3FAOA

Crystal structure of s118a mutant 3clsp of prrsv
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDAGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
molecule keywords Non-structural protein
total genus 39
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3faoA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3faoA03
1C1PA 1C1WH 4FVDA 1GBKA 6GCHG 1PQ8A 1B5GH 2A4RA 4CRBA 1B0FA 4FUHA 2Y5HA 2BMGB 1GI7B 2A4QA 3ZZ8A 1SGTA 1BZXE 1NPMA 1V2NT 5PTPA 1L1GA 1A0LA 1BITA 2QF0A 4D9QA 4KTUA 3K6YA 1SL3A 2H1UA 2Y6TA 5A0AE 3KCGH 2QCYA 1KXCA 3BG8A 3A8BA 3MTYA 5C1YA 1AGJA 1A5GH 4IMZA 1ETRH 4HTCH 1MTNC 3TK5A 3HKJB 4ZH8A 1G3EA 2NU1E 1SB1H 1X7AC 1JIRA 3LGIA 4Y6DA 3TU7H 1JRSA 1OWEA 2AGIX 4WJG2 7GCHG 5AFYH 1ZPZA 1SI5H 1W13U 3LH1A 1SGFG 1KDQB 3M35A 3OY5U 2ANKH 2BLVA 2P95A 1UTKA 1DVAH 4MVNA 2C90B 1GPZA 1DS2E 1MBMA 4Q7YA 1SSXA 4TY7A 4ZKOU 2XBXA 3LJJA 3SV8A 2W3IA 1UK2A 3BG4B 1TQ0B 1K21H 3SUEA 4XBDA 1FLEE 4D9RA 3A8CA 3UNRA 2BVSH 2XC4A 3RXUA 4DW2U 1SGFA 2PGQB 3C27B 2W7SA 1QJ7B 1GI6A 3A7XA 1Y3VA 4BTTB 1UVPA 1VCPA 8LPRA 3EE0B 5C5NA 1AHTH 1O3BA 3M7UA 2ZPRA 2PTNA 1AFEH 3M3SA 4B2AA 5DP9A 1EOLA 3U8RH 4FU7A 1O2WA 1HJAB 3RC6A 1NFUA 1HFDA 3VPKA 1AWHB 3PB1E 3DA9B 2WV4A 3UR6A 3PLBA 1GBAA 3GISB 3M3VA 3KQDA 2AEIH 4NA9H 1YPJH 3MFJA 5DPAA 4Y0ZE 2VWMA 5JPMH 1K2I1 1H9HE 1CU1A 2QGRA 2F83A 2Z3EA 1V2TT 5CHAC 4LZ4B 2A5AA 3PWBA 2ZCLP 2OUAA 5AVDA 1ID5H 1G30B 3ATIA 3A8DA 2WPIS 2QIQA 2Z9LA 4A7IB 5LH8A 2BD3A 3D65E 1IQMA 2CHAB 1Z6EA 2D1JA 3BTKE 3B8JA 1O5EH 2QY0B 2BQ6B 1SQTA 4CRFA 7LPRA 1KYNA 2D8WA 3TITA 5L6NH 5LPEA 1UHBA 4H4FA 4XFQA 1IOEA 1DLKB 2GTBA 1C4U2 1O38A 1NO9H 1TRMA 3TJUA 2Y5GA 3QWCH 3RU4D 3LC3A 1E38B 1BOQA 1SLXB 1CE5A 1Z6JH 1BB0B 4Y10E 3KHVA 3GYMA 2PSXA 1O2NA 3MOCA 4A1XA 1TNIA 3QK1A 2H2ZA 4NIYA 1GBEA 3FAOA 3PWCA 1FXYA 4XBBA 4DCDA 2O8LA 2ODQA 2P59A 1KXAA 1KY9A 2ZHFH 5GXPA 4NGAH 5JB9S 4YOJA 1JIMA 1LVMA 3T62A 1O2MA 3ZZ4A 5JB8S 1GI3A 2ANYA 1EB1H 2SNWA 5JBBS 2G4UA 1HYLA 3ELAH 1O5DH 4CR5A 