7A 3UY9A 2KAIB 1HDTH 1O3FA 1GJ9B 3ATLA 3TITA 4AB9A 3EA9A 4BAKB 1NU7B 2C8ZB 2OINA 2HPPH 4CRAA 4X1SU 3IITA 2XWAA 5DJ7A 3TGIE 1ZTJA 3QN7A 2BMGB 2W3KA 4ZKRU 2XCNA 3BG4C 3KQCA 1ZHRA 3K2UA 3M3TA 1GI8B 1UCYK 2BYAX 4X8VH 1SG8B 2UUFB 2FEQH 2FWWA 2R0LA 2IN2A 3RMLH 1B0FA 1LVYA 4UE7H 4TY6A 1GBBA 1HIAB 1EPTB 4Q7YA 1GI3A 3VPKA 1VGCC 1PPGE 4X0WU 3SHCH 3BEFB 1PQ8A 3SBKA 3I77A 2JH6D 4GSOA 5H4IB 1N8OB 5F8XA 1SGCA 1KLIH 1UTJA 1GWAA 1SOZA 2OUAA 3I78A 4CH8B 1TLDA 3UR6A 1WTHD 2ZHFH 2OC7A 3Q00A 2JKHA 4ABEA 4VGCB 1SGIB 2H5CA 3DT0H 2XWBI 1M9UA 1HCGA 3SV7A 4X8SH 1NFYA 4DOQA 2TGAA 1O2VA 1FIWA 4HTCH 1SVPA 4OS5A 1DY9A 2IPHA 1P2KA 3CS7A 3Q3YA 5FPYA 2GVFA 2WYGA 1YCPK 5GXPA 3F9GA 2G4TA 1AY6H 1C4V2 2HPQH 4CRBA 1BTUA 1O39A 3BF6H 1LCYA 1CE5A 4ZH8A 1TQ7B 2BDBA 1BA8B 2BX4A 3KHVA 4NSVA 2GTBA 3KIDU 5GIBA 3BTGE 4MNWA 1GBTA 1DICA 4AG2A 2BVRH 4UFDH 4DVAU 1NU9A 1XUGA 3PMHB 1C1RA 4FUFA 1V2ST 3ZZ7A 5SGAE 3PYHA 8GCHF 1G3DA 2EEKA 1QBVH 1C1PA 1GMHG 3GY8A 5GWZA 3ITIA 4MNXA 3ZZ8A 3ENSB 1FNIA 1HBTH 1SHHB 3W94A 3M7QA 1O2WA 1C4U2 1DX5M 3UTUH 4ZAEA 3UOPA 1QNJA 1YPHE 1LQDB 1DFPA 1GJ4H 2V35A 3QTVH 3A8CA 5AFYH 3QGNB 1ZSLA 1NT1A 1MD7A 4MG3A 2OLGA 1GHBG 1NRPH 1NRNH 1QRXA 4KKDA 1HAZB 1WQVH 5LGOA 1TABE 3F9FA 1EZQA 1LQEA 3RMNH 4KTUA 1ELGA 4DW2U 1O3AA 1C1SA 3VB4A 3N7OA 1NRQH 1OYTH 1Y3VA 3UQVA 2A45B 3EGKH 3EAJA 2M5TA 1DITH 1V2WT 4THNH 3RU4T 3ZZCA 4RKOB 5EQRA 1GJDB 2ASUB 2O8TA 2ESTE 2GP9B 5E2PA 4RKJB 1EASA 1O5EH 5DP6A 2ZDVH 2GV6A 1AFQC 2SFAA 3ZVGA 4MNYA 2A0QB 3BIVH 2GZ8A 3SJOA 4FUBA 2OD3B 5C5OA 3K65B 3ATKA 1FXYA 1ID5H 1O35A 1GBIA 3NCLA 5PTPA 1PFXC 1TOMH 1O3JA 2BZ6H 4YESB 1LTOA 5ESTE 2Y80A 4A5TS 1CGHA 2PGBB 1GBAA 1ELEE 3P8FA 2BQ6B 1H8IH 2WV4A 2ODYB 3VGCC 4K5ZA 3RXDA 3UFAA 1J17T 3BV9B 4NSYA 2BDIA 1MTNC 1DDJA 4BAOB 2SGQE 1KXEA 4BTIB 4JYUH 2WPKS 1K1IA 1AZ8A 2XC0A 3M35A 1ELDE 3K6YA 1GVZA 3KN2A 1P2NA 3E0PB 2HOBA 1O5CB 1YPMH 1EKBB 2P3FH 2P8OB 2Z7FE 3DFLA 5L2ZH 4UFGH 1F5RA 1ETSH 3GY7A 4ZKSU 4JZFH 1MH0A 4INHA 1VGCB 3PMAB 1ZGIA 3LGYA 3BTTE 1HXFH 1SOTA 2BZAA 1GG6C 4KTSA 1L1NA 5F03A 1BJUA 2XC4A 5HM9A 4O9VA 2VIDA 2FLBH 3F1SB 1BTZA 2BD2A 4AOQA 2O8LA 1V2LT 1MZDA 1T32A 2QC2A 3H7TA 4IGDA 1GI1A 1Z8JB 2QCYA 3RMOH 2ALPA 4AYVB 2G4UA 3M37A 4INKA 4X8TH 3P17H 1A3EH 3UOUA 1GHXH 2ZFSA 3F6UH 4ZHLU 3V7TA 4CBOA 2F3CE 1WCZA 2QF3A 5EQQA 1UVUH 3RXIA 2R3UA 4OGXA 4CRCA 2FOEA 1QURH 3STJA 2GMTC 1XM1A 2XXLA 4ZUHA 1ZJKA 4MLFB 5HXFA 1C2DA 1ETTH 1OP2A 1NPMA 1C2MA 3RXOA 2HNTE 4INLA 3GISB 1C5OH 3LDXH 1P10A 1LHCH 2ZTZA 5DP3A 3G01A 4IMQA 4BNRA 2GKVE 1DANH 2OCVB 1C1WH 4ZXXH 4BAHB 2PKSC 3QO6A 1ZPCA 2Y7XA 3P92A 3S9BA 1C2IA 3K9XB 1NN6A 2ZFQH 3DHKH 3S9CA 4AFZA 1TX7A 2ANYA 3KL6A 2HNTF 3T62A 3PWBA 1S81A 1G30B 1V2NT 2ANMH 5CHAC 3BTKE 1EZUC 4FUDA 1KXBA 3TNTA 1CT4E 3SU4A 1TNIA 2Z9LA 2BB4A 1FN8A 3A8BA 2FS9A 3RM0H 1N8OC 1F5LA 1LVBA 1JMOH 4X2YA 1ZJDA 4TY7A 1K1LA 1D3TB 3RXFA 1GHVH 2RA0A 1DUAA 4WXVA 3PB1E 5EXNA 1UHBB 2SGPE 1KY9A 1GMDG 1CT0E 3VB6A 4VGCC 1O3NA 1J14A 1L0ZA 3E8LA 1GJ7B 1C2JA 3U8RH 3SN8A 1DXWA 2BLWA 2SGEE 1B5GH 1AVXA 1FZZA 4E7NA 3PMBB 3PROA 4GCHG 1YYY1 2WPLS 2GX4A 3BEUA 2J38A 4BXWA 1FIZA 2GCTB 1YKTA 2SNVA 3HK3B 2BOHB 4ZROA 1UVPA 5C2ZA 1IQMA 1ANBA 4HGCA 4I31A 1C5QA 3MNSA 2FYQA 3RXUA 4AYYB 1IQGA 1CHGA 1EJMA 1SGRE 1SL3A 3MYWA 1HAIH 4TPIZ 3RXKA 2HNTC 1ANCA 6GCHG 8ESTE 1UTNA 2VIVA 2XNIA 1HXEH 4B71A 1GBJA 1HAHH 3RXJA 1MQ6A 3M3SA 1O3PB 1S0QA 2IJOB 2NU3E 1FJSA 1IQIA 1T8NA 1TRYA 1YP9A 2ZIQH 1Z8IB 4O97A 1RD3B 5C3NA 3T5FH 4TWWA 1SBWA 1GJ8B 1F0RA 3LGVA 3RXEA 1MKWH 1ZMJA 5J4QA 1Z6JH 3FP6E 5T3HA 1ANDA 5A0CA 1G32B 5DGJA 3KQEA 5A8YA 3T2NA 2ODPA 4IBLH 2GMTB 2YNAA 3RXQA 2XW9A 4BANB 2LPRA 2ZFRH 4XBBA 1C9PA 3E6PH 3MI4A 3MNXA 2FS8A 1UCYH 3LGWA 2GDDA 5L30H 3SJ9A 1BTYA 3A8AA 1O3IA 1T8OA 1ZHPA 2JH5D 3CS0A 1O2PA 1C2FA 3LH1A 4E06H 3A83A 4I8KA 3SU5A 5L6NH 1AGJA 2Z6BD 1SC8U 1CA0C 1BCUH 4JZIA 1DPOA 2FOHA 2BD4A 5C67A 3NK8A 4ISIH 2RG3A 1E34B 1HAOH 2FDAA 4AB8A 1DM4B 3LGUA 1JRTA 3ZVCA 3H7OA 5ABWA 1XUIA 1ZSJA 3VB5A 2CF9H 1ZSKA 4OS6A 2AERH 2B0FA 1ZR0A 1GBDA 1GHYH 5AVDA 1QGFA 1TPAE 3T25A 1THPB 4BXSA 1BTHH 3EDXB 1KDQB 2VWLA 4FVDA 4J1YA 1LHFH 3LT3A 1G2MA 