3FAOA

Crystal structure of s118a mutant 3clsp of prrsv
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDAGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Non-structural protein
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
total genus 39
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3faoA03
1SGYE 4XBCA 1SVPA 3GY3A 1GHAG 2OQUA 1N6XA 1MD7A 4MPVA 4ZKRU 3RU4D 2W7UA 4YOGA 1VGCB 1EB2A 4AFUA 1SFIA 1W11U 1HDTH 4X1QU 3URCA 1SLUB 1GHYH 3BTGE 2FS8A 1AFQB 4X2VA 4OS1A 1RS0A 5JYIA 4FUFA 1W7GH 2D1JA 1OPHB 2V0BA 2ZGCA 3P8FA 3PM3A 1AGJA 1XVMA 1GI8B 2J92A 2HWLB 2O8WA 1QL8A 1OS8A 4TWWA 5ESTE 1SR5C 5TJXA 3S69A 2ZTXA 5B6OA 2OLGA 4Y10E 1C1OA 1GBLA 3ZV9A 1LKAA 1KLJH 1O2XA 4I7YH 4X2WA 4XOJA 4JK6A 1TQ7B 1ID5H 4XDEA 2RA3A 4MPWA 1V6DA 2ASUB 2Z3DA 4A6LA 2VVCA 2RA0A 1YF4A 2PV9B 1IQMA 5EODA 1O2WA 2SGFE 2P95A 5EXMA 5A0CA 1GMCG 4KGAA 3GY8A 1EUFA 3SUFA 1PPGE 3UUZA 1TA2A 1MTSA 1GBTA 3TK5A 1O38A 4BTTB 1S6FA 1UMAH 2O8MA 2QXGA 3VXFH 5JPMH 1GMHF 1D4PB 1O5EH 2D2DA 2BZ6H 5A0BA 2BM2A 1E35B 1ZHMA 3LOXA 1P3CA 5FCRA 2FMJA 1GHVH 1SGDE 3VB6A 1LVBA 1H8IH 1O5FH 3U8OH 2ZFPH 1RTFB 3S9CA 1TA6A 3PV4A 3A86A 1A5HA 5C2ZA 1ZSKA 1QBVH 3C1KA 2GP9B 4K2YA 3B23B 2BD7A 4YLQH 2GTBA 2ZI2H 1QJ6B 1O2LA 3LPRA 4YTAA 4UE7H 3NPSA 4MPXA 1DXPA 1GJ4H 3H7TA 5EQRA 3TGKE 4ABDA 3FAOA 1HAHH 1EZXC 1FY4A 5DO4H 1O2RA 1QA0A 3NK8A 1LPZB 2HRVA 1YC0A 1NFUA 4JZDH 1HYLA 2BXUH 5C1XA 2BDIA 1NFXA 2BD9A 2QCYA 2OC1A 4ZAEA 5FXLA 4YOJA 4CRGA 1O3HA 4DCDA 5FBIA 1OSSA 2AH4X 1EB1H 1UVTH 3RLYH 2VINA 1DLKB 1JRTA 4IC5A 5GCHG 1P01A 1UCYE 4WJG2 2Z9LA 3H7OA 3RC6A 1Y3YA 1HLTH 1A46H 5E0JA 1GBKA 2ZDKA 3P70B 6GCHF 2VIPA 2AFQB 1H4WA 1Z6JH 1SB1H 2QAAA 1OP0A 3RUOA 3A82A 1KY9A 4Y8XA 2BMGB 1ANDA 1TQ0B 1AWFH 1GJCB 3SO3A 1EJMA 2O8TA 2Y5GA 1B0FA 1N1LA 2BQWB 2STAE 3UTUH 1THPB 2A4OA 1O3DA 1C2KA 1KTSB 1RGQA 1UK2A 1QB9A 2FP7B 4MQAA 4DT7B 4JZEH 1CA8B 3BG8A 1ZSJA 2QF3A 4ISHH 1YPKH 5E8EH 5AF9H 1VCWA 1FIZA 3SZNA 1BDAA 4X6MA 3ZVAA 1LHCH 2ZDAH 2XCFA 1CT0E 4UFFH 1SGPE 1ZTKA 3RXTA 3M37A 1ANCA 2PTNA 4IGDA 2F3CE 3F9FA 1DVAH 5EU8A 3RXLA 1UTNA 1K28D 3BTDE 1JWTA 2Y7XA 3VB3A 2ZPRA 4JCNA 2CXVA 4CHAC 2D26C 4A5TS 5EW2H 4ZHLU 3RP2A 4H4FA 2CHAC 1T8NA 3QDZB 1DSTA 3O8BA 1C5VA 2J34A 2Y5FA 4WF8A 1GI1A 1QA7A 1L2EA 5T6GA 2GCHF 4Y8ZA 5AFYH 3RC5A 3EDXB 1C5NH 1O2MA 3T26A 1AWHB 3ODFA 1INCA 1O5CB 1TRYA 3MTYA 1G2MA 5DGJA 1P12E 3O8RA 1BRUP 1O2HA 4AB8A 1CGIE 5E0GA 3TPIZ 4BAKB 1KXBA 1QL9A 1FQ3A 1UTMA 1GBAA 2ZGXH 4GSOA 1UTOA 2W5EA 3F9EA 1A3BH 3U8TH 2VU8E 2FTMA 7GCHG 5I25A 4ABHA 1GMDF 4MTBA 4YO9A 3QX5H 3GDUA 5A2MH 3GY6A 2ZKSA 1O2GH 4BOHA 3SNEA 1SGTA 2G4UA 3GCNA 1YCPM 1D6WA 4Y79A 4BXSA 4X1SU 4OGXA 1KLTA 5LPEA 4B75A 1TX7A 1LTOA 1BOQA 1D6RA 1MZDA 3SW2B 1VJAU 4K1EA 2A5AA 4DVAU 2GDDA 1TNHA 1GI3A 3P8NA 4Q7XA 1HPGA 3MO6A 1N8OB 5GDSH 2JH6D 3OYPA 1O3IA 4ISIH 3GCTF 3OSYA 1BUIA 1IHSH 1YLCA 1UTKA 3SU1A 3VXEH 3ZZDA 1Y3VA 1ETSH 1NT1A 1V2PT 1GI7B 2C4FH 3K9XB 3GCTG 1DFPA 4MVNA 2O9QA 1NM6A 3MNBA 1SLXB 2ANKH 3RU4T 2BD5A 2XBWA 2B7DH 4SGBE 4IN2A 3V12A 1SGFG 3SV6A 8GCHF 3M5LA 2Y7ZA 2UUKB 7LPRA 4TPIZ 3STIA 4RN6A 5JBTA 1C5QA 1EJNA 4Y6DA 5DP9A 1RTLA 1VITF 4IMZA 1MCTA 1OXGA 1P06A 3HKJB 1SGRE 4D7FA 4VGCB 1C2MA 1Y3UA 4FUHA 3HK3B 2B8OH 2OBQA 2BDCA 1DY8A 1BQYA 2Z6BD 3KQBA 1DWCH 4WMFA 2CGAA 4Y7BA 3SNAA 1UTPA 4VGCC 1QURH 3Q00A 1HAOH 4X8SH 1O3EA 1UK3A 1C5YB 1TONA 1BTZA 1O3NA 2EI7A 4JYVH 2A7HA 1IQHA 3UREA 1W3CA 1UVSH 1BT7A 1IQLA 1ZGVA 2WINI 1DY9A 4XFQA 2FX6A 3LT3A 3S9AA 5DK1A 3UNQA 1WTGH 2PKAA 2W26A 3Q77A 3SV8A 3SU4A 3S9BA 1Z71A 4INHA 3SBKA 8LPRA 5DP8A 2PKSB 1KDQA 3SHAH 1GJ5H 2H9EH 4IW4E 3ZZ4A 2BLOA 1FY5A 2XW9A 4AGJA 5JB8S 1CBWB 2OBOA 1A7SA 1TLDA 1XMNB 1NRRH 1GHBG 2J4IA 2ZTZA 1W2KH 4QT8C 4OS6A 4RKOB 1OWKA 2F9NA 3O8DA 2P94A 5C5NA 2G5NA 1EP5A 2HVXA 1AVGH 1CBWC 1K1LA 4U32A 2ZA5A 1C1UH 2ANMH 2FO9A 1Z8JB 2HLCA 4NA8A 2BVSH 4CRBA 2XBXA 3UWIA 5GXPA 1L4DA 3OTJE 2ZDNA 5L30H 1HNEE 5AVDA 1O30A 1C2LA 4THNH 1O2UA 1G36A 5JB9S 2H2ZA 1Y5AT 1QFKH 3MNSA 1O0DH 1BTWA 4Z6AH 2A5KA 1WV7H 1TAWA 4X8VH 2Z9KA 1UK4A 3QUMP 3SJ9A 5A09A 1PQ5A 2HGTH 1AIXH 5DP5A 2G81E 1PQ8A 2GVFA 1QHRB 2XC0A 3SU2A 1O5AB 1C2HA 1FI8A 1OYQA 3LIWA 1GJAB 1A4WH 1TPOA 4FUGA 2XWBI 2TIOA 4HFPB 5DP4A 2WPIS 1AE5A 2Y81A 4NFFA 2SGDE 1A5GH 1UHBB 4K69A 3RXBA 2ZHDA 3ENSB 5A8YA 2QXHA 1MU6B 4ZKNU 1O3KA 1G3EA 2YOLA 1EAUA 1P09A 1AN1E 3JZ1B 4GCHG 1QTFA 1C5MD 3BTTE 2FOFA 4ABGA 4FUBA 1FZZA 3SGAE 2FM2A 1LPGB 2CN0H 2PWXA 3UY9A 2HPPH 5A0AE 2PW8H 3RLWH 4K3JA 1Q2WA 1S85A 2TGPZ 1N6YA 1OWJA 5FX5A 3RXJA 3UQOA 2P3TB 2GZ9A 3CP7A 4M7GA 1O3GA 1ORFA 2B9LA 3FP8E 1LMWB 4U30A 4CH2B 3BTQE 4RSPA 1HIAB 4ZROA 1AQ7A 3SNDA 1G32B 1FN6A 2BDHA 2EI8A 3KQCA 1J16A 3URDA 1YP9A 3RXSA 5T6FA 3W95A 2V6NA 3RMLH 1GJ7B 4IMQA 2ILNA 1GJDB 1BTXA 1ZHPA 1ZMLA 1C2FA 3F6UH 1GG6B 3A87A 5EW1H 1VCPA 3QLPH 4DJZB 4X6OA 2NWNA 1HAIH 1MKWH 1QNJA 1GJ6A 1LO6A 1RD3B 2ZHFH 1B7XB 3GISB 3ZZ9A 1T8LA 3FFGA 2RG3A 5L6NH 1WOFA 1GG6C 1H9LB 1PJPA 3GDSA 3RXKA 2KAIA 4ZH8A 3GOVB 1OWIA 2SGPE 2OC7A 1B0EA 1PPBH 1C5RA 1V2JT 2A32A 2R3UA 1P10A 2FS9A 3GCOA 3SN8A 4NA9H 1CO7E 1AO5A 3SNBA 2FI3E 1HJ8A 5CHAB 2VIWA 