2PTCE 1RD3B 2ZU4A 3OTJE 4FUFA 1W8BH 1LPZB 4LZ1H 1YCPH 1UTLM 1CHOF 3TJNA 2YOLA 1GBMA 3LOXA 1P2QA 1P2KA 1C1OA 1C5LH 1MKXH 2QXHA 2F9BH 3RXBA 1DY8A 3SJ8A 1ZSJA 1ARCA 1ZPCA 1A0JA 1FIWA 1GBLA 2AFQB 2DE8A 4O9VA 3VB6A 5I46H 3MO6A 1F7ZA 3VB3A 3SU6A 1GMCG 1AWFH 4NFFA 5FX6A 1S83A 4NWLA 1AY6H 4IW4E 2EI7A 3TJVA 2FOAA 1F5KU 4YTAA 3JZ2B 2O8TA 1MZAA 2IOTA 3BTME 3OX7U 2PFEA 4X2VA 1TRYA 3RMNH 1C5OH 4JCNA 1AD8H 4A6LA 1NU7B 4B76A 1SGQE 1XUHA 1HJ9A 4FVBA 3QGNB 2G4TA 3Q3KA 2XBWA 4WH6A 3FVFB 3ESTA 3MI4A 4GCHG 1SGNE 1O3JA 3S9CA 2BM2A 2BDYA 2BZ6H 2CGAA 5TJXA 4GHTA 2FOEA 1GJ7B 2HOBA 1K1PA 4HZHA 1CHGA 2ZA5A 1MTWA 3MHWU 3EAJA 1Z8GA 2VIOA 3LU9B 2XXLA 1K1OA 1KLJH 1CGHA 4ABAA 2W7UA 2R0LA 1JMOH 3BV9B 3MU8A 3QZRA 2Z3DA 5C2ZA 1KIGH 2GMTB 2JH5D 3IWMA 2ZU5A 2CF9H 1HAOH 1TOCB 2FO9A 3MMGA 1TIOA 2P3TB 1P2NA 1GJ4H 1MD7A 5JBTA 3RC5A 3SU2A 5E2OA 3KIDU 5C20A 1GJCB 3TK9A 2C8WB 3TGJE 1EXFA 4D8NA 1T8LA 1H4WA 1D6RA 1QQ4A 1YCPM 1V2KT 1LMWB 1OWIA 3IITA 1ZSLA 3E8LA 1D3PB 1K1IA 2ODYB 2Q6GA 3HKIB 1UK4A 1YLDA 1UO6A 1PQ5A 4J1YA 3GCHB 2XCFA 1S82A 2IN2A 5LPRA 1AQ7A 3BTGE 2Y81A 2GZ7A 1QNJA 1SVPA 3L3TA 8ESTE 4X8UH 1FI8A 1HXEH 1LPGB 1A46H 1ZTLA 3EGKH 1AN1E 1GI1A 4UFGH 3AW0A 2Z7FE 2C3SA 2M5TA 5CE1A 4AB9A 2VWOA 1UCYH 1AUJA 1GBFA 4K1TA 3HATH 4Y7AA 1C5MD 4DIHH 4BOHA 6CHAC 1W0ZU 1AVXA 1S85A 1K9OE 1O32A 4DY7B 1FPHH 2ZU2A 1AFQB 4KTCA 3RXHA 1G32B 6LPRA 1ZTKA 3RDZA 2ZDLA 3SUGA 1DITH 1WV7H 4DGJA 1T4UH 3RXVA 1HCGA 1P2JA 4ABBA 4ISOA 4AYYB 1BT7A 1NESE 2C8YB 1BHXB 2ZTXA 1B7XB 1AVGH 1SQAA 1F0SA 3M61U 2A2XH 3SHCH 3LH3A 1ZTJA 1Y3YA 4H6SB 2BD4A 4AORA 1RTFB 4PROA 3TGIE 3ENSB 4OS4A 4IS5A 2UWOA 4Y8XA 2FYRA 1T8OA 2GDEH 2ZQ1A 3A85A 3A89A 3A88A 3R0FA 3VGCB 2G51A 2XYAA 3P70B 3F1SB 3GCTG 2QV1A 2HPQH 3T2NA 5FPTA 2ZZUH 1O37A 1GJDB 1QJ6B 3Q3YA 4Y8ZA 2F9PA 3MH7A 1CA0B 1OOKB 4KGAA 1F5LA 1BRCE 2BY9X 3W95A 3ZVBA 3A7VA 1O3CA 1SR5C 1HLTH 1QB6A 1NRNH 1FONA 3UOUA 4I8JA 3LDXH 3AVZA 3M5MA 2FDAA 4K3JA 4B75A 3GOVB 2EA3A 3NK8A 3S7KB 5DP7A 4ISLA 3U8TH 1ZMLA 