1DWCH 2BDHA 1HYLA 1NFXA 1F0UA 2PHBA 1SR5C 1YCPH 1O38A 3QX5H 1SSXA 4OS7A 1A5GH 1PQ5A 5DK1A 3GY6A 1V2QT 1TGTA 3LC3A 4K8BA 1OP8A 1OWJA 1EQ9A 1SGNE 1NC6A 2PW8H 3M36A 1D3QB 2P93A 4ABJA 1P04A 1O2ZA 3RLYH 1QQUA 1UK2A 1A5HA 1E38B 5LH8A 3SU1A 4X6MA 2ZTXA 1GBEA 1MU6B 1QJ7B 5DP4A 1PYTD 3SUEA 1EAWA 2J2UA 3GY2A 2XC5A 1EPTA 1CT2E 1BBRK 1HIAA 1O3BA 2V3OH 1H4WA 2P59A 2VVCA 3AAVA 2AS9A 5EW2H 1F2SE 1VR1H 4HZHA 1C5ZB 1MKXK 3AAUA 5G4BA 5A8XA 1ELCA 1F92A 1EAUA 2B9LA 3SGQE 1IQEA 1TAWA 3Q77A 1RIWB 4HFPB 1C1MA 2H9TH 2VWMA 2VH0A 1EATA 1ZPBA 5IDKA 2FOAA 3ATMA 1Z71A 1SQTA 3MO6A 1RRKA 1TPPA 2FODA 5JBAS 1TRMA 1JXPA 2ZTYA 4OS2A 1EZXC 5JBTA 1TNJA 1GCTC 2B5TB 3U8OH 1AKSA 2C4FH 2BY5X 4BAQB 2ZU1A 4DT7B 1EOLA 1FAKH 5GCHF 3T26A 1P03A 1P12E 5TJXA 1A46H 3A82A 3ZVEA 1PPEE 1VITH 1L4ZA 5CHAB 2BDGA 1K21H 1UK4A 1BMNH 2ZCLP 2C3SA 2Q6FA 3K6ZA 1FLEE 2UWPA 2ZG0H 1P06A 4MPXA 3A8DA 1C5UA 1JIMA 4DJZB 1E0FD 2VIOA 4H6TA 7GCHG 2HALA 5EPNA 1GPZA 1PJPA 1PPBH 4CRFA 2FYRA 3STIA 5I25A 1ZGVA 1IQKA 1O5FH 1W8BH 2FOCA 1TGCA 3E3TA 3M3VA 3QZQA 3NZIA 5L2YH 1C5WB 1MAYA 2BD8A 3TPIZ 1VCPA 2G8TA 1GMCG 1GL0E 1DLKB 4JMYA 1E35B 4YTAA 1MKXH 1O2HA 3PO1C 2ZO3H 1D4PB 2C8WB 3RXRA 4ABAA 1T31A 2OXSA 3LJJA 3OYPA 2EA3A 1GMCF 4QT8C 2V3HH 2WUBA 2PUQH 1EJNA 1EB2A 4B76A 4J2YB 1GI4A 2ZQ1A 1C2GA 3A7VA 3MH7A 1ZHMA 1TPOA 1YCPM 5C5NA 1QBNA 3RDZA 2BDCA 4YM9A 4DURA 1C1OA 1GG6B 1NESE 2TGDA 1YPGH 1DS2E 4X2XA 1AIXH 1MTSA 2TGTA 3FZZA 1FDPA 3LOXA 2Y6TA 1JIRA 1KTSB 1AWHB 2FX6A 3AASA 1CVWH 1V2TT 1GL1A 3ZV9A 2BLVA 1QJ6B 4ZHAA 1O34A 2O9QA 1GHZA 1SB1H 4H42U 1O2MA 3DFJA 1LHGH 1O5GH 2PFEA 2ZNKH 3MHWU 1ZRBA 2THFB 3GICB 2B7DH 3SGAE 1FY3A 4FUIA 1AB9C 1BJVA 2O8UA 1WV7H 2W5EA 4B2BA 4Y79A 1A1RA 1A0JA 4XBDA 2UWOA 1LDTT 5GCHG 1AD8H 1T4UH 1IQLA 1OWHA 1C5YB 1QL8A 2WV5A 4GAWA 3LJOA 4GUXA 3UUZA 2ZDKA 3OY6U 3FZDA 2CXVA 9LPRA 2H9HA 4SGAE 5GJ4B 1O30A 1S6HA 3LIWA 3LU9B 2DE8A 3TK9A 5JDUB 1QA0A 2FESH 4GHQA 1BB0B 5DPAA 3ZZ3A 5F6MA 1AE5A 3TIUA 4R0IA 1RTFB 3BTDE 1J8AA 1W3CA 7ESTE 4X2WA 2EI8A 2J95A 3FVFB 2ZGCA 1P11E 2R9PA 1C5XB 1EPTC 3SU2A 5A2MH 1TA2A 1O2RA 2H2ZA 4NCYA 1S6FA 1L2EA 3SZNA 1VCWA 1W11U 4TYDA 1XUKA 2A7JA 1TPSA 4KELA 1C5NH 1BDAA 3A80A 2AGEX 3RC5A 1GJ6A 4NZQA 1DWDH 1UTPA 2WYJA 6CHAC 5F8ZA 3A84A 4WWYA 1GI2A 1YPLH 1NO9H 2ZHEH 4FVBA 2Z9KA 1IQJA 3SI3H 1SGEE 3O8DA 4JZEH 1BRCE 3SV8A 1GI0A 4XFQA 2PTCE 2WPIS 2Y5FA 3RC6A 3PO1B 3TVJB 1ESBA 2PUXB 3UQOA 1VITG 1O37A 2QV1A 5EXLA 4MDSA 1F0SA 3GCNA 1GGDC 5E0GA 3VB7A 1FY4A 3RU4D 4NA8A 1P2JA 5A8ZA 3SUFA 3VXEH 1BUIA 1IQNA 4JYVH 4F4OC 4NWLA 2YOLA 2F9BH 5HYOA 5E0JA 3EE0B 2BXUH 3LPRA 1TGSZ 1MAXA 2VINA 3ATWA 2HVXA 4E05H 2AMPA 1FY5A 1DVAH 1DUEA 2STAE 3B8JA 1O2TA 3OX7U 4CR9A 1GVLA 1TNHA 2NU4E 3U9AH 4CBNA 2ZEBA 4X2VA 4XE4A 1G9IE 3O8BA 3RXCA 1FN6A 1K22H 1KIGH 1TA6A 4M7GA 1O3MA 1UCYE 3ZZ4A 4ASHA 2BY7X 4HI3A 1V6DA 2A4RA 3VXFH 3P8OA 1ABJH 3KGPA 3RU4E 3GDVA 4X6NA 2OP9A 1GMDF 1C5VA 1BRAA 4BAMB 1NRRH 2D8WA 3PLKA 4LZ1H 1K1MA 4O3TA 4TWYA 1FPCH 2YNBA 4GHTA 2RA3A 1CBWC 4ABIA 3Q3XA 4UDWH 3M61U 2NWNA 1MCTA 4WMFA 2A7CA 1UTLM 2A5IA 2VU8E 5FXLA 2FXRA 2BDYA 4OS4A 5A0AE 1Y5BT 1Y5UT 4K1SA 4BTTB 1V2OT 1TMBH 2Z3CA 1W2KH 1HAXB 3LGTA 2VVVA 1JOUB 2BOKA 2ZCHP 3Q3KA 5LPFA 1YM0A 1NFWA 1TNGA 1K28D 3HATH 4CRGA 3RXSA 3URDA 1G36A 2LNCA 4FUJA 3MO3A 2XYAA 2PWXA 5JBCS 5DP9A 3SI4H 2H1UA 4FUCA 1EUFA 5C1XA 1SGQE 1O2YA 3GDSA 1BMMH 1C2KA 4IC6A 4TPYA 2A4QA 3PM3A 1RFNA 3LONA 3MU0A 1ANEA 1HFDA 6CHAB 1AKSB 1P02A 1TE0A 4XOJA 2FOFA 2F9NA 3UWJH 2ANKH 4YZUA 1S0RA 2ULLA 1O2SA 1PPHE 1ZZZA 1Q31A 1SLUB 3EQ0H 5EGMA 3UREA 8GCHG 1TIOA 1NZQH 3DD2H 4YOIA 4ABHA 4A92A 4Y0YE 3CP7A 4WH8A 2BQ7B 4IN1A 1QHRB 5C1YA 1ZMLA 1YBWA 2GD4B 4U32A 3OSYA 2BM2A 1BHXF 1Z8RA 4Z0KA 1AHTH 3PTNA 2PTNA 1O5BB 4UD9H 4D8NA 2NU1E 5JBBS 2GGVB 3GOVB 1UO6A 2VJ1A 2P8OC 1QB1A 1QCPA 2A1DB 4FUHA 2XBXA 2ZPSA 1GHBF 2A4GA 1W14U 4LZ4B 1C5PA 3UWIA 7LPRA 1SGFA 2OC1A 1XVOA 3S7HB 2FTMA 2G81E 2BVSH 1ARCA 1UHBA 1GJBB 3BG8A 3MH6A 3GY3A 3VGCB 2AYWA 4U01A 3R3GB 2WPJS 2FI3E 5DP5A
chains in the Genus database with same CATH superfamily