3BEFB 4I8LA 1JIRA 1D3DB 1FIWA 1P3EA 4TPYA 1Y5BT 2ESTE 4FU8A 2R2MB 1JRSA 4XE4A 1YPMH 3TVJB 2UWOA 2Z3EA 2BDGA 2LPRA 2CF8H 3CS7A 1C5ZB 1TIOA 1C2DA 3PTBA 2SNWA 1O3CA 5FHTA 3BTEE 1CHOF 1THRH 1P2OA 2C90B 2O8LA 4WXVA 1GHAF 4K8BA 5C20A 3M3SA 1CHOG 4I8KA 1DE7H 2TBSA 1P2JA 4ZXXH 2GZ7A 1W12U 3ATLA 2TGAA 1AU8A 3UNSA 3W94A 1AKSA 2VWLA 4NZQA 4BAOB 4X1PU 2PLXA 1XM1A 1TYNA 1BRAA 1EOJA 4DGJA 1LVOA 3KN2A 1GBHA 3KIDU 1C5SA 3LH3A 3C27B 1MTVA 3U9AH 1ZJDA 3E0PB 1VGCC 3HATH 4I8HA 1TWXB 1CGJE 3E8LA 3UWJH 1GJBB 1ZSLA 1ZR0A 1GDQA 4CH8B 1AFQC 1F5KU 4UEHH 5E2PA 2PGQB 5TCAA 3KCGH 1WUNH 4FU9A 1A5IA 3T62A 2XNIA 3DD2H 1G3CA 1P11E 2FTLE 2PHBA 3KGPA 1FAXA 2ODPA 3RXFA 4B2CA 4SGAE 4ESTE 2WPMS 5LH8A 2AYWA 1EKBB 4X0WU 3A89A 5JBCS 1OP8A 4DG4A 1MQ5A 1O3MA 2GKVE 3T2NA 4AZ2B 4GHTA 1C1WH 1GMCF 1QR3E 4HGCA 4KP0A 3PMHB 1PPCE 2QXIA 1BHXF 3SV7A 1HB0B 2A4GA 6CHAB 4A1VA 2CV3A 3I29A 4F49A 4CRAA 1O5GH 1FJSA 1HGTH 5I46H 3KL6A 1DITH 3LGYA 3LU9B 3TK6A 1HAYB 1WAYB 1S84A 3SUDA 3SQEE 1GDNA 4JYTA 5FPYA 3RU4E 1SPJA 1NY22 4Y8YA 1C4U2 2C8ZB 4YOIA 2F83A 2Q6FA 2ALVA 1J14A 5EXNA 3G01A 3M5OA 3QTOH 5JDUB 3TJNA 2ODYB 4RKJB 3MO9A 1K21H 2AMDA 1T32A 3TNSA 3RXUA 1PYTD 3I77A 1W8BH 1CGHA 5L2YH 2VJ1A 5PTPA 1WYKA 1O37A 3TH3H 1YLDA 2C93B 2GDEH 4KKDA 3ZYDA 2J38A 2PTCE 1IHTH 2WUBA 2ANYA 4WY3A 2HALA 3MU0A 1A3EH 5DPAA 2XBYA 5F8ZA 3SHCH 3ZVGA 4DY7B 1F2SE 5IDKA 1W0ZU 2ZU3A 1TBRH 1C5LH 2BDAA 3GY2A 1NTPA 1ZMJA 4AN7A 5C67A 1NFYA 2PR3A 3M61U 2R3YA 5J4QA 3P6ZB 5FCKA 3UFAA 5C1UA 1VZQH 1ELGA 4A92A 2UUYA 3RXDA 2P93A 2AMQA 1QRXA 4ISNA 3Q76A 4KELA 5LPRA 4X6NA 4YT6H 5FBEA 1EAIA 5GCHF 3Q3YA 2ZFRH 1PQAA 4K5ZA 1D3QB 1F92A 1XUKA 1J17T 2HOBA 1V2MT 1LHDH 2BQ7B 1IQJA 1QIXB 1MU8B 2IPHA 3MWIU 4FVBA 4NWKA 4JK5A 2QA9E 2A0QB 3BTHE 3UR9A 2ZG0H 2JETB 2TGDA 3H5CB 2FDAA 5JBAS 3RXHA 1O2IA 1Z6EA 2J2UA 1QJ1B 3P92A 1LHGH 4IN1A 1LVYA 4AOQA 3EA8A 3E90B 4UDWH 1HUTH 1HAVB 2B5TB 1F5LA 5FAHA 2Z7FE 2ZHQH 3K6YA 2GMTB 2FOAA 2A31A 2Z9IA 2J95A 3VGCB 1Y3WA 1FV9A 2IOTA 4UFGH 4UONA 1A0HB 1MZAA 4NWLA 3CENA 1GDUA 4CR5A 1G2LA 1T8MA 1TGTA 1SL3A 3TJVA 2OQ5A 2GCTB 4MNWA 4NSVA 2OUAA 3WY8A 3MO3A 4ZUHA 3D23A 1UVOA 3PYHA 2VIQA 3ZVEA 1ARCA 3EYDA 3KQEA 1EAWA 4IS5A 2C3SA 1L0ZA 1GL1A 1BRBE 5F8XA 2R9PA 2NU4E 2OD3B 4Z0KA 4A1XA 2JH0D 2GV7A 1WQVH 2P59A 3QGJA 3PMBB 3IWMA 1O2KA 1ZTLA 3D65E 1BMMH 4Y7AA 2FEQH 4FUEA 1EPTA 1E0FD 3ZZ6A 3BEUA 4BANB 2VWMA 4ZMAH 2CF9H 2ZPQA 3K65B 4KTSA 3PMAB 5FX6A 3SU6A 4ABAA 1ETRH 1C5TA 1W10U 2DE9A 3BTWE 1F0RA 1KXDA 1XUJA 2WV4A 4I8GA 3ZZCA 4YM9A 2PGBB 5C5OA 3U1JB 4E06H 1K22H 1SOZA 1OWEA 2XCNA 2ZFTA 4ZXYH 3U8RH 4JZFH 1TBZH 4XBDA 7GCHF 1SHYA 1NRQH 3EAJA 3KHVA 1F5RA 1ELAA 4R0IA 3LJOA 3NWUA 3GDVA 2FOMB 1A2CH 4NFEA 1GI6A 1HV7A 1NESE 2P3UB 1ELDE 3UPEA 1C1TA 3EQ0H 4K1TA 3VB4A 4ABFA 4X1NU 3GYMA 4FUDA 3ODDA 3PO1B 1C2EA 3F9GA 1ANBA 3E6PH 3PLKA 1ZPZA 3OX7U 3RMMH 4TY7A 2STBE 3MOCA 3SUGA 4XSKU 1OWDA 4B74A 4MG3A 2ZIQH 1T7CA 3M7QA 3DUXH 5H4IB 2XC4A 4GUXA 1YM0A 1UJ1A 4GVUA 1SSXA 1EXFA 2ZP0H 3GYLB 1BTHH 2ULLA 3A88A 1DXWA 1BTPA 1Z8IB 1YBWA 3V13A 1S0QA 1N8OC 5SGAE 4Q2KA 2ZNKH 4I33A 2G8TA 1J9CH 1GBCA 1G30B 2HNTE 3FZDA 2LNCA 1ZLRA 1DSUA 1V3XA 3NZIA 4Q80A 3NKKA 1ZRBA 1H1BA 4A7IB 3PTNA 3R3GB 4D8NA 1ACBE 2ZU1A 1BA8B 5EQQA 3M7UA 4WVPE 3MH5A 1LHEH 2RDLA 2Q6DA 3F1SB 1HRTH 1NU7B 1NRPH 3A84A 2ZCLP 3TU7H 1V2UT 3AAUA 5T3HA 1LQEA 4Y71A 1TABE 3RXVA 1QL7A 2BLQA 4MLFB 1IQFA 2AMPA 2BXTH 3TGJE 2PFEA 2AEIH 1AD8H 1GI4A 4TWYA 4KTCA 3O8CA 2Y5HA 4O03A 1CT2E 2NU1E 1TMBH 1GBIA 2A1DB 1AVXA 2THFB 2EI6A 1SQTA 2K1QA 1BBRH 1K2I1 3QO6A 2FOBA 3TJUA 5ESBA 1O2OA 4Q7YA 3M35A 2VH6A 1S82A 1ELCA 1GGDB 1SG8B 1ZPBA 1MTNB 1SFQB 3SORA 2Y80A 2JKHA 1CSOE 5K0HA 3MU8A 1U6QA 2W3KA 1S6HA 2BVRH 2TGTA 4I32A 3EE0B 2A4QA 4LZ4B 5HMAA 1VCQA 1GHBF 1RRKA 3SI4H 3BEIB 1GGDC 1MTNC 2G4TA 1ABJH 1F0SA 3BSQA 4CBOA 1DLEA 3M36A 1XUGA 2A2XH 1V2QT 2PKSC 4JZ1A 3RXGA 1AUJA 1RFNA 5LPFA 3MNXA 3MFJA 3MHWU 3CS0A 2P8OB 3RC4A 3ATMA 2XC5A 2VB0A 4Y0ZE 1ABIH 4H6TA 2B0FA 4MPUA 3T28A 2OXSA 5DG6A 1O5DH 2GX4A 4NA7A 2C8WB 3ZV8A 1TFXA 1V2NT 2ZFSA 3A7ZA 3I78A 2ZDVH 2BVXH 1VJ9U 3BV9B 1J8AA 3OY6U 2BLVA 3SU3A 1EAXA 1SGNE 4CBNA 3ZZ7A 3T27A 2FYQA 4UD9H 4J1YA 3SQHE 5F6MA 4B73A 2ODQA 1TNIA 4D7GA 1D9IA 1P2KA 2VH0A 2ZGBH 4B2AA 1FY8E 1NU9A 1BHXB 2SNVA 1LQDB 2ZEBA 5AFZH 1C1VH 1YPJH 4ISLA 1VITH 2VIVA 5ETXA 4WWYA 3BTFE 3HGPA 3RXRA 3ZYEA 1DANH 1GBDA 1NROH 2BHGA 4ASHA 2Z9JA 1BMNH 1F0TA 4YESB 4B1TA 3ZZ5A 1ZMNA 2WPHS 3RXQA 3L3TA 4D9QA 1OKXA 2ZF0H 1AHTH 3K6ZA 4GCHF 1K1JA 1O34A 1A1RA 1FDPA 1O3LA 2FOGA 4OGYA 1CVWH 4LXBH 4ZKSU 1DT2A 2ZZUH 3E3TA 1IAUA 2VWOA 1HAPH 3OU0A 1F7ZA 1HJ9A 4LOYH 1AFEH 1FY3A 4DW2U 3LH1A 2A7JA 4DIIH 1P05A 1IQEA 3KEEA 2G55A 3ITIA 5DP7A 4YT7H 1XKBC 5K7RA 1TPPA 1P57B 1FPCH 1MKXH 2G52A 1UTLM 1OWHA 1C1RA 3LGTA 4Y76A 1J15A 2BDYA 4HI3A 4BTUB 2AIPA 1EZUC 2BOKA 1S0RA 2PKAB 2FOCA 4NIWA 1YPHE 1KDQB 1WSSH 1O33A 1TRMA 1RTKA 2GV6A 3PWBA 3S7KB 2P16A 4UFEH 5HGGA 1CE5A 1QJ7B 2WPKS 2ZU4A 1BBRK 1ZJKA 1HFDA 2FIRH 1DPOA 2QN5T 1EP6A 1C1QA 2QIQA 2UUJB 3UNRA 1W13U 1CT4E 1P04A 4MNYA 1ZZZA 1FAKH 2AERH 3LGWA 3HPTB 1Z1JA 2BTCE 5HM9A 3RDZA 4BAMB 1OYTH 