1FIZA 2GCTB 3Q00A 3QGJA 2G00A 4BNRA 2JETC 2THFB 1DY9A 1DFPA 1F0UA 1O2GH 1SGYE 3F9GA 3ZZAA 1ZJDA 3I77A 3UNQA 1O3IA 5AF9H 3STJA 3PMAB 1THPB 2V35A 2FESH 3Q76A 1C9PA 4U01A 1G36A 5E2PA 1O2SA 3MU4A 2W5EA 4ESTE 3GYLB 2ZG0H 3TLOA 1WYKA 2PW8H 1C5YB 1VJ9U 2ANWA 3SGAE 1HAYB 4J2YB 2SGFE 3LJOA 5EW2H 3PMJA 2W26A 4B74A 2BOHB 1H1BA 2GKVE 4F49A 4NIXA 2JKHA 3BN9A 2XTTB 2AH4X 1ZGIA 2WV5A 1C1QA 2AS9A 3SNDA 1GVKB 4BAKB 1HAGE 3QUMP 2AGEX 4U32A 1DE7H 2G5VA 3UWIA 4CR9A 3TH4H 4I33A 4UFEH 3GY4A 4KTSA 1N8OC 2UUFB 2EEKA 3JZ1B 5DP8A 1ZJKA 4FU9A 2ZO3H 4X6PA 4X1NU 1MAYA 1EPTA 1V3XA 1LPKB 2J4IA 3AAVA 4GPGA 3KQCA 3BTEE 3RXSA 1FY8E 1O3HA 1EX3A 1GBJA 1GHAF 4A1VA 1FDPA 4KKDA 2FS9A 1FV9A 1O5FH 1F5RA 1J9CH 4SGAE 4CREA 1ELDE 4WY3A 1PYTD 4Y0YE 3KQEA 4E06H 1MU6B 2GCTC 1DX5M 4Q7XA 3LGTA 2PKAB 2P8OB 1ELBA 2BDGA 3BG4C 2OP9A 4WMDA 1HXFH 2V3HH 1GVLA 3F9FA 4NFEA 2HLCA 2SFAA 4WH8A 2XWBI 4YT6H 2VU8E 4NSYA 4X6OA 2ZFTA 2OBQA 3GCNA 3M7TA 2BY8X 1YKTA 5E0GA 3GY6A 1ZR0A 4A92A 4WXIA 2VWNA 2O8WA 4UONA 3TNTA 1IQEA 1FZZA 6GCHF 1QL9A 4IC6A 1O2XA 1K1LA 1V2MT 1O5CB 2Z9KA 1P05A 5A0BA 5F6MA 2HWLB 1BRAA 1NU9A 1TAWA 2F91A 1OWHA 3CENA 1DXPA 1VGCB 1A3EH 1KXEA 2HNTF 4UEHH 4NCYA 2WPHS 3UQVA 4B2CA 2F9OA 2GCHG 1O34A 1P57B 1SGPE 1AKSA 1TBQH 3RXMA 1FAXA 2J38A 4MNYA 1SLWB 2O9QA 2PLXA 4QT8C 1AE8H 1P3CA 4ABGA 1GMDF 5EXLA 4NG9H 3RXLA 1O2OA 1TWXB 1LTOA 1O30A 2H9EH 5F03A 4ABDA 1GHVH 1QGFA 1BTPA 1GDNA 4YZUA 8GCHF 1MCTA 4NWKA 3SW2B 2BDAA 2ZHQH 3URCA 1QBOA 3LKWA 4WXVA 1TNHA 4Z6AH 2WPMS 2ZIQH 1CBWB 4KP0A 1HIAB 1S84A 3GICB 5FX5A 4ZXYH 2ZHEH 3SHAH 3QDZB 6CHAB 1QRWA 5TCAA 5EW1H 2STBE 1C1MA 1G9IE 4ZROA 4JZFH 2TPIZ 1ELFA 4JZ1A 5BRRE 1D4PB 3RXOA 1LKAA 1Y5BT 1O36A 2BB4A 2CF8H 4JMYA 4MLFB 4JYVH 3MWIU 4WVPE 5LPFA 5H4IB 1C1NA 1C2FA 2OCVB 2RA3A 2ZKSA 5EG4A 1SMFE 3PTBA 2J2UA 2FLBH 1C4V2 1T7CA 1TNGA 1WQSA 4FUDA 4NA8A 4B1TA 1C1SA 4K8YA 3E16B 3SNCA 4ZAEA 1UVUH 3QZQA 1A1RA 1DUEA 4CBOA 2ZC9H 1LVBA 1UTOA 1TFXA 2P3UB 3AW1A 3VEQB 1ANBA 3K6ZA 2EI8A 1SGDE 2WINI 