1H1BA 7KMEH 1TMTH 1P9SA 1TBZH 3T7LA 2CHAC 3TGKE 2PKAA 3UB0A 3VG8A 1CGIE 2EY4C 3GCHC 3RXBA 3BTHE 1LKAA 1O3CA 4I8JA 1WSSH 2ZDAH 1TX6A 1PPCE 2F9UA 2PSYA 1HLTH 3SOSA 2JH0D 2V0BA 5EOKA 4GB0A 1RTLA 1V2VT 1SLXB 5K0HA 1ESAA 4YT7H 3ZVYA 2ZI2H 3M7UA 5C11A 4AGKA 1GHAG 4F1PA 5LKUA 3L33A 1SGTA 3TJNA 1WQSA 2Z9IA 1P01A 2F9VA 3KCGH 1A5IA 4CH2B 1TB6H 3UPEA 1O3DA 3C27B 4K2YA 4WH6A 1RS0A 2TPIZ 3P95A 1WTGH 1GHAF 4IW4E 5F8TA 1S85A 1XUHA 1KXFA 4NG9H 3RP2A 4H4FA 1ESTA 4F48B 2ZZUH 1VJAU 3BEIB 2EC9H 1MM3A 2G55A 2ZDLA 4AFSA 2QIQA 2ZECA 1C5TA 4IC5A 3ATIA 3V12A 3HTKC 5FPSA 1BTWA 4ZHMU 2XBVA 1W12U 1RTKA 3P8GA 2FI4E 2A32A 4ISHH 1QTFA 1CHOG 2PV9B 5B6LA 3R0FA 1CA8B 1MTWA 4MPVA 5B78A 1AN1E 4Y6DA 4YT6H 3L11A 3SV2H 2QYIA 1O32A 5K7RA 4A6LA 3TLOA 1A0LA 4MTBA 1LKBA 4X3GA 5A09A 1C2LA 2L6OA 2JETC 1CHOF 2HWLB 1SMFE 2XBWA 2BD5A 1J16A 2PUYA 3VK6A 2PKSB 2O8MA 1YPEH 2J9NA 3WWBA 1YC0A 3T27A 2L7PA 1YY3A 3BTEE 1P9UA 4YLUA 3RTRB 3NKKA 1OWKA 1K0HA 4MQAA 1OP0A 2W26A 1AWFH 4UP5A 4WZ0A 2CV3A 4IN2A 1KXCA 2J98B 1VZQH 3SJKA 4D7GA 4O3UA 4IMZA 4AP4A 1TQ0B 5DG6A 2VPDA 4NFFA 1WILA 2BXTH 4JZ1A 2GDEH 3U28C 2VPGA 1RJXB 4XSKU 3U69H 1CU1A 1AE8H 5EG4A 2YMSD 5TDWA 1EXFA 1P57B 4I8HA 1EP6A 2YURA 1BT7A 2OBQA 3E90B 2KWJA 3KEEA 1F0TA 1TGBA 1MKWK 1H9LB 5EQSA 3ZYDA 1INCA 4BHWA 2QA9E 1ELAA 1A4WH 3SU6A 3RM2H 2KWNA 2ZGJA 1ZMNA 1ABIH 5IYTA 2PSXA 3SQEE 1T8LA 2W7UA 2W6ID 4WJG2 2AIPA 3FKSD 3FN8A 1V3XA 1Y59T 5B8DA 1E36B 2ZHQH 4I86A 3ZZBA 2GV7A 3GCTF 3ZVAA 2ZCKP 3EB5A 1E1QD 1NTPA 1MBMA 5DP7A 5FAHA 4B6EA 1K9OE 2Q1JA 2GCTC 3SNBA 3Q76A 4WVPE 3EYDA 2BY9X 1GBLA 2IOTA 2EODA 3PMJA 2B8OH 3MH5A 1RXPA 1WEUA 1P2OA 3OTJE 4FK5A 3ZYQA 1O2KA 2Y5GA 4K1EA 1HAVB 2TBSA 2MT5A 1AI8H 4AG1A 1WXRA 4B1TA 5JG6A 2F83A 3KV6A 3AVZA 1KXAA 1E4UA 1QZ8A 1O2XA 2CK3D 1VFYA 1MZAA 1EOJA 2CGAA 1DE7H 1SGDE 2ZHWH 1LDJB 1TOCB 3MNBA 4ZCNA 3F0OA 5GNDA 5G05B 2W3IA 3ZYEA 2FOBA 1WAYB 1BOQA 3GCTG 1A0HB 1OKXA 3M5LA 2OK5A 2P94A 4KP0A 2FIRH 4GNFA 3W95A 1D6RA 1QRZA 2ANWA 2BX3A 1EX3A 3UR9A 1FY8E 1C5RA 4Y10E 4PPEA 3GYLB 3ELAH 3F9EA 5FCRA 3SNAA 2EGPA 4MVNA 4GCHF 2ZU2A 2E6SA 2YREA 1YPHC 1P3EA 4A7IB 1AMHA 3LQIA 2BY6X 2CHAB 1OOKB 1Z1IA 1Z8GA 3LC5A 1SGPE 2WZQA 1W7XH 3KNVA 4B75A 1UW7A 1FQ3A 2SGAA 2Y7ZA 2L74A 1Y5AT 2QGRA 1D9IA 3BN9A 2BQWB 1EZSC 1RIWC 3MQKC 1OS8A 1P0SH 2TRMA 2MIQA 1PPFE 5BPEA 1O5DH 1OYQA 2GCHF 2ZFPH 2ECGA 1L1GA 3SU3A 1BRBE 1ELTA 1F5KU 3B23B 5EU8A 2BLQA 1HJ9A 1J9CH 2OTVA 1XUFA 1L4DA 1K1JA 1KLTA 1HGTH 3RXLA 1IAUA 2KGIA 1W0JD 4DCDA 2YQMA 1Y3XA 2L0BA 1QIXB 2CF8H 2ZGXH 1ACBE 1EFRD 3AW0A 1A7SA 5E8EH 4WF8A 3ZZ6A 2ZDNA 1TONA 1D6WA 2J4IA 2G5NA 2NU2E 3A7WA 6GCHF 4L58A 1GHWH 1VYXA 2XOYA 3GYMA 1O2IA 2DUCA 3RXAA 3C1KA 1WYKA 4GPGA 2FZZA 1GCDA 3FFGA 4K8YA 2TIOA 3UIRA 4B2CA 4NN2A 2GCHG 2SNWA 4B73A 5H1TA 3ZZAA 7GCHF 1P05A 2F6JA 4WZ2A 1OHHD 3NG2A 1TX8A 2A31A 2HYED 1O2JA 2R3YA 1O3OA 4LK9A 1GJ5H 2VPBA 2VGCB 1AUTC 4X6OA 4WZ3B 1PQ7A 1P3CA 3TH3H 3E16B 3RC4A 3T29A 3VFEA 2HGTH 1ZLRA 1SFIA 1N1LA 3ZPV1 2KCPA 1C4Y2 1W0YH 1O3HA 3NWUA 2VP7A 1GBKA 1BRUP 1N6XA 3P70B 3PV4A 5LKZA 1D3DB 2QN5T 1O2GH 4B74A 4Z0OA 4JK6A 2L80A 1T7CA 4F52B 1EP5A 1YF4A 1C9TA 1O36A 2A2QH 2WPHS 1H9IE 3V3MA 5CE1A 2YHOA 5JB8S 3MO9A 2PNXA 3RXPA 1AFEH 2PGQB 3O36A 1QB9A 2NAAA 2YHNA 1LVMA 1ELVA 2FX4A 5D1MB 1QL7A 2K1QA 4D9RA 5AF9H 1ELFA 4LJNA 4DY7B 1DSUA 3EE7A 3FANA 2ECJA 1SHYA 3T28A 2VBCA 1HJ8A 1TMUH 1MABB 2DE9A 5C1UA 2VWOA 3TJUA 3BTQE 3S0NA 1HJAC 4Q6FA 2MA6A 2QXIA 2EQNA 1SPJA 2BD9A 4I8GA 1JBUH 4Y8YA 3SO3A 2Y82A 2ZGHA 1G37A 1GI5A 1RGQA 3A7TA 1TNLA 1ZYOA 4Y7BA 2ZP0H 4OGYA 3ZVFA 3LQJA 4WA6A 3A87A 2ZQ2A 3JZ2B 5C20A 1Y3UA 1XX9A 1O3KA 5JB9S 1J15A 4JCNA 2FO9A 1GCTB 5HMAA 4DIHH 4QF3A 4NIVA 4NIYA 1BBRH 1A2CH 2KIZA 1PYTC 1WBGB 5LKTA 4NGAH 3OEED 3MNCA 3KQDA 3SNEA 4AC9A 1SLWB 2P3TB 3O8CA 3T9KA 3A86A 1Z2QA 4F49A 4CHAC 1U6QA 4W4UA 2VB0A 1P8VC 2XTTB 1C1QA 2RDEA 1MD8A 1QRWA 3FO8D 1X7AC 1VCQA 2LGKA 1DWBH 3ODDA 4Y8XA 2FTLE 4GLYA 5EXMA 2LP6A 5HM2A 2GT7A 1QJ1B 4FU9A 4E7RG 3LJUX 4XI1A 2KAIA 2VJEA 2FM2A 4ZDTA 1XMNB 2I6SA 4LKAA 3ZVBA 4B7YC 3KNXA 2P95A 3B9FH 2A2XH 4I8LA 4ISLA 3TJOA 3RXMA 1NROH 5IK2D 1NFUA 1GJCB 1T4VH 4O03A 3UNRA 4ZMAH 4AFQA 3LVQE 3SHAH 1FPHH 3ZZDA 2ZETC 3A7ZA 3MDBC 