1TPSA 1Z7KA 3LC5A 1OP2A 2WYJA 1O36A 1AZ8A 1GCDA 3U1IB 3ZZ8A 3L33A 4DURA 1O2QA 3RMNH 3T29A 1MTWA 3RXCA 3SU5A 5HXFA 1SOTA 2ZFQH 1FXYA 5EXLA 1ZTJA 4ABBA 3FP6E 2XTTB 1GBJA 1Y5UT 3D49H 1P03A 1SQAA 4GPGA 1SMFE 5CHAC 4GAWA 1ETTH 1GWAA 2UUFB 3TLOA 3UOPA 2ZCHP 3BG4B 3MU5A 3FANA 1TNLA 6LPRA 3PLBA 1IQKA 1NC6A 1BZXE 1KTTB 3QZQA 3VFEA 4AFQA 3MH4A 4JMYA 1EZSC 2F9PA 3AASA 2RCEA 1NS3A 2R0LA 2OP9A 3A81A 4NIXA 1JXPA 4DIHH 2HPQH 3MYWA 1T8OA 1AVWA 3BG4C 5FPSA 5IYTA 1TALA 4GLYA 2H9TH 4AORA 1DOJA 3FP7E 5GJ4B 1XUHA 3N7OA 1NZQH 1QRWA 2QXJA 2NU2E 5JBBS 2XXLA 4NSYA 3QZRA 1GI9B 3GCHB 8KME2 1DWDH 4A1TA 4X1RU 1P0SH 1Q3XA 9ESTA 1O3JA 3M3TA 1C1SA 3BTME 3V7TA 1PFXC 4ABIA 1C2GA 1IQNA 4FUCA 1SGQE 1HAVA 1QY6A 3GCHC 2I6QA 1MTUA 2G00A 2F91A 2DE8A 1V2OT 1KSNA 9LPRA 3AAVA 4LK4A 3SOSA 1ESAA 3SV2H 4BTIB 2F9VA 5CMXH 4E7NA 5DJ7A 1HBTH 2H5DA 1C5WB 1O3PB 2R0KA 1G37A 1GVZA 1ESBA 2BD4A 1OX1A 1V2ST 3GY4A 3ZVBA 2EC9H 5E0HA 5EQSA 4TY6A 3LDXH 2WYGA 1W7XH 2Z94A 2NU3E 1G3DA 2BLWA 3PWCA 1MAYA 3NCLA 1C1PA 2BOHB 1QGFA 2VIDA 2ZWLH 1ZGIA 1FY1A 3QGNB 2PSYA 1KXFA 6ESTA 6CHAC 1RXPA 2ZCKP 3GY7A 2H6MA 2Q1JA 4MNVA 1MKXK 4AYVB 4B71A 1BIOA 1NN6A 5LGOA 2FXRA 4D9RA 3LGUA 2FOEA 2FI5E 2Y6TA 1FLEE 2D8WA 2YNBA 3SV9A 1PQ7A 4K8YA 5F03A 5ABWA 1O2VA 1QB1A 3NUMA 2BX4A 2KAIB 3E91A 2F9UA 1QQUA 3A8DA 1V2TT 4O3TA 2F9OA 1XXDA 1GMHG 4OS4A 1AY6H 2TPIZ 1UO6A 1Z8RA 2BD8A 1C2IA 2QV1A 4B2BA 1UCYH 3ZVFA 2PUXB 3E16B 1O32A 3AVZA 4WXIA 3AW1A 3T25A 4FXGH 1MCVA 2G51A 1HCGA 1O2NA 2P3FH 3DHKH 2AIQA 3KQDA 5F8TA 2ALPA 1K1IA 1QBNA 4OS5A 2AGEX 1AI8H 3RXPA 3PB1E 1MKWK 4E7RG 4I8JA 1BJUA 4KTUA 3MH6A 1GPZA 3PROA 4JZIA 3RXMA 2VVUA 4YZUA 4NIVA 2QY0B 4X2YA 3VB7A 1GVKB 2W3IA 1AKSB 2A45B 3A85A 1GBFA 1KYNA 3RM2H 3SJOA 1ESTA 2HNTF 1WU1A 1SGIB 1ARBA 2XRCA 3VPKA 2AS9A 1D3TB 2I6SA 3SI3H 3MMGA 1YPHC 3TGIE 4AFSA 1MUEB 2ZU2A 3PLPA 2JETC 3MU4A 2QF0A 1UTQA 1O3FA 2CMYA 2WPJS 1EX3A 1G3BA 1HXEH 1E34B 2O8UA 4ZKOU 1XUIA 1T4VH 3F9HA 1K1MA 1YYY1 2BY5X 2GMTC 6GCHG 1DS2E 1H9IE 1WBGB 1O3AA 5E2OA 3VGCC 1JMOH 1A61H 2FOHA 2IJOB 3A8CA 7KMEH 4WH8A 3HK6B 1GBMA 1NO9H 5BPEA 3TIUA 2GCTC 2IN2A 2CJIA 2A5IA 3R0FA 5FPTA 3F68H 3U98H 1RIWB 2ZO3H 4CHAB 1PPEE 1A0LA 1P9SA 1H8DH 2BY6X 3QK1A 1V2KT 1P2IA 2PSXA 2DUCA 1YPLH 2CHAB 5EPYA 2ZHWH 2FI4E 3D62A 1RIWC 1ELBA 1GHWH 3QN7A 3SUEA 3Q3KA 1C4V2 4O97A 4CR9A 3V0XA 3P8GA 5AHGH 1W0YH 2ZQ1A 1TB6H 4CRFA 1QBOA 1HAZB 1C1NA 2WPLS 3IG6B 1QB6A 1O2SA 1NFWA 3P95A 1YCPH 1EOLA 4BAHB 1L4ZA 3LGIA 1JIMA 3SJKA 1FPHH 4NG9H 3M3VA 1BMLA 4INKA 4PROA 1CU1A 3RM0H 4JYUH 2UWLA 4Y0YE 5HM2A 2GCHG 3TITA 1TGCA 3UQVA 1A0JA 5EG4A 2GGVB 1H9HE 3LKWA 1LDTT 3FZZA 4OS2A 1AMHA 1SHHB 1S83A 1C5UA 2ZECA 3LONA 3B9FH 2WV5A 2SGAA 4WMEA 3DFLA 4MNXA 1BCUH 5HYOA 1TMUH 2FLRH 4F4OC 1V2RT 2ZDLA 2WUCA 1YKTA 2QGRA 1O2JA 1FMGA 2BB4A 3L6PA 3VB5A 1SC8U 4BNRA 2V3HH 1MBQA 1FN8A 1MQ6A 1AZZA 1GMDG 1V2LT 3MH7A 1L1GA 4CRDA 3BF6H 3OY5U 2FESH 1WTHD 2A4RA 3ZZ3A 1UCYK 3PO1C 1G9IE 2XWAA 5T6DA 1NPMA 3A7XA 1L1NA 1O5BB 1DUAA 2FODA 2BQ6B 3A7TA 1GL0E 3BTKE 1BITA 2ZU5A 4AG2A 4YLUA 5DP6A 1P2MA 1LKBA 3M5NA 1TGSZ 2ZDMA 3U69H 3SNCA 3ZZBA 1GBEA 1XUFA 1HAGE 3QTVH 1Z8GA 3A80A 2H5CA 1SBWA 2Z9GA 2ZGHA 5G4BA 1ELEE 4INLA 3MU1A 1P2NA 2SGQE 3UIRA 4H42U 1CA0B 1Y3XA 1K9OE 1ZHRA 1UHBA 1EATA 2J9NA 3RXEA 2BD3A 2OC0A 1E38B 1JBUH 2ZPSA 1O3BA 4OS7A 5DP3A 1V2WT 1O2PA 8GCHG 2OC8A 5C3NA 2VVVA 5GWZA 5A8XA 2ZTYA 4ABEA 3VEQB 1ZPCA 1C1MA 1CHGA 3DT0H 1CA0C 3LGVA 1GI2A 1P8VC 5EGMA 1WCZA 1VITG 1SLVB 4IBLH 1P02A 3A83A 2BY7X 1C5OH 3E1XB 1C5PA 1QQ4A 2M5TA 4TYDA 2YNAA 1LHFH 3KF2A 4FUIA 4BXWA 1YGCH 4X8UH 1EPTB 1SI5H 4FVDA 1GI0A 2UWPA 1K1OA 3STJA 1LVMA 1P9UA 1TBQH 1GBBA 1V2VT 3P17H 3SGBE 3EA9A 1WQSA 1HIAA 4CRCA 1CQQA 3LJJA 3PMJA 3SGQE 1LCYA 1ZOMA 2C8XB 1EPTC 1SGEE 1M9UA 3ZVDA 1BTUA 2V3OH 1EZQA 1TOCB 3IITA 1MMJN 3T5FH 2VNTA 5GIBA 3GICB 4IC6A 1OOKB 1GJ9B 1EQ9A 1PYTC 2Z3CA 4O3UA 3Q3XA 1E36B 1HXFH 1GVLA 2XBVA 2XYAA 2OTVA 3TH2H 3TNTA 4AB9A 1MAXA 1SLWB 3HKIB 1BBRE 5L2ZH 1LPKB 1MH0A 2Y82A 2P8OC 1C9TA 1EASA 4AG1A 2J94A 3B8JA 5A8ZA 1PPZA 1GHXH 1TRNA 3A7VA 1AE8H 1TNKA 5BRRE 4XBBA 3E0NB 2FZZA 5EOKA 1IQIA 1YCPK 1S81A 4FU7A 1MD8A 1TGNA 2SGEE 2ZHEH 3LC3A 1TPAE 7ESTE 1AB9B 3SU0A 3ZZAA 5J4SA 2PUQH 1BRCE 3HGNA 3M7TA 4WMDA 1FUJA 1S5SA 1FNIA 1DDJA 2FPZA 1SQOA 1Z1IA 3UOUA 3ZVCA 4HZHA 1GJ8B 4NZLA 1AUTC 3MI4A 2BZAA 1TMTH 3BIVH 1T31A 4NGAH 1DWEH 2R2WU 1KLIH 4U01A 3RXIA 1AB9C 1E37B 4FUJA 4K1SA 1ELTA 1QCPA 4ZHMU 2ZC9H 4H6SB 4X8TH 2FYRA 4Q7ZA 3TH4H 1O2ZA 1ZYOA 3DFJA 1L1JA 1KXAA 1FONA 1XXFA 1UVPA 2NU0E 1TGBA 4D76A 2A2QH 2A7CA 3KNXA 3TJOA 4AFZA 2EEKA 1GHZA 1IOEA 3TK9A 2TRMA 1UVUH 3JZ2B 3NXPA 1SGCA 1DUEA 2GD4B 2Q6GA 3P8OA 2H1UA 1Y8TA 2FWWA 3SJ8A 1DICA 4Y11E 4MDSA 1K1PA 1RJXB 1O31A 3GY5A 4U2WA 1ELFA 1P2QA 4AX9H 3ATKA 2BD2A 4ABJA 1XVOA 2BY8X 2F9BH 1IQGA 5DKMA 4AYYB 2FX4A 2W7SA 1C5XB 2V35A 3EA7A 1NRNH 1Q31A 3BIUH 3MNCA 2ZGJA 1XKAC 2BDBA 1GI5A 3EGKH 4E05H 1TNGA 2OCVB 2VWNA 1O2TA 1BJVA 3V3MA 5TCCA 2G5VA 1JOUB 3QWCH 3ELAH 1HJAB 4I31A 4K60A 2BX3A 2OINA 3S0NA 8ESTE 1NRSH 1B5GH 1VR1H 2QYIA 3A7WA 4ZHAA 3RMOH 1ELVA 3K2UA 4WH6A 1BTYA 2AGIX 3SJIA 4J2YB 1BB0B 1PPHE 1HJAC 2HNTC 1TNJA 2AGGX 1DX5M 1GCTB 3FVFB 2BY9X 1D3PB 3RXAA 4NIYA 1SGFA 1TE0A 1C9PA 1XX9A 3AW0A 4X2XA 3RXOA 4DOQA 1THSH 1BMAA 2GT7A 2ZFFH 4AGKA 4UFDH 3DA9B 2QC2A 4NCYA 1YPGH 3M5MA 5C1YA 4CREA 4X6PA 2FLBH 1TOMH 1DWBH 1GCTC 3A8AA 3BN9A 2VGCB 2BYAX 4ISOA 1C2JA 1Y59T 1F0UA 1UTJA 3UR6A 1EJAA 1O2YA 1KIGH 2SFAA 1K1NA 2GT8A 1QRZA 3ATIA 2H9HA 4GHQA 1ZRKA 1ANEA 2ANWA 2ZQ2A 3ATWA 1O35A 4R8TB 5CE1A 1PPFE 1KXEA 1X7AC 1HAXB 2VGCC 4B76A 4O9VA 1W14U 2C8YB 1YPEH 1O39A 1TX6A 5GPIB 4BAQB 2EA3A 1TX8A 4LZ1H 1T4UH 3A7YA 1DM4B 2GZ8A 5EPNA 1KXCA 1C4Y2 3S7HB 3A8BA 1O3OA 3ESTA 2JH5D 4HTCH 1MBMA 2VIOA