1S81A 4MPXA 4H42U 3TH3H 1SQOA 1IHTH 2ZGBH 4X8TH 6ESTA 1Z1IA 3GY7A 3EYDA 1GWAA 3S9BA 1VITH 3QX5H 1OP8A 1BTXA 3TPIZ 1P2IA 2Q6FA 5DP3A 2DE9A 5C67A 1Y5UT 4E05H 4I7YH 3CS7A 1LHCH 2UUYA 1RIWC 1SGRE 1P8VC 1O2ZA 4NIWA 4RN6A 1QURH 1AMHA 1ESAA 1C9TA 1YLCA 1MTSA 4ASHA 1AZ8A 3PTNA 4ZHMU 1A61H 1EP6A 1BMAA 2FI4E 1MBQA 2ESTE 1LHDH 1IQKA 3MH6A 2A4GA 2FX6A 3E90B 2NU0E 3ZV9A 5C5OA 4NZLA 5EPNA 1BA8B 2Y80A 2HALA 2R3YA 4Y79A 1GI8B 1TRNA 2BVXH 2Z9JA 1CBWC 1JWTA 1GJ9B 2GD4B 3O8DA 2PUQH 4R0IA 4K60A 1IQGA 2XW9A 1ELTA 3UWJH 2I6SA 4I32A 1UJ1A 2BY5X 1SPJA 1T32A 4Q7ZA 1O3DA 2V3OH 1C1RA 2WYJA 1BMNH 1C2JA 2FOGA 4WMFA 3MO3A 1ANEA 1N6XA 2RDLA 1P2MA 5JYIA 3BEFB 2BTCE 3W94A 2XRCA 1NFXA 4GUXA 3S7HB 1LHGH 1NFWA 3KN2A 1SGCA 3RXRA 3RXEA 1QQUA 2VWLA 1PFXC 4IN2A 1HAIH 1TPSA 2TIOA 1P0SH 2G8TA 2VVCA 3HGPA 3E0NB 1QCPA 1GMCF 1H8DH 1EAXA 3PROA 1TGCA 2OC8A 5DK1A 1GBDA 1EZXC 5FPYA 3TNSA 3VFEA 1IQFA 1C5NH 4ABFA 3UY9A 2ZGXH 2RA0A 2NU4E 2F9NA 2C4FH 2QA9E 1G37A 1M9UA 5EODA 2HNTC 4X2WA 3A8AA 3QN7A 2ZECA 3V13A 3F9EA 1EAIA 1NROH 4NA7A 2H5DA 1MH0A 3M3TA 2GVFA 4Y7BA 4THNH 4AGKA 3GY8A 2ZDAH 3RXJA 1WAYB 1T8MA 2WPLS 1WSSH 3PMHB 1RGQA 1U6QA 4MNVA 1KSNA 4CH2B 3ZZ6A 2JETB 1NC6A 1TB6H 1HRTH 4B73A 2CMYA 1GI5A 1QTFA 1YPHE 1VZQH 4MPUA 3MNXA 1C5PA 1QFKH 1O3NA 3PV4A 2WPKS 1UMAH 4Q2KA 2Z9IA 4Y76A 3URDA 2FS8A 3N7OA 1A5IA 1QHRB 4OS7A 4TPYA 1EOJA 3T26A 1LO6A 1GGDC 5DG6A 3ZZ5A 2JH6D 1VCQA 2ZHWH 2BD9A 3OSYA 1YGCH 1F0TA 1D9IA 1EPTC 1SOTA 3ZZCA 1PPCE 4JZEH 3LGWA 3RMMH 1MU8B 2ZU3A 3E1XB 1PYTC 3LONA 1K1JA 2KAIA 1P03A 3VGCC 4AG1A 4D76A 1C4Y2 1UTPA 1HB0B 3LC5A 3U1IB 1GMHG 1ZGVA 3SN8A 3TH2H 1TABE 3G01A 1Z1JA 1OKXA 1PPEE 1V2OT 1OSSA 1ZSKA 5IDKA 1O2PA 2BY6X 4YLQH 1MCVA 3O8BA 4ABIA 1BTYA 1ZRBA 3GY2A 2QF3A 1H9IE 3UNSA 1OX1A 2WPJS 4TY6A 4AFUA 1Y3WA 2OBOA 4ZUHA 1EQ9A 1AI8H 2BHGA 3SU4A 3RM0H 2SGPE 1MQ5A 1P12E 2ZTZA 3SV9A 3SGBE 1UVSH 2BX4A 2D26C 1EZSC 1KLTA 1Y8TA 2A31A 1GHWH 3K65B 3V12A 1G2MA 1HNEE 1O5GH 3NXPA 2TBSA 3SU5A 2XWAA 3SJKA 1AE5A 4BAMB 