1O2QA 2P3UB 1MTVA 2WUCA 3ZZ5A 5SVIB 1AB9B 2A5KA 3D65E 4D76A 1Z7KA 3HGNA 3S69A 2YSMA 3DSGA 1O2OA 2VPEA 1V2JT 4Q7ZA 2AMDA 5DO4H 3RXGA 1COWD 5A0BA 1X4UA 4FU8A 4AGJA 3SW2B 3MTYA 3ZV8A 2V6NA 1GI9B 1MTNB 4NFEA 4Q2KA 3U1JB 2D26C 4FUEA 1XKAC 2Z9GA 3M5MA 5H1VA 2M85A 3EA7A 1S83A 1MTUA 2QE7D 1LMWB 1TBRH 3TJVA 3MH4A 2JMDA 5T6GA 5KGOA 8LPRA 1HUTH 1T8MA 5FCKA 1HRTH 2XEUA 5DINA 2RFKC 1FONA 1TNKA 4F55A 1GGDB 1ELBA 5DN6D 4UFFH 2QIZA 1W0ZU 4MPUA 1A3BH 3RMMH 2D2DA 4Y8ZA 4GVUA 1AFQB 4Y7AA 2A5AA 1SQOA 4CR5A 3PLPA 1FY1A 4IS5A 3SUGA 2BDAA 2CN0H 1C1UH 4A1VA 2G43A 1GMHF 2VIPA 3QTOH 1GBFA 9ESTA 5J4SA 3A7YA 3C6WA 1K1OA 2K1JA 3U98H 4I7DA 4Y76A 3GY5A 1MBQA 2A7HA 1QFKH 3HKIB 1YLCA 2ZWLH 3FAOA 4CRDA 2M3HA 5FB0A 1K1NA 3M5OA 1AO5A 2QY0B 1SQAA 1WEPA 2UUKB 1NY22 1SI5H 1V2PT 1D3PB 2AH4X 1O3GA 1Z1JA 5T6DA 4AN7A 1AZZA 1F7ZA 2QAAA 1MU8B 4XBCA 3LH3A 4H9DA 3WWFA 1AUJA 4Y71A 3RXHA 5J3XA 1JWTA 1WGMA 2LXHC 3PTBA 1OWIA 1SGFG 4ISNA 2M2AA 2P57A 1TYNA 1THRH 4Q7XA 4AZ2B 4LXBH 3GCOA 4UFEH 4R8TB 1XXFA 5SVIA 3SJIA 1YGCH 3AW1A 1TGNA 3M7TA 1UTQA 1WOFA 4A0CD 3GV4A 3BTME 3V13A 1DSTA 1HNEE 1PQAA 2ECVA 2JIZD 1O5AB 1GI6A 4K3JA 2OC8A 1XWHA 3TH2H 1V2MT 3HK6B 2QXHA 3O8RA 3A88A 3LRQA 5FBEA 2AGGX 1IQHA 4CHAB 2P16A 4JZDH 4X1NU 3U5OA 3DUXH 3URCA 6ESTA 2AN6A 2PR3A 1K2I1 3U8TH 3H5CB 2YW8A 2BD7A 1A61H 1TRNA 2J98A 4SGBE 3T6RA 2UWLA 3D49H 2NU0E 2YVRA 1BTXA 1ZRKA 2FPZA 1IOEA 1THSH 3S7KB 1ORFA 1HJAB 1CGJE 1O31A 1LO6A 1WEMA 4I32A 4ABGA 1GVKB 5T6FA 2STBE 2ZPRA 3ODFA 2VH6A 4BTUB 1XUJA 4NA9H 3SV9A 2F6NA 1UVSH 4JYTA 5TDRA 3TU7H 4U2WA 2ALVA 1IQFA 1AU8A 2VGCC 4YO9A 2QXJA 1DT2A 4V3KC 1O2UA 4NA7A 1YPJH 1ZPZA 4A1TA 1DY8A 3SU0A 1E37B 1IHSH 1KSNA 4NWKA 1B7XB 1S84A 3ZVZB 4R2YA 3MU5A 2AGIX 3A89A 1KLJH 3MU8A 1EAIA 1NBMD 2R2MB 4DT4A 1BHXB 3MU4A 4ESTE 4DG4A 4ABFA 1G2LA 1H9HE 1ZTKA 3IG6B 1CBWB 1TBQH 2XCFA 1GI7B 2XP0A 2K8IA 5CHBA 2WV9A 1GBHA 1BMLA 4KGAA 1P2QA 2ZDMA 3E1XB 2K17A 3QZVA 3GY4A 5G0FA 2G00A 2H0DA 5FPTA 1ZOMA 1UVTH 1CQQA 1O2LA 4Z6AH 3DDTA 4FXGH 4RT0A 5B76A 5FX6A 1BMAA 3EA8A 1Z6EA 8KME2 1BTPA 1O2NA 2OQ5A 2CMYA 1MQ5A 1Y3YA 3PLBA 5BRRE 4X6PA 2R0KA 2WINI 2CRWA 3TK6A 1MMJN 2XNDD 2CRRA 4YOJA 3EB6A 1DLEA 1BQYA 2PP6A 3F68H 3DQVR 3BIUH 4GNEA 2AIQA 2Z9JA 3WY8A 1Q3XA 1HYIA 3SV6A 3W1EA 2Q6GA 2VVUA 1AVWA 5C0UA 1O3LA 5EIYA 4X8UH 3Q1DA 4WMEA 2A4OA 2H5DA 3CENA 2W7SA 2ZPQA 4Y11E 1QR3E 1YPKH 2Z3DA 5EJZA 1HV7A 1NRSH 2ZHDA 1KTTB 1GBCA 1CO7E 1E79D 2OBOA 3KQ5A 4JK5A 4WMDA 4GNDA 3SOWA 5TABA 1V2UT 5JYIA 4C9ZA 4X1RU 2Y81A 3OE7D 3BTWE 3BG4B 2JRJA 2KFWA 2J92A 4Y0ZE 2FP7B 3RXTA 2ILNA 2FLRH 2PLXA 1GDUA 1FAXA 1GDNA 1K2FA 1OXGA 1KDQA 1CSOE 3IWMA 4NIXA 1GBMA 2EI6A 1MUEB 2HLCA 1WU1A 2G5VA 3QLPH 1NM6A 1FI8A 1G3BA 4ZUXU 1DWEH 1S82A 3MFJA 2J97A 3QUMP 3A81A 2BHGA 3VB3A 3TH4H 2FMJA 2ZFFH 5EJLA 6LPRA 3FJUB 1UJ1A 1C5MD 2MD8C 4D9QA 3SNCA 5SVXA 1AQ7A 2XRCA 4QF2A 2HRVA 1LPGB 2AMQA 1Q2WA 3KQBA 1FMGA 4U30A 3I29A 3N9PA 1BIOA 3V0XA 1S5SA 2F9OA 3I2DA 4DGJA 1SLVB 2VWNA 4MNVA 1H8DH 4YC9A 3QGJA 4K69A 5TCCA 3HPTB 1DVPA 1C2HA 1DOJA 2F9PA 2FI5E 2ZKSA 3D62A 4I33A 3MOCA 5GDSH 2BTCE 1C5SA 1XKBC 5B79A 1V2KT 1UTKA 1G3EA 5EW1H 1XXDA 3UNQA 2BY8X 2SGFE 1W7GH 2G45A 3S9AA 4ZXYH 1QB6A 3O33A 4ABBA 1Y3WA 2ZFTA 1C1VH 1SGYE 1HAGE 2UUJB 2D1JA 2L43A 1HAPH 2VNTA 1LVOA 2C8YB 1W10U 5LPRA 5DKMA 2OXQC 1CA0B 5LPEA 4M9FA 2Q6DA 2G52A 1FUJA 2AFQB 1K1PA 2F91A 5ESBA 4NIWA 4FUGA 1QBOA 1L1JA 2ZU4A 1QQ4A 1TWXB 1WENA 2O8WA 4I7YH 1ZTLA 4LK4A 3NXPA 5FHTA 1OX1A 1LHEH 2C8XB 2Z94A 2UUYA 3QDZB 3QWCH 4CCGX 3OU0A 2J94A 1KYNA 2FOGA 3E91A 5I46H 3JZ1B 1OWDA 2WPMS 5CMXH 5TRBA 2GZ9A 3ZZ9A 4A1XA 4FU7A 1IHTH 2R2WU 1C1TA 1OWEA 1LHDH 2OQUA 2LXPC 3N7DA 1O33A 3TNSA 3F9HA 2XBYA 1C5LH 4ISOA 1LPKB 4RN6A 3U1IB 4Q80A 4UEHH 4AORA 5FL7D 2ZA5A 2AEIH 2ECTA 3SNDA 3L3TA 3A7XA 3GDUA 2LELA 3O37A 1ARBA 4TSFD 5AHGH 1HYJA 1EB1H 3D23A 1B0EA 1NS3A 1UVOA 5TCAA 3SUDA 3HKJB 3QZRA 1HPGA 4AX9H 3GL6A 5KH9A 2KZ4A 1VITF 2H6MA 5G04B 1PPZA 2GT8A 4D7FA 2VIWA 5FBIA 2TGPZ 2LQ6A 4KTCA 1HAVA 5E2OA 3FP8E 4Z0RA 2VJFA 2PKAB 2RDLA 4UONA 1OSSA 5H9MA 5E0HA 1YLDA 4ABDA 4H6SB 1P2IA 2C93B 2QXGA 2ZF0H 2FSAA 3F2FA 5B6OA 5C13A 3M5NA 