chains in the Genus database with same CATH superfamily
1SGYE 4XBCA 1SVPA 3GY3A 1GHAG 2OQUA 1N6XA 1MD7A 4MPVA 4ZKRU 2L5UA 3RU4D 2W7UA 4YOGA 1VGCB 2MUMA 1EB2A 4AFUA 1SFIA 1W11U 1HDTH 4X1QU 3URCA 1SLUB 1GHYH 3BTGE 1BMFD 2FS8A 1AFQB 4X2VA 5SVIA 1WXRA 4OS1A 1RS0A 2E6RA 5JYIA 2JJ1D 4FUFA 1W7GH 2D1JA 1OPHB 2V0BA 2ZGCA 3P8FA 3PM3A 1AGJA 5EIYA 1XVMA 1GI8B 3CNRA 2J92A 2HWLB 2HLDD 2O8WA 1QL8A 2LN0A 1OS8A 3N9OA 4M9FA 4TWWA 5ESTE 1SR5C 4I86A 5TJXA 3S69A 2H0DA 2VPBA 2ZTXA 5B6OA 2OLGA 2J5UA 4Y10E 1C1OA 1GBLA 1WEMA 3ZV9A 1LKAA 1KLJH 1O2XA 4I7YH 4X2WA 4XOJA 4JK6A 1TQ7B 1ID5H 2HDPA 4XDEA 2RA3A 2KGGA 4MPWA 1V6DA 2ASUB 2Z3DA 4A6LA 2VVCA 4QQ4A 2RA0A 1YF4A 1YWUA 2PV9B 1IQMA 4YBTA 5EODA 1O2WA 2SGFE 2P95A 5EXMA 3W1EA 5A0CA 1GMCG 4YABA 4KGAA 3GY8A 1EUFA 3SUFA 1PPGE 3UUZA 1TA2A 2LELA 1MTSA 1GBTA 3TK5A 1O38A 4BTTB 1S6FA 1UMAH 2O8MA 3AK5A 2QXGA 3VXFH 5JPMH 1KMHB 1NBME 1GMHF 1D4PB 1O5EH 2D2DA 2BZ6H 3PV2A 5A0BA 1JOCA 2BM2A 1E35B 1ZHMA 3LOXA 1P3CA 5FCRA 2JMDA 2FMJA 1GHVH 1SGDE 3VB6A 2CT2A 1LVBA 1H8IH 1O5FH 3U8OH 5B8DA 2ZFPH 1RTFB 3S9CA 1TA6A 3PV4A 3A86A 1A5HA 5C2ZA 2KGIA 1ZSKA 1QBVH 3C1KA 2GP9B 4K2YA 3B23B 2BD7A 3C5KA 4NN2A 4YLQH 2GTBA 2LP6A 2ZI2H 1QJ6B 1O2LA 3LPRA 4YTAA 4UE7H 3NPSA 4MPXA 4FK5A 1DXPA 1GJ4H 3H7TA 5EQRA 3TGKE 2FSAA 4ABDA 3FAOA 1HAHH 1EZXC 1FY4A 5DO4H 1O2RA 1QA0A 1K0HA 3NK8A 2ECNA 1LPZB 2HRVA 2NAAA 2PNXA 1YC0A 1NFUA 4JZDH 2ECJA 1HYLA 2BXUH 5C1XA 2BDIA 3UAIC 1NFXA 2BD9A 2QCYA 3FO8D 2M85A 4RI0A 2OC1A 4ZAEA 5FXLA 4YOJA 4CRGA 2L75A 1O3HA 4DCDA 5FBIA 1OSSA 2AH4X 1EB1H 1UVTH 2DSMA 3KQIA 3RLYH 2VINA 1DLKB 1JRTA 5C0TA 4IC5A 5GCHG 1P01A 1UCYE 2F4LA 4WJG2 4A0CD 2Z9LA 3H7OA 3RC6A 4GB0A 1Y3YA 3FKSD 1HLTH 2KCOA 1A46H 5E0JA 2LGVA 1GBKA 2ZDKA 3P70B 6GCHF 3L1XA 3Q1DA 2VIPA 2AFQB 1H4WA 1Z6JH 1SB1H 2QAAA 1OP0A 3RUOA 3A82A 5HIZA 1KY9A 4Y8XA 2BMGB 1ANDA 2WHXA 1TQ0B 1AWFH 1GJCB 3SO3A 3O47A 1EJMA 2O8TA 2Y5GA 1E1RD 1B0FA 4Q6FA 2F42A 5F53A 1N1LA 2BQWB 2STAE 3UTUH 1THPB 2A4OA 1O3DA 1C2KA 3FL2A 1KTSB 1RGQA 1UK2A 3RPGB 1QB9A 2FP7B 4MQAA 4DT7B 4JZEH 1CA8B 3BG8A 3KV6A 1ZSJA 2QF3A 4ISHH 1YPKH 5E8EH 5AF9H 1VCWA 1FIZA 3SZNA 1BDAA 4X6MA 3ZVAA 1LHCH 2ZDAH 1Z6UA 2XCFA 4P5OB 1CT0E 4UFFH 1SGPE 1ZTKA 3RPGC 3RXTA 4UI9B 3M37A 1ANCA 2PTNA 4IGDA 2F3CE 3N99A 3F9FA 1DVAH 5EU8A 3RXLA 1UTNA 1K28D 3BTDE 1JWTA 2Y7XA 3VB3A 2ZPRA 4JCNA 2CXVA 4CHAC 3M7KA 3OEED 2D26C 4A5TS 5KH3A 5EW2H 4ZHLU 3RP2A 4H4FA 2CHAC 1WIMA 1T8NA 3QDZB 1DSTA 3O8BA 1C5VA 2J34A 2Y5FA 4WF8A 3ASLA 2KX4A 3DSOA 5KECA 1GI1A 1QA7A 1L2EA 5T6GA 2GCHF 4Y8ZA 5AFYH 3RC5A 2E6SA 3EDXB 1C5NH 3NG2A 5H1UA 1O2MA 3T26A 1AWHB 3ODFA 1INCA 1O5CB 1TRYA 3MTYA 4V3LC 1G2MA 5DGJA 3OE7D 1P12E 3O8RA 1BRUP 1O2HA 4AB8A 1CGIE 5E0GA 3TPIZ 4BAKB 4Z1MD 1KXBA 1QL9A 1FQ3A 1UTMA 1GBAA 2ZGXH 4GSOA 1UTOA 2W5EA 3F9EA 1A3BH 3U8TH 2VU8E 1WDIA 2FTMA 7GCHG 5I25A 4ABHA 1GMDF 4MTBA 4YO9A 3QX5H 3GDUA 5A2MH 3GY6A 2ZKSA 2L43A 1O2GH 4BOHA 3SNEA 1SGTA 2XOYA 2G4UA 3GCNA 1YCPM 1D6WA 4Y79A 4BXSA 4X1SU 4OGXA 2KM0A 3FEHA 1KLTA 5LPEA 4B75A 1TX7A 1LTOA 1BOQA 1D6RA 1MZDA 3SW2B 1VJAU 4K1EA 2A5AA 4DVAU 2GDDA 1TNHA 1GI3A 2V3MA 5FB1A 2FFWA 2ECTA 3P8NA 4Q7XA 2YMSD 1HPGA 3MO6A 1N8OB 5GDSH 2JH6D 3FJUB 3OYPA 1O3IA 4ISIH 5EJZA 3V43A 3GCTF 3OSYA 1BUIA 1IHSH 1YLCA 1UTKA 3SU1A 3VXEH 3ZZDA 1Y3VA 1ETSH 1NT1A 1V2PT 1GI7B 2C4FH 3K9XB 3GCTG 1DFPA 4MVNA 4TT3D 2O9QA 2G6QA 1MM2A 1NM6A 3MNBA 1SLXB 2ANKH 3RU4T 4YC9A 2BD5A 2XBWA 2B7DH 4SGBE 5T1VA 4IN2A 3V12A 3E2DA 2MKEA 1SGFG 3SV6A 8GCHF 3M5LA 2Y7ZA 2UUKB 7LPRA 4TPIZ 3STIA 2QE7D 4RN6A 5JBTA 1U6GB 1C5QA 1EJNA 2XP0A 4Y6DA 5DP9A 1RTLA 2EGMA 1VITF 4IMZA 1MCTA 1OXGA 4N4FA 1P06A 3HKJB 1SGRE 3GL6A 2V7QD 4D7FA 4VGCB 3U28C 1C2MA 1Y3UA 4FUHA 3HK3B 2B8OH 2OBQA 2BDCA 1DY8A 4A4CA 1BQYA 2OK5A 3WWFA 2Z6BD 3KQBA 1DWCH 5EYAF 1WEEA 4WMFA 2CGAA 4Y7BA 2I50A 3SNAA 1UTPA 4VGCC 1QURH 3Q00A 3MQKC 1HAOH 4X8SH 1O3EA 1UK3A 1C5YB 3O70A 1TONA 3ZPVE 1BTZA 1O3NA 4AYCB 2EI7A 4JYVH 2KREA 3EB5A 2A7HA 1IQHA 3UREA 1W3CA 1UVSH 1BT7A 1IQLA 1ZGVA 2WINI 1DY9A 4XFQA 5I3LA 2FX6A 2VJFB 3LT3A 3S9AA 5CDFE 2MT5A 5DK1A 3UNQA 1WTGH 2PKAA 2W26A 3Q77A 3SV8A 3SU4A 3S9BA 5D1MB 1Z71A 4INHA 3SBKA 8LPRA 1JM7B 5DP8A 2PKSB 1KDQA 3SHAH 1GJ5H 2H9EH 4CA1A 4IW4E 3ZZ4A 2BLOA 1FY5A 2XW9A 4AGJA 2KE1A 5JB8S 1CBWB 2OBOA 1A7SA 1TLDA 1XMNB 4I7DA 3LQIA 1NRRH 1GHBG 2J4IA 2ZTZA 1W2KH 4QT8C 4OS6A 4RKOB 1OWKA 2F9NA 2K4DA 3LVRE 3O8DA 4YBSA 2P94A 5C5NA 2G5NA 1EP5A 2HVXA 3N7DA 1AVGH 1CBWC 1K1LA 4U32A 2WSSD 2ZA5A 1C1UH 2ANMH 2FO9A 1Z8JB 2HLCA 4L58A 4NA8A 2BVSH 4CRBA 3ZIAD 2XBXA 3HCUA 3UWIA 2L74A 5GXPA 4P00A 1L4DA 3OTJE 2ZDNA 5L30H 1HNEE 4UP5A 3N9MA 5AVDA 1O30A 1MABB 1C2LA 4THNH 1O2UA 2D8UA 2KCAA 1G36A 5JB9S 2LAUA 2H2ZA 1Y5AT 1QFKH 3MNSA 1O0DH 1BTWA 4Z6AH 2A5KA 1WV7H 1TAWA 4X8VH 2Z9KA 1UK4A 3QUMP 3SJ9A 4RT1A 5A09A 3UB0A 1PQ5A 2HGTH 1AIXH 4GNDA 5DP5A 2G81E 1PQ8A 2GVFA 1QHRB 2XC0A 1WEOA 4ZDTA 3SU2A 1O5AB 1C2HA 1FI8A 1OYQA 3LIWA 2XNDD 1GJAB 1A4WH 1TPOA 4FUGA 3LJUX 4QF3A 2XWBI 3DWDA 2TIOA 4HFPB 5C94A 5DP4A 2WPIS 1AE5A 2Y81A 3KYFA 2SGDE 4NFFA 5GNDA 1A5GH 1UHBB 4K69A 3RXBA 2LXPC 2ZHDA 3ENSB 5A8YA 2QXHA 1MU6B 4ZKNU 2L6OA 1O3KA 5H1TA 1G3EA 2YOLA 1EAUA 2J97A 1P09A 1AN1E 4LK9A 3JZ1B 4GCHG 1QTFA 3QZVA 5SVXA 1C5MD 3OAAD 3BTTE 2FOFA 4ABGA 4FUBA 1FZZA 3SGAE 2FM2A 3WW7A 1LPGB 2CN0H 2PWXA 3UY9A 2HPPH 5A0AE 2PW8H 3RLWH 4K3JA 3MDBC 1Q2WA 1S85A 3SOXA 2TGPZ 1N6YA 1OWJA 5FX5A 3RXJA 4GNFA 3UQOA 2P3TB 2GZ9A 3CP7A 4M7GA 1O3GA 1ORFA 2B9LA 2ECVA 3FP8E 1LMWB 4U30A 4CH2B 3BTQE 4RSPA 1HIAB 3O36A 4ZROA 1AQ7A 3SNDA 1G32B 2RDEA 1FN6A 2BDHA 3LQJA 2DJAA 2KR4A 2EI8A 3KQCA 1WENA 1J16A 3URDA 1YP9A 3RXSA 5T6FA 3W95A 2V6NA 3RMLH 1GJ7B 4IMQA 2ILNA 1GJDB 1BTXA 1ZHPA 1ZMLA 1C2FA 3F6UH 1GG6B 3A87A 5EW1H 1VCPA 3QLPH 2Y43A 4DJZB 4X6OA 2NWNA 4V3KC 1HAIH 4X3GA 1MKWH 1QNJA 5FERA 1GJ6A 1LO6A 1RD3B 2ZHFH 1B7XB 3GISB 3ZZ9A 1T8LA 2VNFA 3FFGA 2RG3A 1S6LA 5L6NH 1WOFA 1GG6C 1H9LB 1PJPA 3GDSA 3RXKA 3O34A 2KAIA 4ZH8A 3GOVB 2XB1A 1OWIA 2W6ID 3SHBA 2SGPE 2OC7A 1B0EA 1PPBH 1C5RA 1V2JT 2A32A 2R3UA 1P10A 2FS9A 3GCOA 3SN8A 4NA9H 1CO7E 1AO5A 3SNBA 2FI3E 1HJ8A 5CHAB 2VIWA 3BEFB 4I8LA 1JIRA 4FETA 1D3DB 1FIWA 1P3EA 4TPYA 1Y5BT 2ESTE 4FU8A 2R2MB 1JRSA 2K0QA 1DVPA 4XE4A 3SUBA 4OM9A 2CRWA 1YPMH 3TVJB 2UWOA 2Z3EA 2BDGA 2LPRA 2CF8H 3CS7A 3ZVZB 1C5ZB 1TIOA 1C2DA 3PTBA 2SNWA 1O3CA 5FHTA 1CHCA 3BTEE 1CHOF 1OHHD 1THRH 1P2OA 2C90B 2O8LA 4WXVA 1GHAF 4K8BA 5C20A 4F52B 3M3SA 1CHOG 4GNEA 4I8KA 1DE7H 2TBSA 1P2JA 4ZXXH 2GZ7A 1W12U 3ATLA 2TGAA 1AU8A 3UNSA 3W94A 1AKSA 2VWLA 3U5NA 4NZQA 4BAOB 4X1PU 5HIYA 2PLXA 5C17A 1VYXA 1XM1A 5AIUA 1TYNA 1BRAA 1EOJA 4DGJA 1LVOA 3KN2A 1GBHA 3KIDU 1C5SA 3F0PA 3LH3A 3C27B 1MTVA 3U9AH 1ZJDA 3E0PB 1VGCC 3HATH 5TDWA 4I8HA 1TWXB 1CGJE 3E8LA 3UWJH 1GJBB 1ZSLA 1ZR0A 2OWAA 1GDQA 4CH8B 1AFQC 1QZ8A 4ASUD 2L7PA 1F5KU 4UEHH 5E2PA 2PGQB 5TCAA 3KCGH 1WUNH 4FU9A 1A5IA 3T62A 2XNIA 3DD2H 1BORA 4W4UA 1G3CA 1P11E 2FTLE 2PHBA 3KGPA 3O37A 1FAXA 2ODPA 3RXFA 4B2CA 4SGAE 4ESTE 3KYGA 2WPMS 5LH8A 2AYWA 1EKBB 4X0WU 3EB6A 3A89A 4LLBA 5JBCS 1OP8A 4DG4A 1MQ5A 1O3MA 2GKVE 3T2NA 4AZ2B 4GHTA 1C1WH 1GMCF 1QR3E 4HGCA 4KP0A 3PMHB 1PPCE 2QXIA 1BHXF 2KR7A 3SV7A 1HB0B 2A4GA 6CHAB 4A1VA 2CV3A 3I29A 4F49A 4CRAA 1O5GH 1FJSA 1HGTH 5I46H 3KL6A 1DITH 3LGYA 5CHBA 3LU9B 5IK2D 3TK6A 1HAYB 1WAYB 1S84A 3SUDA 3SQEE 1WEVA 1GDNA 4JYTA 5FPYA 3RU4E 1SPJA 1NY22 4Y8YA 1C4U2 1G25A 2C8ZB 4YOIA 2F83A 2Q6FA 2ALVA 1J14A 5EXNA 1YLNA 3G01A 3M5OA 4DT4A 3QTOH 5JDUB 3TJNA 2ODYB 4RKJB 3MO9A 2AHME 1K21H 2AMDA 1T32A 3TNSA 3RXUA 1PYTD 2OXQC 4O64A 3I77A 1W8BH 1CGHA 2D8SA 2QJ0A 5L2YH 2VJ1A 5PTPA 1WYKA 3ZNIA 1O37A 3TH3H 1YLDA 1N87A 2C93B 2GDEH 4KKDA 3ZYDA 2J38A 2PTCE 3N9QA 1IHTH 2WUBA 2ANYA 4WY3A 2HALA 3MU0A 1A3EH 5DPAA 2XBYA 5F8ZA 3SHCH 3ZVGA 4DY7B 1F2SE 5IDKA 1W0ZU 2ZU3A 5FB0A 1TBRH 4XRNA 1C5LH 2BDAA 3GY2A 2K1JA 1NTPA 4UP0A 1ZMJA 4AN7A 5C67A 4F1PA 1NFYA 2PR3A 3M61U 2R3YA 5J4QA 3P6ZB 5FCKA 3UFAA 5C1UA 1VZQH 1ELGA 4A92A 2UUYA 3RXDA 2P93A 2AMQA 1QRXA 4ISNA 3Q76A 4KELA 5LPRA 4X6NA 4PPEA 4YT6H 5FBEA 5C0UA 1EAIA 3LRQA 5GCHF 3Q3YA 2ZFRH 1PQAA 4K5ZA 1D3QB 1F92A 1XUKA 1J17T 2HOBA 1V2MT 1LHDH 2BQ7B 2KWJA 1IQJA 1QIXB 1MU8B 2IPHA 3MWIU 4FVBA 4NWKA 4JK5A 2MNZA 2QA9E 2A0QB 3BTHE 3UR9A 2ZG0H 2JETB 2TGDA 3H5CB 2FDAA 5JBAS 3RXHA 1O2IA 1Z6EA 2J2UA 1QJ1B 3M99A 3P92A 1LHGH 4IN1A 3HCSA 1LVYA 4AOQA 3EA8A 3E90B 5HKKD 2LDRA 5SVIB 4UDWH 1HUTH 2FUUA 1HAVB 2B5TB 1F5LA 5FAHA 2Z7FE 2ZHQH 3K6YA 2GMTB 2FOAA 2RR4A 2A31A 2Z9IA 2JRJA 4YADA 2J95A 3VGCB 1WEQA 2KWOA 1Y3WA 1FV9A 2IOTA 4UFGH 2F43B 4UONA 1A0HB 1MZAA 4NWLA 3CENA 1GDUA 4CR5A 2H0DB 1G2LA 1T8MA 1TGTA 1SL3A 3TJVA 1WEPA 2OQ5A 2GCTB 4MNWA 4NSVA 2OUAA 3WY8A 4Z0OA 3MO3A 2CKLA 4ZUHA 3D23A 1UVOA 3PYHA 2VIQA 3ZVEA 1ARCA 3EYDA 3KQEA 4B7YC 1EAWA 4IS5A 2C3SA 1L0ZA 1GL1A 1BRBE 3T7LA 5F8XA 2R9PA 2NU4E 2OD3B 4Z0KA 4A1XA 2RSDA 2JH0D 2GV7A 1WQVH 2P59A 3QGJA 3PMBB 3IWMA 1O2KA 4LADB 1ZTLA 2VPEA 3D65E 1BMMH 4Y7AA 4GNGA 2FEQH 4FUEA 1EPTA 1E0FD 3ZZ6A 1WE9A 3BEUA 4BANB 2VWMA 3I2DA 2YYRA 4C9ZA 4ZMAH 2CF9H 2ZPQA 1MM3A 3K65B 4KTSA 3T6RA 3PMAB 5FX6A 3SU6A 4ABAA 1ETRH 1C5TA 1W10U 2DE9A 3BTWE 3PRBA 3UNRA 1F0RA 1KXDA 1XUJA 2WV4A 4I8GA 3ZZCA 4YM9A 2PGBB 5C5OA 1JM7A 3U1JB 4E06H 1K22H 5B79A 1SOZA 1OWEA 2WPDD 5KH9A 2XCNA 2ZFTA 4ZXYH 3DSGA 3U8RH 1VFYA 2QICA 1F62A 4JZFH 1TBZH 4XBDA 7GCHF 1SHYA 5B78A 1NRQH 3EAJA 3KHVA 1XWHA 1F5RA 2JMIA 4R8PK 4B6EA 1ELAA 4R0IA 3LJOA 3NWUA 4FIPA 3GDVA 2FOMB 1A2CH 4NFEA 1GI6A 1HV7A 1NESE 2FUIA 1ELDE 2P3UB 3PLWA 3UPEA 5D1KB 1C1TA 3EQ0H 4K1TA 3VB4A 4ABFA 4X1NU 3GYMA 4FUDA 3ODDA 1H8ED 3PO1B 1C2EA 3F9GA 2C2VS 1ANBA 3E6PH 3ZPV1 3PLKA 