5D1KB 2Y5HA 3E0NB 1BZXE 1WUNH 2J34A 3TK5A 1OPHB 1W13U 2ZC9H 2BVXH 5KEDA 2KR4A 4K1TA 3VEQB 2SGDE 3HGPA 4XDEA 1QY6A 1SQRA 2JETB 4HG6A 3DA9B 3QK1A 3OY5U 3ESTA 3SQHE 3SJ8A 3SGBE 1LPZB 2B0OE 1V2RT 3UNSA 1QA7A 3ZVDA 3HCSA 4K60A 1P2MA 5DP8A 5HGGA 4ASUD 3MMGA 3U5MA 3P6ZB 1P09A 3GCHB 2BD3A 4NZLA 2ZU3A 4YOGA 4ZKOU 1JRSA 4MPWA 5EODA 2ECNA 4CREA 2YU4A 3MU1A 1WIMA 4XRNA 4ZKNU 4PROA 2D8UA 1AVGH 1BBRE 2GZ7A 4X1PU 3P8NA 4BOHA 4X1QU 3MHSA 1BITA 1ETRH 2ODQA 3NUMA 4FO9A 5DKAA 2JMIA 3LKWA 3DPLR 5JPMH 3RLWH 1VKYA 1UK3A 3RPGC 4BBQA 1O3EA 4A4CA 3FM8C 3KYGA 4RSPA 3NPSA 2G51A 5FX5A 1Y8TA 2Z3EA 2G6QA 2ZGBH 2C90B 3A85A 1HAYB 5AFZH 1C1NA 5EPYA 3MWIU 2OC0A 1GJAB 3RXVA 2RSDA 4B2AA 3FP7E 4B86C 1G3CA 1X4IA 5EYAF 5ETXA 2RCEA 1UTMA 3TGJE 2BLOA 2I6QA 4OS1A 1GDQA 3KQIA 4LADB 4DIIH 4XD7D 3BTFE 4YAXA 1N6YA 3OFND 4WXIA 1C2EA 3BSQA 4LOYH 3PWCA 2FOMB 1VJ9U 2ZU5A 1DXPA 1MCVA 3KF2A 1KXDA 5GPIB 3RUOA 4WY3A 2CJIA 1TFXA 1XVMA 1UTOA 2VIQA 3SORA 2FUIA 2DX8A 3LGIA 4YLQH 4AFUA 1FV9A 2QF0A 1UMAH 5LKXA 1HB0B 2CKLA 2XOCA 1O0DH 1EAXA 1SFQB 1TALA 1EJAA 2H9EH 2WPDD 1QL9A 3L6PA 2K4DA 4YBSA 2EI7A 3UY9A 2E6RA 2KAIB 3N9OA 1HDTH 1O3FA 1GJ9B 3ATLA 3TITA 2D8SA 4AB9A 3EA9A 4BAKB 2K0QA 1NU7B 2C8ZB 2OINA 2HPPH 4CRAA 4X1SU 3IITA 2XWAA 5DJ7A 3TGIE 1ZTJA 3QN7A 2BMGB 2W3KA 4ZKRU 2XCNA 3BG4C 1WEEA 3KQCA 1ZHRA 3K2UA 3M3TA 5AIUA 1GI8B 4B6FA 1UCYK 2BYAX 4X8VH 1SG8B 3PUQA 2UUFB 2FEQH 2FWWA 2R0LA 2IN2A 2V3MA 3RMLH 1B0FA 1LVYA 1W0KD 4UE7H 4A49A 4TY6A 1GBBA 1HIAB 1EPTB 4Q7YA 1GI3A 2LGLA 3VPKA 1VGCC 3OTPA 1FX0B 1PPGE 4X0WU 3NRLA 3SHCH 3BEFB 1PQ8A 3SBKA 3L1ZB 3I77A 2OWAA 2JH6D 4GSOA 2YMSC 3SYJA 5H4IB 1N8OB 2KGGA 5F8XA 1SGCA 1KLIH 1UTJA 1GWAA 1SOZA 2OUAA 3I78A 4CH8B 1TLDA 3UR6A 1WTHD 2ZHFH 5LCWB 2OC7A 3Q00A 2JKHA 4ABEA 5C0TA 4VGCB 1SGIB 2H5CA 3DT0H 2XWBI 1IYMA 1M9UA 1HCGA 1H8HD 3SV7A 4X8SH 1NFYA 4DOQA 2TGAA 1O2VA 1FIWA 3KYFA 1SVPA 4HTCH 1DY9A 2IPHA 4OS5A 1WE9A 1P2KA 3CS7A 3Q3YA 5FPYA 2GVFA 2WYGA 1YCPK 5GXPA 3F9GA 3N9LA 2G4TA 1AY6H 1C4V2 3LDYA 2HPQH 4CRBA 1BTUA 1O39A 3BF6H 1LCYA 1CE5A 4ZH8A 1TQ7B 2AHME 2BDBA 2Y1NA 4LLBA 1BA8B 2BX4A 3KHVA 4NSVA 2GTBA 3KIDU 5GIBA 3BTGE 4MNWA 2LDRA 1GBTA 1DICA 4AG2A 2MKEA 2BVRH 4UFDH 4DVAU 1NU9A 1XUGA 3PMHB 1C1RA 4FUFA 1V2ST 3ZZ7A 2KCYA 5SGAE 3PYHA 8GCHF 1G3DA 2EEKA 1QBVH 4YADA 1C1PA 1GMHG 3GY8A 5GWZA 3ITIA 4MNXA 3ZZ8A 3ENSB 1FNIA 1HBTH 1SHHB 3W94A 1WDIA 3M7QA 1O2WA 1C4U2 1DX5M 3UTUH 4ZAEA 3UOPA 1QNJA 3N7EA 4YATA 1YPHE 1LQDB 1DFPA 2C2VS 4Q63A 1GJ4H 2V35A 3QTVH 3O34A 3A8CA 5AFYH 3QGNB 1YWUA 1ZSLA 1NT1A 1MD7A 2E61A 4MG3A 2OLGA 1GHBG 1NRPH 1NRNH 1QRXA 4KKDA 1HAZB 4V3LC 1WQVH 5LGOA 1TABE 3F9FA 1EZQA 1LQEA 3RMNH 4KTUA 3M62A 1ELGA 4DW2U 1O3AA 1C1SA 3VB4A 3N7OA 1NRQH 1OYTH 1Y3VA 2KWOA 3UQVA 2A45B 3EGKH 3EAJA 2M5TA 1DITH 1V2WT 4THNH 3RU4T 3ZZCA 4RKOB 5EQRA 3KV5A 1GJDB 2ASUB 2O8TA 2KKXA 2ESTE 2GP9B 5E2PA 4RKJB 1EASA 1O5EH 1WEOA 5T1VA 5DP6A 2ZDVH 2GV6A 1AFQC 2SFAA 3ZVGA 4MNYA 2A0QB 3BIVH 2GZ8A 3SJOA 4FUBA 2OD3B 3PRBA 5C5OA 3K65B 3ATKA 1FXYA 1ID5H 3DWDA 3HCUA 1O35A 1GBIA 3NCLA 5PTPA 1PFXC 1TOMH 1O3JA 2BZ6H 2I50A 4YESB 1LTOA 5ESTE 2Y80A 4A5TS 1CGHA 2PGBB 1GBAA 1ELEE 3P8FA 2BQ6B 4IC3A 1H8IH 2L75A 2WV4A 2ODYB 3VGCC 4K5ZA 3RXDA 2LN0A 3UFAA 4PTBA 1J17T 3BV9B 4NSYA 2BDIA 1MTNC 1DDJA 4BAOB 2SGQE 1KXEA 4BTIB 4JYUH 2WPKS 2L5UA 1K1IA 1AZ8A 2XC0A 5FEYA 3M35A 5H1UA 1ELDE 3K6YA 1GVZA 3KN2A 1P2NA 3E0PB 2HOBA 5F53A 1O5CB 1YPMH 1EKBB 2P3FH 2P8OB 2Z7FE 3DFLA 5L2ZH 4UFGH 5KH3A 1F5RA 1ETSH 3GY7A 4ZKSU 4JZFH 1MH0A 4INHA 1VGCB 3PMAB 1ZGIA 3LGYA 2M13A 2IQJA 3BTTE 2BAYA 2UZGA 1HXFH 1SOTA 2BZAA 1GG6C 4KTSA 1Z60A 1L1NA 5F03A 1BJUA 2XC4A 5HM9A 3V43A 4O9VA 2VIDA 2FLBH 3N9NA 3F1SB 1BTZA 2BD2A 4AOQA 2YSJA 2O8LA 3KDEC 1V2LT 1MZDA 1JOCA 1T32A 3F2HA 2QC2A 3H7TA 2JM3A 4IGDA 1GI1A 1Z8JB 2QCYA 3RMOH 2ALPA 4AYVB 2G4UA 3M37A 4R8PK 4INKA 4L7XA 4X8TH 3P17H 1A3EH 3UOUA 1GHXH 2ZFSA 3F6UH 4ZHLU 3O47A 3V7TA 4CBOA 2F3CE 3UAIC 1WCZA 2QF3A 5EQQA 1UVUH 4Q4LA 2R3UA 4OGXA 3RXIA 4CRCA 2FOEA 1QURH 3STJA 2GMTC 1XM1A 2XXLA 4ZUHA 1ZJKA 4MLFB 5HXFA 2FUUA 1C2DA 1ETTH 1OP2A 1NPMA 1C2MA 3RXOA 2HNTE 4INLA 3GISB 2HVYB 2LAUA 