1ZPZA 3OX7U 3RMMH 4TY7A 2STBE 3MOCA 3SUGA 4XSKU 5KEDA 1OWDA 4B74A 4MG3A 2ZIQH 1T7CA 2KWNA 3M7QA 4L7XA 3C6WA 3DUXH 5H4IB 3LDYA 2XC4A 4GUXA 1YM0A 1UJ1A 4GVUA 1SSXA 2M6MA 1EXFA 2ZP0H 3GYLB 1BTHH 2ULLA 3A88A 1DXWA 5LKUA 1BTPA 1Z8IB 1YBWA 1E79D 3V13A 1S0QA 1N8OC 5SGAE 4Q2KA 4FJCA 5SVYA 2ZNKH 4I33A 2G8TA 1J9CH 1GBCA 2IPQX 1G30B 2HNTE 3FZDA 2LNCA 1ZLRA 1DSUA 1V3XA 3NZIA 4Q80A 3NKKA 3H7HA 1ZRBA 1H1BA 5B75A 5C13A 1Z2QA 2YQLA 4A7IB 3PTNA 3R3GB 4D8NA 1ACBE 2ZU1A 2CSVA 1BA8B 5EQQA 3M7UA 2LXHC 4WVPE 3MH5A 1LHEH 2HVYB 2CONA 2RDLA 2Q6DA 3F1SB 1HRTH 1NU7B 1NRPH 4IC3A 3A84A 2ZCLP 3TU7H 1V2UT 3AAUA 5T3HA 1LQEA 4Y71A 4YATA 1TABE 3RXVA 1QL7A 2BLQA 4MLFB 3DPLR 1IQFA 3N9PA 2AMPA 2BXTH 3TGJE 2PFEA 2AEIH 1AD8H 1GI4A 3DSPA 4TWYA 4KTCA 3O8CA 2Y5HA 4O03A 1CT2E 2NU1E 3PRDA 2VJEB 2EGPA 1TMBH 1GBIA 2A1DB 1AVXA 2JMJA 2THFB 2EI6A 1SQTA 2K1QA 1WILA 1BBRH 1K2I1 2GJGA 3QO6A 2FOBA 3PUQA 3TJUA 4B86C 5ESBA 2IDAA 1O2OA 4Q7YA 3M35A 2VH6A 1S82A 1ELCA 1GGDB 1SG8B 1ZPBA 1MTNB 1SFQB 3SORA 3SOUA 2Y80A 4AVXA 2JKHA 5LKZA 1CSOE 3OFND 5K0HA 5FL7D 3MU8A 1U6QA 2W3KA 1S6HA 2BVRH 2TGTA 4I32A 3EE0B 3U5PA 2A4QA 4LZ4B 5TRBA 5HMAA 1VCQA 1GHBF 1RRKA 2DX8A 3SI4H 3BEIB 1EFRD 1GGDC 4YXWD 1MTNC 2G4TA 1ABJH 1F0SA 3BSQA 4CBOA 1DLEA 3M63A 3M36A 1XUGA 2A2XH 1V2QT 2PKSC 4JZ1A 3RXGA 4FO9A 1AUJA 1RFNA 5LPFA 3MNXA 3MFJA 3MHWU 3CS0A 2P8OB 1FX0B 3RC4A 3ATMA 2XC5A 2VB0A 4Y0ZE 2MA5A 1ABIH 4H6TA 2B0FA 4MPUA 3T28A 2K17A 4FOUC 2OXSA 5DG6A 1O5DH 2GX4A 4NA7A 5EJLA 2C8WB 3ZV8A 1TFXA 1V2NT 2ZFSA 3A7ZA 3I78A 2ZDVH 2BVXH 1VJ9U 3BV9B 1J8AA 3OY6U 2BLVA 3SU3A 1EAXA 1SGNE 4CBNA 2YHNA 3ZZ7A 1HYIA 3T27A 2FYQA 4UD9H 4J1YA 3SQHE 4A49A 5F6MA 4B73A 2ODQA 1TNIA 4D7GA 1D9IA 2VPGA 1P2KA 2VH0A 3L1ZB 3KNVA 2M3HA 2ZGBH 4B2AA 1FY8E 1NU9A 1BHXB 4IC2A 2SNVA 1LQDB 1SQRA 2ZEBA 5AFZH 1C1VH 1YPJH 4ISLA 1VITH 5C11A 2VIVA 5ETXA 4WWYA 3BTFE 3HGPA 3RXRA 5G04B 3ZYEA 1DANH 1GBDA 1NROH 2BHGA 4ASHA 2Z9JA 1BMNH 1F0TA 2K16A 4YESB 4B1TA 3ZZ5A 1ZMNA 2WPHS 3RXQA 3L3TA 3U5MA 4D9QA 3L11A 1OKXA 2KCPA 2ZF0H 1AHTH 3K6ZA 4GCHF 2KIZA 1HYJA 2PP6A 1K1JA 1O34A 1A1RA 1FDPA 1O3LA 1W0JD 2FOGA 3PHDA 5KH7A 4OGYA 1CVWH 4LXBH 4ZKSU 1DT2A 2ZZUH 2KZ4A 4BHWA 5J3XA 3E3TA 1IAUA 2VWOA 1HAPH 3OU0A 1F7ZA 1HJ9A 4LOYH 2LGLA 1AFEH 1FY3A 4DW2U 3LH1A 2A7JA 4DIIH 2HYED 1P05A 1IQEA 3KEEA 2G55A 3ITIA 5DP7A 4YT7H 2EODA 1XKBC 5K7RA 1TPPA 3VG8A 1P57B 1FPCH 1MKXH 3M62A 2G52A 3U5OA 2M1RA 1UTLM 3PV5A 1OWHA 4O62A 1C1RA 1W0KD 3LGTA 4Y76A 1J15A 4Z0RA 5H9MA 2BDYA 4HI3A 2YVRA 4BTUB 2AIPA 3F2GA 1EZUC 2BOKA 1S0RA 2PKAB 2C2LA 2FOCA 2YURA 3JUEA 4NIWA 1YPHE 1KDQB 4RT0A 1WSSH 1O33A 1TRMA 1RTKA 2GV6A 3PWBA 3KQ5A 3S7KB 2P16A 4UFEH 5HGGA 1CE5A 1QJ7B 3F2HA 2WPKS 2ZU4A 1BBRK 1ZJKA 1HFDA 2FIRH 1DPOA 2QN5T 1EP6A 1C1QA 2QIQA 2UUJB 3F2FA 1W13U 1CT4E 1P04A 4MNYA 1ZZZA 1FAKH 2AERH 3LGWA 3HPTB 1Z1JA 2BTCE 5HM9A 3RDZA 4BAMB 2YW8A 1OYTH 1TPSA 4WZ3B 1H8HD 1Z7KA 3LC5A 2B0OE 1OP2A 2WYJA 1O36A 1AZ8A 1GCDA 3U1IB 3ZZ8A 4I7CA 3L33A 4DURA 3KV5A 1O2QA 1X4UA 3RMNH 3T29A 1MTWA 3RXCA 3SU5A 5HXFA 1SOTA 2ZFQH 1FXYA 2YHOA 5EXLA 1ZTJA 4ABBA 3FP6E 2XTTB 1GBJA 1Y5UT 3D49H 1P03A 4LKAA 1SQAA 4GPGA 1SMFE 5CHAC 4GAWA 2QIZA 1ETTH 1GWAA 2UUFB 3TLOA 3UOPA 2ZCHP 3BG4B 3MU5A 3FANA 1TNLA 6LPRA 3PLBA 1IQKA 1NC6A 1BZXE 1KTTB 3QZQA 2WV9A 3VFEA 3MH4A 4JMYA 4AFQA 2UZGA 1EZSC 2EY4C 2F9PA 3AASA 2RCEA 1NS3A 2R0LA 2OP9A 3A81A 4NIXA 1Z60A 1JXPA 3IHPA 2F6JA 1WEUA 4DIHH 2HPQH 3MYWA 1T8OA 1AVWA 3BG4C 5FPSA 5IYTA 1TALA 4GLYA 2H9TH 4AORA 1DOJA 3FP7E 5GJ4B 1XUHA 3N7OA 1NZQH 1QRWA 2QXJA 2NU2E 3ZVYA 1YY3A 5JBBS 2XXLA 4NSYA 2L80A 3QZRA 1GI9B 3GCHB 8KME2 3ZYQA 1DWDH 2JDID 4A1TA 1NBMD 5FEYA 4X1RU 1P0SH 1Q3XA 9ESTA 1O3JA 3M3TA 1C1SA 2CSYA 3BTME 2L0BA 2YT5A 3V7TA 1PFXC 4ABIA 1C2GA 5LKXA 1IQNA 4FUCA 1SGQE 1HAVA 1QY6A 3GCHC 2I6QA 1MTUA 2G00A 2F91A 2DE8A 1V2OT 1KSNA 9LPRA 3AAVA 4LK4A 3SOSA 1ESAA 3SV2H 4BTIB 2F9VA 5CMXH 4E7NA 5DJ7A 1HBTH 2H5DA 1C5WB 1O3PB 2R0KA 4ZCNA 1G37A 1GVZA 1ESBA 1FP0A 3O7AA 2BD4A 1OX1A 1V2ST 3RTRB 3GY4A 3ZVBA 5TBNA 2EC9H 5E0HA 3EE7A 5EQSA 4TY6A 3LDXH 2WYGA 1W7XH 2Z94A 2NU3E 3MHSA 4P02A 1G3DA 4ACAA 2BLWA 3PWCA 5B6LA 1MAYA 3LVQE 3NCLA 1C1PA 2BOHB 1QGFA 2VIDA 2ZWLH 1ZGIA 1FY1A 3QGNB 2PSYA 1KXFA 6ESTA 1LDJB 6CHAC 1RXPA 5EJ1A 2ZCKP 1DCQA 3GY7A 2H6MA 2Q1JA 4MNVA 1MKXK 4AYVB 4B71A 1BIOA 1NN6A 5LGOA 4TKPB 2FXRA 4D9RA 3LGUA 2FOEA 2FI5E 2Y6TA 1WESA 1FLEE 2D8WA 2YNBA 3VK6A 3SV9A 1PQ7A 4K8YA 5F03A 5ABWA 1O2VA 1QB1A 3NUMA 2BX4A 2KAIB 3E91A 3H09A 2F9UA 1QQUA 3A8DA 2J98B 1V2TT 4O3TA 2F9OA 1XXDA 1GMHG 4OS4A 1AY6H 2TPIZ 3KDEC 4CCGX 1UO6A 1Z8RA 4TSFD 2BD8A 1C2IA 2QV1A 4B2BA 1SKYE 1UCYH 3ZVFA 2PUXB 3E16B 1O32A 3AVZA 4WXIA 5G0FA 2MA6A 3AW1A 3T25A 4FXGH 1MCVA 2G51A 4YBMA 4Q4LA 2QF5A 1HCGA 1O2NA 2P3FH 3DHKH 3WWBA 2AIQA 3KQDA 5K3QA 5F8TA 2ALPA 1K1IA 1QBNA 4PTBA 4OS5A 2AGEX 1AI8H 3RXPA 3PB1E 1MKWK 4E7RG 3ZTGA 4I8JA 4OGCA 1BJUA 4KTUA 3MH6A 1GPZA 3PROA 4JZIA 3RXMA 1V87A 2KWKA 2VVUA 4YZUA 4NIVA 2IQJA 2QY0B 4X2YA 3VB7A 1GVKB 2W3IA 1WFKA 2LGGA 1AKSB 2A45B 3A85A 1GBFA 1KYNA 3RM2H 3SJOA 1ESTA 2HNTF 2LRIC 1WU1A 1SGIB 1ARBA 2JM3A 2XRCA 3VPKA 2AS9A 1D3TB 2I6SA 3SI3H 3MMGA 1YPHC 3F3BA 3MHHA 5TABA 3TGIE 4AFSA 1MUEB 2ZU2A 3PLPA 2JETC 3MU4A 2QF0A 1UTQA 1O3FA 2CMYA 2WPJS 4YAXA 2JJ2D 4WZ2A 2JIZD 1EX3A 1G3BA 1HXEH 2KFTA 1E34B 2O8UA 4ZKOU 1XUIA 1T4VH 3F9HA 4XD7D 1K1MA 1YYY1 2BY5X 1E1QD 2GMTC 3PURA 1K2FA 6GCHG 1DS2E 1H9IE 1WBGB 1O3AA 5E2OA 3VGCC 1JMOH 1A61H 2FOHA 2ECIA 5KGOA 2VPDA 2IJOB 3A8CA 7KMEH 2QF4A 4WH8A 3HK6B 1GBMA 1NO9H 5BPEA 3TIUA 2GCTC 2IN2A 2CJIA 2A5IA 3R0FA 5FPTA 3F68H 3U98H 1RIWB 2ZO3H 4CHAB 1PPEE 1A0LA 1P9SA 1H8DH 2BY6X 3QK1A 1V2KT 2G43A 1P2IA 2PSXA 2DUCA 5DN6D 1YPLH 2CHAB 2K8IA 5EPYA 2BAYA 2VJEA 5B76A 2ZHWH 2FI4E 3D62A 1RIWC 1ELBA 2Y1MA 1GHWH 1VKYA 3QN7A 3SUEA 4AYCA 3Q3KA 1C4V2 4O97A 4CR9A 2VBCA 3V0XA 2YREA 3P8GA 5AHGH 1W0YH 2ZQ1A 1TB6H 4CRFA 1QBOA 1HAZB 2VJFA 1C1NA 2WPLS 3IG6B 1QB6A 1O2SA 1NFWA 3P95A 4F48B 1YCPH 1EOLA 2MNYA 4BAHB 1WEWA 1L4ZA 3LGIA 1JIMA 3SJKA 4I7BA 1FPHH 4NG9H 3M3VA 1BMLA 4INKA 4MVTA 3DQVR 4PROA 1CU1A 3RM0H 4JYUH 2UWLA 4Y0YE 5HM2A 2GCHG 3TITA 1TGCA 3UQVA 1A0JA 2CSZA 5EG4A 2M2AA 2GGVB 1H9HE 3LKWA 1LDTT 2ZETC 3FZZA 2XOKD 4OS2A 1AMHA 1SHHB 1S83A 1C5UA 2ZECA 3LONA 3B9FH 2WV5A 2SGAA 2LQ6A 4WMEA 3DFLA 4MNXA 1BCUH 3N7EA 5HYOA 4ZQLA 1TMUH 2FLRH 1X4JA 4F4OC 1V2RT 2ZDLA 2WUCA 4A4BA 1YKTA 2QGRA 1O2JA 1FMGA 2BB4A 3L6PA 3VB5A 3DCLA 1SC8U 4BNRA 2EXUA 2V3HH 1MBQA 1FN8A 1MQ6A 1AZZA 1GMDG 1V2LT 3MH7A 1L1GA 4CRDA 3BF6H 3OY5U 2FESH 2MD8C 1WTHD 2A4RA 3ZZ3A 1UCYK 3PO1C 1G9IE 2XWAA 5T6DA 1NPMA 3A7XA 1L1NA 1O5BB 1DUAA 2FODA 2YSJA 3GS9A 2BQ6B 3A7TA 1GL0E 3BTKE 3O35A 1BITA 2ZU5A 4AG2A 2AN6A 4YLUA 5DP6A 1P2MA 1LKBA 3M5NA 1TGSZ 2ZDMA 3U69H 3SNCA 3ZZBA 2G45A 1GBEA 1XUFA 1HAGE 3QTVH 1Z8GA 3A80A 2H5CA 1SBWA 2Z9GA 2ZGHA 5G4BA 4LJNA 1ELEE 4INLA 3MU1A 1P2NA 2SGQE 3UIRA 4H42U 1CA0B 1Y3XA 1K9OE 1LDKC 3FM8C 1ZHRA 1UHBA 1EATA 2KU3A 2J9NA 3LQHA 3RXEA 1VD4A 2BD3A 2OC0A 3O33A 1E38B 1JBUH 2ZPSA 1O3BA 4OS7A 5DP3A 1V2WT 1O2PA 8GCHG 2KFWA 2OC8A 2CKLB 5C3NA 2VVVA 5GWZA 5A8XA 2ZTYA 4ABEA 3VEQB 1ZPCA 1C1MA 1CHGA 3GV4A 3DT0H 1CA0C 3LGVA 1GI2A 1P8VC 2W6JD 4XI1A 5EGMA 1WCZA 1VITG 1SLVB 3OEHD 4IBLH 2KCYA 2KYUA 1P02A 3A83A 2BY7X 1C5OH 3E1XB 1C5PA 1QQ4A 2M5TA 4TYDA 2YNAA 3SYJA 4S3OB 1LHFH 3KF2A 4FUIA 4BXWA 1YGCH 4X8UH 1EPTB 1SI5H 4FVDA 1GI0A 2UWPA 1IYMA 1K1OA 3STJA 1LVMA 2RI7A 4B6FA 1P9UA 1TBQH 1GBBA 1V2VT 1COWD 3P17H 3SGBE 4N3WA 3EA9A 1WQSA 2YUCA 1HIAA 4CRCA 1CQQA 3SZEA 5DSFA 4H9DA 3DDTA 4S3OC 3LJJA 2F6NA 3PMJA 4QF2A 3FN8A 3SGQE 1LCYA 4ZUXU 1ZOMA 2C8XB 1EPTC 1SGEE 1M9UA 3ZVDA 1BTUA 2V3OH 1EZQA 1TOCB 3IITA 1MMJN 3T5FH 2VNTA 5GIBA 3GICB 4IC6A 1OOKB 1GJ9B 1EQ9A 1PYTC 2MD7B 3T9KA 2Z3CA 4O3UA 1E4UA 3Q3XA 1E36B 1HXFH 1GVLA 2XBVA 3SOWA 2XYAA 2OTVA 3TH2H 3TNTA 4AB9A 1MAXA 5JG6A 1SLWB 3HKIB 1BBRE 5L2ZH 4WZ0A 1LPKB 1MH0A 2Y82A 2P8OC 2RFKC 1C9TA 1EASA 4AG1A 2J94A 3B8JA 5A8ZA 1PPZA 1GHXH 1TRNA 3A7VA 1AE8H 1TNKA 5BRRE 4XBBA 3E0NB 2FZZA 5EOKA 1IQIA 1YCPK 1S81A 4FU7A 1MD8A 1TGNA 2SGEE 2ZHEH 3LC3A 1TPAE 4F55A 7ESTE 2PUYA 1AB9B 3SU0A 3ZZAA 5J4SA 4Q63A 2PUQH 1BRCE 3HGNA 3M7TA 4WMDA 1FUJA 1S5SA 4MSXA 1FNIA 2CRRA 1DDJA 2FPZA 2CK3D 5G05B 1SQOA 1Z1IA 3UOUA 3ZVCA 4HZHA 1GJ8B 4NZLA 4BBQA 1AUTC 3MI4A 2BZAA 1TMTH 2KKYA 3BIVH 2XOCA 1T31A 4NGAH 1DWEH 2R2WU 5B77A 1KLIH 4U01A 3RXIA 1AB9C 1E37B 4FUJA 4R7EA 4K1SA 1ELTA 1QCPA 4ZHMU 2ZC9H 4H6SB 4X8TH 2FYRA 3N9LA 4Q7ZA 3TH4H 1O2ZA 1ZYOA 2JUNA 3DFJA 1L1JA 1KXAA 1FONA 1XXFA 1UVPA 2IJD1 2NU0E 1TGBA 4D76A 2EQNA 2A2QH 2A7CA 3KNXA 3TJOA 4AFZA 2EEKA 1GHZA 1IOEA 3TK9A 2TRMA 1UVUH 3JZ2B 3NXPA 4OGEA 1SGCA 1DUEA 2GD4B 2Q6GA 4HG6A 3P8OA 2H1UA 1Y8TA 2FWWA 3SJ8A 3FOAA 1DICA 4Y11E 3F0OA 4MDSA 1K1PA 1RJXB 3OTPA 1O31A 2FD4A 3GY5A 4U2WA 1UW7A 1ELFA 1P2QA 4AX9H 3ATKA 1WGMA 2BD2A 4ABJA 1XVOA 2BY8X 2F9BH 3N9NA 1IQGA 5DKMA 4AYYB 2FX4A 2W7SA 1C5XB 2V35A 3EA7A 1NRNH 1Q31A 3BIUH 3MNCA 2ZGJA 1ZBDB 2EA6A 1XKAC 2BDBA 2ECGA 4AP4A 1GI5A 3EGKH 4ACBA 2VP7A 2YQMA 4E05H 1TNGA 4AUQB 2OCVB 2XEUA 5D1LB 2VWNA 2MIQA 1O2TA 1BJVA 3V3MA 5TCCA 2E61A 2G5VA 2ECWA 2YU4A 1JOUB 3QWCH 3ELAH 1HJAB 1FBVA 4I31A 4K60A 2BX3A 3HTKC 5H1VA 2OINA 3S0NA 8ESTE 5LKTA 1NRSH 1B5GH 1VR1H 2QYIA 3A7WA 2M13A 4ZHAA 3RMOH 4WA6A 5LCWB 1ELVA 3K2UA 4WH6A 1BTYA 2AGIX 3SJIA 4J2YB 1BB0B 1PPHE 1HJAC 2HNTC 1TNJA 2AGGX 1DX5M 1GCTB 3FVFB 2BY9X 1D3PB 3RXAA 4NIYA 2LV9A 1SGFA 1TE0A 1C9PA 2YSMA 1XX9A 3AW0A 4X2XA 3RXOA 4DOQA 1THSH 1BMAA 2GT7A 2ZFFH 5DINA 4AGKA 1RMDA 4UFDH 3DA9B 2KKXA 2QC2A 4NCYA 2Y1NA 1YPGH 3M5MA 5C1YA 4CREA 4X6PA 2FLBH 1X4IA 1TOMH 1DWBH 1GCTC 2J98A 3A8AA 3BN9A 2VGCB 2BYAX 4ISOA 1C2JA 1Y59T 2WZQA 1F0UA 2YMSB 1UTJA 3UR6A 1EJAA 1O2YA 1KIGH 2SFAA 1K1NA 2GT8A 1QRZA 3ATIA 5DKAA 1T1HA 2H9HA 4GHQA 1ZRKA 1ANEA 2ANWA 2ZQ2A 3ATWA 1O35A 4AC9A 2LGKA 4R2YA 5AITA 4R8TB 5CE1A 1PPFE 3NRLA 1KXEA 3HCTA 1X7AC 1HAXB 2VGCC 4B76A 4O9VA 1W14U 2XOZA 2C8YB 1YPEH 1O39A 1TX6A 5GPIB 2YMSC 4BAQB 2EA3A 1TX8A 4LZ1H 1T4UH 3A7YA 1DM4B 2GZ8A 5EPNA 1KXCA 1C4Y2 3S7HB 3A8BA 2P57A 1O3OA 5TDRA 3ESTA 2JH5D 4HTCH 1MBMA 2VIOA
chains in the Genus database with same CATH topology