2YYRA 1C5OH 3LDXH 1P10A 1LHCH 2ZTZA 5DP3A 3G01A 2CKLB 4FJCA 2F42A 4IMQA 4BNRA 2F4LA 1DANH 2GKVE 3ZNIA 1Z6UA 2OCVB 1C1WH 4ZXXH 4TKPB 4BAHB 2PKSC 4AVXA 3QO6A 1N87A 1ZPCA 2Y7XA 3P92A 3S9BA 1C2IA 3K9XB 4GNGA 1NN6A 2ZFQH 3DHKH 3S9CA 3OEHD 4AFZA 1TX7A 1V87A 2ANYA 3KL6A 1G25A 2HNTF 5K3QA 3T62A 3PWBA 1S81A 1G30B 1V2NT 2ANMH 5CHAC 3BTKE 3U5NA 1EZUC 4FUDA 1KXBA 3TNTA 1CT4E 3SU4A 1TNIA 2Z9LA 2BB4A 1FN8A 3A8BA 2FS9A 3RM0H 1N8OC 1F5LA 1LVBA 1JMOH 4X2YA 4CA1A 2KU3A 1ZJDA 4TY7A 2Y1MA 1K1LA 1D3TB 4MVTA 1BMFD 3RXFA 1GHVH 2ECWA 2RA0A 3L1XA 1DUAA 4WXVA 1JM7B 3PB1E 5EXNA 1UHBB 2SGPE 1KY9A 1GMDG 1CT0E 3VB6A 4VGCC 1O3NA 1J14A 1L0ZA 3E8LA 1GJ7B 1C2JA 3U8RH 3E2DA 2YQLA 3HCTA 3SN8A 1DXWA 2LV9A 2BLWA 2SGEE 1B5GH 1AVXA 1FZZA 4E7NA 3PMBB 3PROA 2EXUA 4GCHG 1YYY1 2WPLS 2GX4A 3BEUA 2CSVA 2J38A 4BXWA 1FIZA 3DSPA 2GCTB 4P00A 1YKTA 2SNVA 3HK3B 2BOHB 4ZROA 1UVPA 5C2ZA 1IQMA 1ANBA 4HGCA 4I31A 1C5QA 2K16A 3MNSA 1WEWA 2FYQA 3RXUA 4AYYB 1IQGA 1CHGA 1EJMA 1SGRE 1SL3A 3MYWA 1HAIH 4TPIZ 3RXKA 2HNTC 1ANCA 6GCHG 4OM9A 8ESTE 1UTNA 2VIVA 2XNIA 1HXEH 4B71A 2CT2A 1GBJA 1NBME 1HAHH 3RXJA 1MQ6A 3M3SA 1O3PB 1S0QA 2IJOB 2KR7A 2NU3E 3DCLA 3C5KA 1FJSA 1IQIA 1T8NA 1TRYA 1YP9A 2ZIQH 1Z8IB 4O97A 1RD3B 3U5PA 5C3NA 3N9MA 3T5FH 4TWWA 1SBWA 3H09A 1GJ8B 2DJAA 3ZIAD 1F0RA 3LGVA 3RXEA 1MKWH 1ZMJA 5J4QA 1Z6JH 3FP6E 5T3HA 1ANDA 3SUBA 5A0CA 1G32B 5DGJA 3KQEA 2IDAA 2KREA 5A8YA 3T2NA 2ODPA 3SHBA 4IBLH 2GMTB 2YNAA 1BORA 1T1HA 3RXQA 2XW9A 4ZQLA 4BANB 2LPRA 2ZFRH 4XBBA 1C9PA 3E6PH 3MI4A 3MNXA 2FS8A 1UCYH 3LGWA 2GDDA 2M1RA 5L30H 2WHXA 3SJ9A 1BTYA 3A8AA 4N3WA 1O3IA 1T8OA 1ZHPA 2JH5D 3CS0A 1O2PA 1C2FA 3LH1A 4E06H 3A83A 2HDPA 4I8KA 3SU5A 5L6NH 1AGJA 2Z6BD 1SC8U 1CA0C 1BCUH 4JZIA 1DPOA 2FOHA 2BD4A 5C67A 2CSYA 2W6JD 3NK8A 4ISIH 2RG3A 1E34B 4ACAA 1HAOH 2FDAA 4AB8A 1DM4B 3LGUA 1JRTA 3ZVCA 3H7OA 5ABWA 1XUIA 1ZSJA 4MSXA 3VB5A 2CF9H 1ZSKA 4OS6A 2AERH 2HLDD 2B0FA 1ZR0A 1GBDA 2KM0A 1GHYH 5AVDA 3ASLA 1QGFA 1TPAE 3T25A 1THPB 4BXSA 1BTHH 3EDXB 5TBNA 1KDQB 2VWLA 4FVDA 3H7HA 4J1YA 1LHFH 3LT3A 4YABA 1G2MA 1DWCH 2BDHA 1HYLA 1NFXA 1F0UA 2PHBA 1SR5C 1YCPH 1O38A 3QX5H 4FIPA 2IJD1 1SSXA 4OS7A 1A5GH 2XOZA 2ECIA 1PQ5A 5DK1A 3GY6A 1V2QT 1TGTA 3LC3A 2MA5A 2JJ2D 4K8BA 4I7BA 1OP8A 1OWJA 1EQ9A 1SGNE 1NC6A 2PW8H 3M36A 3GS9A 1D3QB 2P93A 2MNYA 4ABJA 1P04A 1WEQA 2MUMA 1O2ZA 5SVYA 4UI9B 3RLYH 3N9QA 1QQUA 1UK2A 1A5HA 1E38B 5LH8A 2VNFA 3SU1A 2H0DB 4X6MA 5KH7A 2ZTXA 1GBEA 2KWKA 2XB1A 1MU6B 1QJ7B 3F0PA 5DP4A 1PYTD 3SUEA 1EAWA 2J2UA 3GY2A 4RI0A 2XC5A 1RMDA 1EPTA 1CT2E 1BBRK 1HIAA 4FETA 1O3BA 5D1LB 2V3OH 1H4WA 2P59A 2VVCA 3AAVA 2AS9A 5I3LA 5EW2H 1F2SE 1VR1H 4HZHA 1C5ZB 1MKXK 3AAUA 5G4BA 5A8XA 1ELCA 1F92A 1EAUA 2B9LA 3SGQE 3LQHA 1IQEA 1TAWA 3Q77A 1RIWB 4HFPB 5HIZA 1C1MA 2H9TH 2QJ0A 2VWMA 3M7KA 2VH0A 4YBTA 1EATA 1ZPBA 5IDKA 2FOAA 3ATMA 1Z71A 1U6GB 1SQTA 3MO6A 1RRKA 1TPPA 2FODA 5JBAS 1TRMA 1JXPA 2ZTYA 4OS2A 1EZXC 5HIYA 5JBTA 1TNJA 1GCTC 2B5TB 3U8OH 3RPGB 1AKSA 2C4FH 2YT5A 2KFTA 2BY5X 4BAQB 2ZU1A 4DT7B 1EOLA 2MNZA 1FAKH 5GCHF 3T26A 1YLNA 3FOAA 1P03A 2WSSD 1P12E 1WESA 5TJXA 1A46H 3A82A 3ZVEA 1PPEE 1VITH 1L4ZA 5CHAB 2BDGA 2KKYA 5FB1A 1K21H 1UK4A 1BMNH 2ZCLP 2C3SA 2Q6FA 3K6ZA 1FLEE 2UWPA 2ZG0H 1P06A 4MPXA 3A8DA 1C5UA 1JIMA 4DJZB 1E0FD 2VIOA 4H6TA 7GCHG 2HALA 5EPNA 1E1RD 1GPZA 1PJPA 1PPBH 4CRFA 2FYRA 1MM2A 3STIA 5I25A 1ZGVA 1IQKA 2GJGA 1O5FH 1W8BH 2FOCA 1TGCA 3E3TA 3M3VA 3QZQA 4S3OB 3NZIA 5L2YH 1C5WB 1MAYA 3N99A 2BD8A 3TPIZ 1VCPA 2G8TA 1GMCG 3FL2A 1GL0E 2VJFB 1DLKB 4JMYA 1E35B 4YTAA 1MKXH 1O2HA 3PO1C 3M63A 2ZO3H 3O70A 1D4PB 2C8WB 3RXRA 4ABAA 3PV5A 1T31A 2OXSA 3LJJA 3OYPA 4R7EA 2EA3A 5C17A 1GMCF 4QT8C 2V3HH 2WUBA 2PUQH 1EJNA 1EB2A 4B76A 4J2YB 1GI4A 1JM7A 2ZQ1A 1C2GA 3A7VA 3MH7A 1ZHMA 1TPOA 1YCPM 5C5NA 1QBNA 3RDZA 2BDCA 3PV2A 4DURA 4YM9A 2QICA 1C1OA 1GG6B 1NESE 2TGDA 2CSZA 1YPGH 1DS2E 4X2XA 1AIXH 1MTSA 2TGTA 3FZZA 4FOUC 1FDPA 3LOXA 2Y6TA 1JIRA 1KTSB 1AWHB 2FX6A 3AASA 1CVWH 1V2TT 1GL1A 3ZV9A 2BLVA 1QJ6B 4P5OB 4ZHAA 1O34A 2O9QA 1GHZA 1SB1H 4H42U 4OGCA 1O2MA 3DFJA 3MHHA 1LHGH 1O5GH 2PFEA 2ZNKH 3MHWU 3ZPVE 1ZRBA 2THFB 3GICB 2B7DH 1S6LA 3SGAE 1FY3A 4FUIA 1AB9C 2LRIC 1BJVA 2O8UA 2MD7B 1WV7H 2W5EA 4B2BA 4Y79A 2LGGA 1A1RA 1A0JA 4XBDA 2UWOA 1LDTT 5GCHG 1AD8H 1T4UH 1IQLA 1OWHA 1C5YB 1QL8A 2WV5A 4GAWA 3LJOA 5DSFA 4GUXA 3UUZA 2CONA 2ZDKA 2EA6A 3OY6U 3FZDA 2CXVA 9LPRA 1LDKC 2M6MA 2H9HA 4SGAE 5GJ4B 1O30A 1S6HA 3LIWA 3LU9B 2DE8A 3TK9A 5JDUB 1QA0A 2FESH 4GHQA 1WFKA 1BB0B 5DPAA 4AYCB 3ZZ3A 5F6MA 1AE5A 3TIUA 3WW7A 4R0IA 1RTFB 3BTDE 1J8AA 1W3CA 7ESTE 4X2WA 2EI8A 2J95A 3FVFB 2ZGCA 1P11E 2R9PA 1C5XB 1EPTC 3SU2A 5A2MH 1TA2A 1O2RA 3PRDA 2EGMA 2H2ZA 4NCYA 1S6FA 1L2EA 3SZNA 1VCWA 1W11U 2J5UA 2YUCA 4TYDA 1XUKA 2A7JA 1TPSA 4KELA 1C5NH 1BDAA 3A80A 2AGEX 3RC5A 2IPQX 1GJ6A 2JUNA 4NZQA 5KECA 1DWDH 1UTPA 2WYJA 6CHAC 5F8ZA 1VD4A 3LVRE 3A84A 2VJEB 4WWYA 1GI2A 1YPLH 1NO9H 2ZHEH 4FVBA 5CDFE 2Z9KA 1IQJA 3SI3H 1SGEE 3O8DA 4JZEH 1BRCE 3SV8A 3PLWA 1GI0A 1ZBDB 4XFQA 2PTCE 2WPIS 3SOXA 2Y5FA 3RC6A 3PO1B 3TVJB 1ESBA 2PUXB 3UQOA 1VITG 1O37A 1H8ED 2QV1A 4RT1A 5EXLA 4MDSA 1F0SA 3PHDA 2KX4A 3GCNA 1GGDC 5E0GA 3AK5A 3VB7A 1FY4A 2KCOA 2Y43A 3RU4D 4NA8A 1P2JA 5A8ZA 3SUFA 3VXEH 1BUIA 5AITA 1IQNA 4JYVH 5B75A 2JJ1D 4F4OC 4NWLA 2YOLA 2F9BH 5HYOA 5E0JA 3EE0B 2BXUH 3LPRA 4IC2A 4ACBA 1TGSZ 1MAXA 2VINA 3ATWA 1FP0A 2HVXA 4E05H 4AUQB 2AMPA 1FY5A 1DVAH 1DUEA 2KCAA 2STAE 3F3BA 4TT3D 2QF5A 3B8JA 1O2TA 3OX7U 4CR9A 1GVLA 1TNHA 5B77A 2NU4E 3U9AH 4CBNA 2ZEBA 4X2VA 4XE4A 1G9IE 3O8BA 3RXCA 1FN6A 1CHCA 1WEVA 1K22H 1KIGH 1TA6A 4M7GA 4YBMA 1O3MA 1UCYE 3ZZ4A 4ASHA 2BY7X 2QF4A 3F2GA 1KMHB 4HI3A 1V6DA 2JDID 4QQ4A 2A4RA 5C94A 2V7QD 3P8OA 3VXFH 3O35A 1ABJH 3KGPA 3M99A 3RU4E 3GDVA 4X6NA 1F62A 2OP9A 1GMDF 1C5VA 3JUEA 1BRAA 4BAMB 1NRRH 2D8WA 3PLKA 4LZ1H 1K1MA 4O3TA 4TWYA 1FPCH 2YNBA 4GHTA 4P02A 2RA3A 1CBWC 4ABIA 3Q3XA 4UDWH 3M61U 2NWNA 1MCTA 4WMFA 4UP0A 2JMJA 2A7CA 1UTLM 2A5IA 2VU8E 5FXLA 2FXRA 2YMSB 2BDYA 4OS4A 5A0AE 1Y5BT 1Y5UT 4K1SA 4BTTB 1V2OT 3OAAD 2FFWA 1TMBH 2Z3CA 1W2KH 1HAXB 3ZTGA 3LGTA 2VVVA 1SKYE 1JOUB 2BOKA 2ZCHP 3Q3KA 5LPFA 1YM0A 1NFWA 1TNGA 1K28D 2KYUA 3HATH 4CRGA 3RXSA 3URDA 1G36A 2LNCA 4FUJA 1DCQA 2RR4A 3MO3A 2XYAA 2PWXA 5JBCS 5DP9A 3SI4H 2H1UA 4FUCA 1EUFA 5C1XA 4S3OC 1SGQE 1O2YA 3GDSA 1BMMH 4O62A 1C2KA 2KE1A 4IC6A 5HKKD 4TPYA 2A4QA 2RI7A 3PM3A 1RFNA 3LONA 3MU0A 1ANEA 1HFDA 6CHAB 1AKSB 1P02A 1TE0A 4XOJA 3SZEA 2FOFA 2XOKD 2F9NA 3SOUA 3UWJH 2ANKH 1FBVA 4YZUA 1S0RA 2ULLA 1O2SA 4Z1MD 1PPHE 1ZZZA 1Q31A 3O7AA 3PURA 1SLUB 3EQ0H 5EGMA 3UREA 8GCHG 1TIOA 1NZQH 3DD2H 4YOIA 4ABHA 4A92A 4Y0YE 3CP7A 4WH8A 2BQ7B 4A4BA 2DSMA 4IN1A 1QHRB 5C1YA 1ZMLA 2LGVA 1YBWA 2GD4B 5EJ1A 4U32A 3OSYA 2BM2A 1BHXF 1Z8RA 2F43B 4Z0KA 4AYCA 1AHTH 3PTNA 4I7CA 2PTNA 1O5BB 3FEHA 4UD9H 5FERA 4D8NA 2NU1E 5JBBS 2GGVB 3GOVB 1UO6A 2VJ1A 2P8OC 1QB1A 4O64A 1QCPA 2A1DB 4FUHA 2XBXA 3IHPA 2ZPSA 1GHBF 2A4GA 1W14U 4LZ4B 4N4FA 1C5PA 3UWIA 7LPRA 1SGFA 2C2LA 3DSOA 3CNRA 4YXWD 2OC1A 1XVOA 2FD4A 3S7HB 1X4JA 2FTMA 2G81E 2BVSH 1ARCA 1UHBA 1GJBB 3BG8A 3MH6A 3GY3A 3VGCB 2AYWA 4U01A 3R3GB 2WPJS 2FI3E 4OGEA 5DP5A
chains in the Genus database with same CATH topology
1H1BA 7KMEH 1TMTH 1P9SA 1TBZH 2CHAC 3TGKE 2PKAA 1CGIE 3GCHC 3RXBA 3BTHE 1LKAA 1O3CA 4I8JA 1WSSH 2ZDAH 1TX6A 1PPCE 2F9UA 2PSYA 1HLTH 3SOSA 2JH0D 2V0BA 5EOKA 1RTLA 1V2VT 1SLXB 5K0HA 1ESAA 4YT7H 2ZI2H 3M7UA 4AGKA 1GHAG 3L33A 1SGTA 3TJNA 1WQSA 2Z9IA 1P01A 2F9VA 3KCGH 1A5IA 4CH2B 1TB6H 3UPEA 1O3DA 3C27B 4K2YA 4WH6A 1RS0A 2TPIZ 3P95A 1WTGH 1GHAF 4IW4E 5F8TA 1S85A 1XUHA 1KXFA 4NG9H 3RP2A 4H4FA 1ESTA 2ZZUH 1VJAU 3BEIB 2EC9H 2G55A 2ZDLA 4AFSA 2QIQA 2ZECA 1C5TA 4IC5A 3ATIA 3V12A 5FPSA 1BTWA 4ZHMU 2XBVA 1W12U 1RTKA 3P8GA 2FI4E 2A32A 4ISHH 1QTFA 1CHOG 2PV9B 3R0FA 1CA8B 1MTWA 4MPVA 1AN1E 4Y6DA 4YT6H 3SV2H 2QYIA 1O32A 5K7RA 4A6LA 3TLOA 1A0LA 4MTBA 1LKBA 5A09A 1C2LA 2JETC 1CHOF 2HWLB 1SMFE 2XBWA 2BD5A 1J16A 2PKSB 2O8MA 1YPEH 2J9NA 1YC0A 3T27A 3BTEE 1P9UA 4YLUA 3NKKA 1OWKA 4MQAA 1OP0A 2W26A 1AWFH 2CV3A 4IN2A 1KXCA 1VZQH 3SJKA 4D7GA 4O3UA 4IMZA 1TQ0B 5DG6A 4NFFA 2BXTH 4JZ1A 2GDEH 1RJXB 4XSKU 3U69H 1CU1A 1AE8H 5EG4A 1EXFA 1P57B 4I8HA 1EP6A 1BT7A 2OBQA 3E90B 3KEEA 1F0TA 1TGBA 1MKWK 1H9LB 5EQSA 3ZYDA 1INCA 2QA9E 1ELAA 