1SGYE 4XBCA 1SVPA 3GY3A 1GHAG 2OQUA 1N6XA 1MD7A 4MPVA 4ZKRU 3RU4D 2W7UA 4YOGA 1VGCB 1EB2A 4AFUA 1SFIA 1W11U 1HDTH 4X1QU 3URCA 1SLUB 1GHYH 3BTGE 2FS8A 1AFQB 4X2VA 4OS1A 1RS0A 5JYIA 4FUFA 1W7GH 2D1JA 1OPHB 2V0BA 2ZGCA 3P8FA 3PM3A 1AGJA 1XVMA 1GI8B 2J92A 2HWLB 2O8WA 1QL8A 1OS8A 4TWWA 5ESTE 1SR5C 5TJXA 3S69A 2ZTXA 5B6OA 2OLGA 4Y10E 1C1OA 1GBLA 3ZV9A 1LKAA 1KLJH 1O2XA 4I7YH 4X2WA 4XOJA 4JK6A 1TQ7B 1ID5H 4XDEA 2RA3A 4MPWA 1V6DA 2ASUB 2Z3DA 4A6LA 2VVCA 2RA0A 1YF4A 2PV9B 1IQMA 5EODA 1O2WA 2SGFE 2P95A 5EXMA 5A0CA 1GMCG 4KGAA 3GY8A 1EUFA 3SUFA 1PPGE 3UUZA 1TA2A 1MTSA 1GBTA 3TK5A 1O38A 4BTTB 1S6FA 1UMAH 2O8MA 2QXGA 3VXFH 5JPMH 1GMHF 1D4PB 1O5EH 2D2DA 2BZ6H 5A0BA 2BM2A 1E35B 1ZHMA 3LOXA 1P3CA 5FCRA 2FMJA 1GHVH 1SGDE 3VB6A 1LVBA 1H8IH 1O5FH 3U8OH 2ZFPH 1RTFB 3S9CA 1TA6A 3PV4A 3A86A 1A5HA 5C2ZA 1ZSKA 1QBVH 3C1KA 2GP9B 4K2YA 3B23B 2BD7A 4YLQH 2GTBA 2ZI2H 1QJ6B 1O2LA 3LPRA 4YTAA 4UE7H 3NPSA 4MPXA 1DXPA 1GJ4H 3H7TA 5EQRA 3TGKE 4ABDA 3FAOA 1HAHH 1EZXC 1FY4A 5DO4H 1O2RA 1QA0A 3NK8A 1LPZB 2HRVA 1YC0A 1NFUA 4JZDH 1HYLA 2BXUH 5C1XA 2BDIA 1NFXA 2BD9A 2QCYA 2OC1A 4ZAEA 5FXLA 4YOJA 4CRGA 1O3HA 4DCDA 5FBIA 1OSSA 2AH4X 1EB1H 1UVTH 3RLYH 2VINA 1DLKB 1JRTA 4IC5A 5GCHG 1P01A 1UCYE 4WJG2 2Z9LA 3H7OA 3RC6A 1Y3YA 1HLTH 1A46H 5E0JA 1GBKA 2ZDKA 3P70B 6GCHF 2VIPA 2AFQB 1H4WA 1Z6JH 1SB1H 2QAAA 1OP0A 3RUOA 3A82A 1KY9A 4Y8XA 2BMGB 1ANDA 1TQ0B 1AWFH 1GJCB 3SO3A 1EJMA 2O8TA 2Y5GA 1B0FA 1N1LA 2BQWB 2STAE 3UTUH 1THPB 2A4OA 1O3DA 1C2KA 1KTSB 1RGQA 1UK2A 1QB9A 2FP7B 4MQAA 4DT7B 4JZEH 1CA8B 3BG8A 1ZSJA 2QF3A 4ISHH 1YPKH 5E8EH 5AF9H 1VCWA 1FIZA 3SZNA 1BDAA 4X6MA 3ZVAA 1LHCH 2ZDAH 2XCFA 1CT0E 4UFFH 1SGPE 1ZTKA 3RXTA 3M37A 1ANCA 2PTNA 4IGDA 2F3CE 3F9FA 1DVAH 5EU8A 3RXLA 1UTNA 1K28D 3BTDE 1JWTA 2Y7XA 3VB3A 2ZPRA 4JCNA 2CXVA 4CHAC 2D26C 4A5TS 5EW2H 4ZHLU 3RP2A 4H4FA 2CHAC 1T8NA 3QDZB 1DSTA 3O8BA 1C5VA 2J34A 2Y5FA 4WF8A 1GI1A 1QA7A 1L2EA 5T6GA 2GCHF 4Y8ZA 5AFYH 3RC5A 3EDXB 1C5NH 1O2MA 3T26A 1AWHB 3ODFA 1INCA 1O5CB 1TRYA 3MTYA 1G2MA 5DGJA 1P12E 3O8RA 1BRUP 1O2HA 4AB8A 1CGIE 5E0GA 3TPIZ 4BAKB 1KXBA 1QL9A 1FQ3A 1UTMA 1GBAA 2ZGXH 4GSOA 1UTOA 2W5EA 3F9EA 1A3BH 3U8TH 2VU8E 2FTMA 7GCHG 5I25A 4ABHA 1GMDF 4MTBA 4YO9A 3QX5H 3GDUA 5A2MH 3GY6A 2ZKSA 1O2GH 4BOHA 3SNEA 1SGTA 2G4UA 3GCNA 1YCPM 1D6WA 4Y79A 4BXSA 4X1SU 4OGXA 1KLTA 5LPEA 4B75A 1TX7A 1LTOA 1BOQA 1D6RA 1MZDA 3SW2B 1VJAU 4K1EA 2A5AA 4DVAU 2GDDA 1TNHA 1GI3A 3P8NA 4Q7XA 1HPGA 3MO6A 1N8OB 5GDSH 2JH6D 3OYPA 1O3IA 4ISIH 3GCTF 3OSYA 1BUIA 1IHSH 1YLCA 1UTKA 3SU1A 3VXEH 3ZZDA 1Y3VA 1ETSH 1NT1A 1V2PT 1GI7B 2C4FH 3K9XB 3GCTG 1DFPA 4MVNA 2O9QA 1NM6A 3MNBA 1SLXB 2ANKH 3RU4T 2BD5A 2XBWA 2B7DH 4SGBE 4IN2A 3V12A 1SGFG 3SV6A 8GCHF 3M5LA 2Y7ZA 2UUKB 7LPRA 4TPIZ 3STIA 4RN6A 5JBTA 1C5QA 1EJNA 4Y6DA 5DP9A 1RTLA 1VITF 4IMZA 1MCTA 1OXGA 1P06A 3HKJB 1SGRE 4D7FA 4VGCB 1C2MA 1Y3UA 4FUHA 3HK3B 2B8OH 2OBQA 2BDCA 1DY8A 1BQYA 2Z6BD 3KQBA 1DWCH 4WMFA 2CGAA 4Y7BA 3SNAA 1UTPA 4VGCC 1QURH 3Q00A 1HAOH 4X8SH 1O3EA 1UK3A 1C5YB 1TONA 1BTZA 1O3NA 2EI7A 4JYVH 2A7HA 1IQHA 3UREA 1W3CA 1UVSH 1BT7A 1IQLA 1ZGVA 2WINI 1DY9A 4XFQA 2FX6A 3LT3A 3S9AA 5DK1A 3UNQA 1WTGH 2PKAA 2W26A 3Q77A 3SV8A 3SU4A 3S9BA 1Z71A 4INHA 3SBKA 8LPRA 5DP8A 2PKSB 1KDQA 3SHAH 1GJ5H 2H9EH 4IW4E 3ZZ4A 2BLOA 1FY5A 2XW9A 4AGJA 5JB8S 1CBWB 2OBOA 1A7SA 1TLDA 1XMNB 1NRRH 1GHBG 2J4IA 2ZTZA 1W2KH 4QT8C 4OS6A 4RKOB 1OWKA 2F9NA 3O8DA 2P94A 5C5NA 2G5NA 1EP5A 2HVXA 1AVGH 1CBWC 1K1LA 4U32A 2ZA5A 1C1UH 2ANMH 2FO9A 1Z8JB 2HLCA 4NA8A 2BVSH 4CRBA 2XBXA 3UWIA 5GXPA 1L4DA 3OTJE 2ZDNA 5L30H 1HNEE 5AVDA 1O30A 1C2LA 4THNH 1O2UA 1G36A 5JB9S 2H2ZA 1Y5AT 1QFKH 3MNSA 1O0DH 1BTWA 4Z6AH 2A5KA 1WV7H 1TAWA 4X8VH 2Z9KA 1UK4A 3QUMP 3SJ9A 5A09A 1PQ5A 2HGTH 1AIXH 5DP5A 2G81E 1PQ8A 2GVFA 1QHRB 2XC0A 3SU2A 1O5AB 1C2HA 1FI8A 1OYQA 3LIWA 1GJAB 1A4WH 1TPOA 4FUGA 2XWBI 2TIOA 4HFPB 5DP4A 2WPIS 1AE5A 2Y81A 4NFFA 2SGDE 1A5GH 1UHBB 4K69A 3RXBA 2ZHDA 3ENSB 5A8YA 2QXHA 1MU6B 4ZKNU 1O3KA 1G3EA 2YOLA 1EAUA 1P09A 1AN1E 3JZ1B 4GCHG 1QTFA 1C5MD 3BTTE 2FOFA 4ABGA 4FUBA 1FZZA 3SGAE 2FM2A 1LPGB 2CN0H 2PWXA 3UY9A 2HPPH 5A0AE 2PW8H 3RLWH 4K3JA 1Q2WA 1S85A 2TGPZ 1N6YA 1OWJA 5FX5A 3RXJA 3UQOA 2P3TB 2GZ9A 3CP7A 4M7GA 1O3GA 1ORFA 2B9LA 3FP8E 1LMWB 4U30A 4CH2B 3BTQE 4RSPA 1HIAB 4ZROA 1AQ7A 3SNDA 1G32B 1FN6A 2BDHA 2EI8A 3KQCA 1J16A 3URDA 1YP9A 3RXSA 5T6FA 3W95A 2V6NA 3RMLH 1GJ7B 4IMQA 2ILNA 1GJDB 1BTXA 1ZHPA 1ZMLA 1C2FA 3F6UH 1GG6B 3A87A 5EW1H 1VCPA 3QLPH 4DJZB 4X6OA 2NWNA 1HAIH 1MKWH 1QNJA 1GJ6A 1LO6A 1RD3B 2ZHFH 1B7XB 3GISB 3ZZ9A 1T8LA 3FFGA 2RG3A 5L6NH 1WOFA 1GG6C 1H9LB 1PJPA 3GDSA 3RXKA 2KAIA 4ZH8A 3GOVB 1OWIA 2SGPE 2OC7A 1B0EA 1PPBH 1C5RA 1V2JT 2A32A 2R3UA 1P10A 2FS9A 3GCOA 3SN8A 4NA9H 1CO7E 1AO5A 3SNBA 2FI3E 1HJ8A 5CHAB 2VIWA 3BEFB 4I8LA 1JIRA 1D3DB 1FIWA 1P3EA 4TPYA 1Y5BT 2ESTE 4FU8A 2R2MB 1JRSA 4XE4A 1YPMH 3TVJB 2UWOA 2Z3EA 2BDGA 2LPRA 2CF8H 3CS7A 1C5ZB 1TIOA 1C2DA 3PTBA 2SNWA 1O3CA 5FHTA 3BTEE 1CHOF 1THRH 1P2OA 2C90B 2O8LA 4WXVA 1GHAF 4K8BA 5C20A 3M3SA 1CHOG 4I8KA 1DE7H 2TBSA 1P2JA 4ZXXH 2GZ7A 1W12U 3ATLA 2TGAA 1AU8A 3UNSA 3W94A 1AKSA 2VWLA 4NZQA 4BAOB 4X1PU 2PLXA 1XM1A 1TYNA 1BRAA 1EOJA 4DGJA 1LVOA 3KN2A 1GBHA 3KIDU 1C5SA