1A4WH 3SU6A 3RM2H 2ZGJA 1ZMNA 1ABIH 5IYTA 2PSXA 3SQEE 1T8LA 2W7UA 4WJG2 2AIPA 1V3XA 1Y59T 1E36B 2ZHQH 3ZZBA 2GV7A 3GCTF 3ZVAA 2ZCKP 1NTPA 1MBMA 5DP7A 5FAHA 1K9OE 2Q1JA 2GCTC 3SNBA 3Q76A 4WVPE 3EYDA 2BY9X 1GBLA 2IOTA 3PMJA 2B8OH 3MH5A 1RXPA 1P2OA 3OTJE 1O2KA 2Y5GA 4K1EA 1HAVB 2TBSA 1AI8H 4AG1A 4B1TA 2F83A 3AVZA 1KXAA 1O2XA 1MZAA 1EOJA 2CGAA 1DE7H 1SGDE 2ZHWH 1TOCB 3MNBA 2W3IA 3ZYEA 2FOBA 1WAYB 1BOQA 3GCTG 1A0HB 1OKXA 3M5LA 2P94A 4KP0A 2FIRH 3W95A 1D6RA 1QRZA 2ANWA 2BX3A 1EX3A 3UR9A 1FY8E 1C5RA 4Y10E 3GYLB 3ELAH 3F9EA 5FCRA 3SNAA 4MVNA 4GCHF 2ZU2A 1YPHC 1P3EA 4A7IB 1AMHA 2BY6X 2CHAB 1OOKB 1Z1IA 1Z8GA 3LC5A 1SGPE 1W7XH 4B75A 1FQ3A 2SGAA 2Y7ZA 1Y5AT 2QGRA 1D9IA 3BN9A 2BQWB 1EZSC 1RIWC 1OS8A 1P0SH 2TRMA 1PPFE 5BPEA 1O5DH 1OYQA 2GCHF 2ZFPH 1L1GA 3SU3A 1BRBE 1ELTA 1F5KU 3B23B 5EU8A 2BLQA 1HJ9A 1J9CH 2OTVA 1XUFA 1L4DA 1K1JA 1KLTA 1HGTH 3RXLA 1IAUA 4DCDA 1Y3XA 1QIXB 2CF8H 2ZGXH 1ACBE 3AW0A 1A7SA 5E8EH 4WF8A 3ZZ6A 2ZDNA 1TONA 1D6WA 2J4IA 2G5NA 2NU2E 3A7WA 6GCHF 1GHWH 3GYMA 1O2IA 2DUCA 3RXAA 3C1KA 1WYKA 4GPGA 2FZZA 1GCDA 3FFGA 4K8YA 2TIOA 3UIRA 4B2CA 2GCHG 2SNWA 4B73A 3ZZAA 7GCHF 1P05A 1TX8A 2A31A 1O2JA 2R3YA 1O3OA 1GJ5H 2VGCB 1AUTC 4X6OA 1PQ7A 1P3CA 3TH3H 3E16B 3RC4A 3T29A 3VFEA 2HGTH 1ZLRA 1SFIA 1N1LA 1C4Y2 1W0YH 1O3HA 3NWUA 1GBKA 1BRUP 1N6XA 3P70B 3PV4A 1D3DB 2QN5T 1O2GH 4B74A 4JK6A 1T7CA 1EP5A 2WPHS 1C9TA 1O36A 1YF4A 2A2QH 1H9IE 3V3MA 5CE1A 5JB8S 3MO9A 3RXPA 1AFEH 2PGQB 1QB9A 1LVMA 1ELVA 2FX4A 1QL7A 2K1QA 4D9RA 5AF9H 1ELFA 4DY7B 1DSUA 3FANA 1SHYA 3T28A 1HJ8A 1TMUH 2DE9A 5C1UA 2VWOA 3TJUA 3BTQE 3S0NA 1HJAC 2QXIA 1SPJA 2BD9A 4I8GA 1JBUH 4Y8YA 3SO3A 2Y82A 2ZGHA 1G37A 1GI5A 1RGQA 3A7TA 1TNLA 1ZYOA 4Y7BA 2ZP0H 4OGYA 3ZVFA 3A87A 2ZQ2A 3JZ2B 5C20A 1Y3UA 1XX9A 1O3KA 5JB9S 1J15A 4JCNA 2FO9A 1GCTB 5HMAA 4DIHH 4NIVA 4NIYA 1BBRH 1A2CH 1PYTC 1WBGB 4NGAH 3MNCA 3KQDA 3SNEA 1SLWB 2P3TB 3O8CA 3A86A 4F49A 4CHAC 1U6QA 2VB0A 1P8VC 2XTTB 1C1QA 1MD8A 1QRWA 1X7AC 1VCQA 1DWBH 3ODDA 4Y8XA 2FTLE 4GLYA 5EXMA 5HM2A 2GT7A 1QJ1B 4FU9A 4E7RG 2KAIA 2FM2A 1XMNB 2I6SA 3ZVBA 3KNXA 2P95A 3B9FH 2A2XH 4I8LA 4ISLA 3TJOA 3RXMA 1NROH 1NFUA 1GJCB 1T4VH 4O03A 3UNRA 4ZMAH 4AFQA 3SHAH 1FPHH 3ZZDA 3A7ZA 1O2QA 2P3UB 1MTVA 2WUCA 3ZZ5A 1AB9B 2A5KA 3D65E 4D76A 1Z7KA 3HGNA 3S69A 1O2OA 1V2JT 4Q7ZA 2AMDA 5DO4H 3RXGA 5A0BA 4FU8A 4AGJA 3SW2B 3MTYA 3ZV8A 2V6NA 1GI9B 1MTNB 4NFEA 4Q2KA 3U1JB 2D26C 4FUEA 1XKAC 2Z9GA 3M5MA 3EA7A 1S83A 1MTUA 1LMWB 1TBRH 3TJVA 3MH4A 5T6GA 1HUTH 8LPRA 1T8MA 5FCKA 1HRTH 1FONA 1TNKA 1GGDB 1ELBA 4UFFH 1W0ZU 4MPUA 1A3BH 3RMMH 2D2DA 4Y8ZA 4GVUA 1AFQB 4Y7AA 2A5AA 1SQOA 4CR5A 3PLPA 1FY1A 4IS5A 3SUGA 2BDAA 2CN0H 1C1UH 4A1VA 1GMHF 2VIPA 3QTOH 1GBFA 9ESTA 5J4SA 3A7YA 1K1OA 3U98H 4Y76A 3GY5A 1MBQA 2A7HA 1QFKH 3HKIB 1YLCA 2ZWLH 3FAOA 4CRDA 1K1NA 3M5OA 1AO5A 2QY0B 1SQAA 2UUKB 1NY22 1SI5H 1V2PT 1D3PB 2AH4X 1O3GA 1Z1JA 5T6DA 4AN7A 1AZZA 1F7ZA 2QAAA 1MU8B 4XBCA 3LH3A 1AUJA 4Y71A 3RXHA 1JWTA 3PTBA 1OWIA 1SGFG 4ISNA 1TYNA 1THRH 4Q7XA 4AZ2B 4LXBH 3GCOA 4UFEH 4R8TB 1XXFA 3SJIA 1YGCH 3AW1A 1TGNA 3M7TA 1UTQA 1WOFA 3BTME 3V13A 1DSTA 1HNEE 1PQAA 4K3JA 1O5AB 1GI6A 2OC8A 3TH2H 1V2MT 3HK6B 2QXHA 3O8RA 3A88A 5FBEA 2AGGX 1IQHA 4CHAB 2P16A 4JZDH 4X1NU 3DUXH 3URCA 6ESTA 2PR3A 1K2I1 3U8TH 3H5CB 2BD7A 1A61H 1TRNA 4SGBE 2UWLA 3D49H 2NU0E 1BTXA 1ZRKA 2FPZA 1IOEA 1THSH 3S7KB 1ORFA 1HJAB 1CGJE 1O31A 1LO6A 4I32A 4ABGA 1GVKB 5T6FA 2STBE 2ZPRA 3ODFA 2VH6A 4BTUB 1XUJA 4NA9H 3SV9A 1UVSH 4JYTA 3TU7H 4U2WA 2ALVA 1IQFA 1AU8A 2VGCC 4YO9A 2QXJA 1DT2A 1O2UA 4NA7A 1YPJH 1ZPZA 4A1TA 1DY8A 3SU0A 1E37B 1IHSH 1KSNA 4NWKA 1B7XB 1S84A 3MU5A 2AGIX 3A89A 1KLJH 3MU8A 1EAIA 2R2MB 1BHXB 3MU4A 4ESTE 4DG4A 4ABFA 1G2LA 1H9HE 1ZTKA 3IG6B 1CBWB 1TBQH 2XCFA 1GI7B 1GBHA 1BMLA 4KGAA 1P2QA 2ZDMA 3E1XB 3GY4A 2G00A 5FPTA 1ZOMA 1UVTH 1CQQA 1O2LA 4Z6AH 4FXGH 5FX6A 1BMAA 3EA8A 1Z6EA 8KME2 1BTPA 1O2NA 2OQ5A 2CMYA 1MQ5A 1Y3YA 3PLBA 5BRRE 4X6PA 2R0KA 2WINI 3TK6A 1MMJN 4YOJA 1DLEA 1BQYA 3F68H 3BIUH 2AIQA 2Z9JA 3WY8A 1Q3XA 3SV6A 2Q6GA 2VVUA 1AVWA 1O3LA 4X8UH 4WMEA 2A4OA 2H5DA 3CENA 2W7SA 2ZPQA 4Y11E 1QR3E 1YPKH 2Z3DA<