4CBNA 3F6UH 3U98H 5FBEA 5E8EH 5DP6A 2Q6DA 4CH8B 1MTVA 1XX9A 7ESTE 1ESTA 1C5VA 2C8XB 3A7YA 4X6NA 2FOHA 1O33A 5JDUB 4I31A 1O3LA 5J4QA 1BBRK 5T6FA 3Q77A 1GJAB 1TONA 2CN0H 3BIVH 4NSVA 2A4OA 1YPGH 3U9AH 3ATLA 2A32A 1C2EA 1O5BB 1ZPBA 1O2RA 9LPRA 4X6MA 3B9FH 2H5CA 4VGCB 3MNBA 1VR1H 1GG6C 3SJOA 1FY1A 3FZZA 3A82A 4K1SA 2GT7A 1ARBA 2Y5FA 1HAPH 1G3BA 3LGYA 3A83A 1W0YH 4XBCA 1W3CA 3MNSA 4OGXA 3DFJA 3SJIA 1IQHA 3UIRA 3RXCA 2HPPH 2A2QH 3HPTB 4JK5A 3UOPA 2GP9B 1N6YA 1GMDG 1C1UH 1UK3A 5GIBA 5FHTA 3UFAA 3ZZBA 5LGOA 3ZZ3A 1QRXA 1O2QA 2O8MA 1AIXH 1DOJA 1FAKH 1A7SA 4OS1A 1HGTH 1FUJA 1GI4A 3GY3A 3M7QA 5GJ4B 1OP2A 2ZEBA 1TMBH 2KAIB 1BBRH 4X1QU 2FTMA 1ZZZA 1O2IA 2FIRH 3UQOA 1V2PT 2VB0A 2ZQ2A 1UTJA 5A8YA 3BTWE 4MNXA 1O3AA 1C5WB 4O03A 5DO4H 4M7GA 2ZU1A 1GHZA 1DSTA 4FUCA 1K28D 1PPBH 4UFDH 4X1SU 1CQQA 2BDHA 5EQSA 1RXPA 4ABHA 4BAHB 1BRUP 4WMEA 1DANH 1BTWA 4CRCA 1P11E 1DWDH 4TWYA 4K1EA 3D49H 3UPEA 1SOZA 4O3TA 2BQ7B 2R0KA 1ELEE 1BTHH 1GBTA 5HXFA 4X2YA 1SHHB 2VIVA 3KL6A 4DOQA 1NN6A 2A7HA 4IMQA 2A7JA 2PKSB 1L0ZA 1EJAA 2CV3A 2FOMB 2K1QA 1FY5A 1GHAG 1IAUA 3S69A 1J16A 5AFZH 3GDVA 5K7RA 3DD2H 3MU1A 3P8NA 3FP8E 5SGAE 2YNBA 1SFQB 2NU2E 5GWZA 3MH5A 4AG2A 1XUGA 5CHAB 2G5NA 2GDDA 4MNWA 1GBCA 4K69A 2Z3CA 3U1JB 1CVWH 3KNXA 5HGGA 2WUCA 1HAVA 2VINA 1JOUB 1TMUH 1TNLA 1GHYH 5EGMA 2STAE 1VCWA 1OP0A 4YOIA 1ABIH 1K22H 3FZDA 1KTSB 1QJ1B 5L30H 4MQAA 2V0BA 3VB5A 3H5CB 1MZDA 4JZDH 3HK3B 3TGKE 1FJSA 3NUMA 1J17T 5F8XA 8GCHG 2XBVA 4YO9A 3FFGA 1G3CA 2VIQA 1AU8A 2ZFFH 2FI3E 2AIPA 1SC8U 3RXIA 2G81E 2P94A 1TNKA 2BZAA 1NFYA 1WTHD 4TYDA 4E7NA 4AB8A 4TWWA 4XDEA 1TGNA 2UUJB 3M5NA 1JRTA 5ESTE 4DURA 1QL7A 3ZVDA 1GJ8B 5EXMA 8KME2 1C2LA 3VXEH 1ACBE 3PO1C 1W11U 1D3QB 1SBWA 2VNTA 4VGCC 1NTPA 1O35A 1CT2E 3DHKH 1TA6A 4Z0KA 3CS0A 2AERH 1AUTC 1HDTH 4E7RG 1YBWA 4JYTA 4IC5A 1S5SA 1TOMH 5JBCS 4UDWH 1FY3A 3SO3A 2PUXB 4YM9A 2R2WU 4GHQA 4ABEA 5DKMA 1GJBB 1V2ST 3ZYDA 1AVWA 3NWUA 3OYPA 3F68H 4NIVA 3A84A 4X0WU 1TBRH 3NPSA 5ESBA 4AX9H 1KLIH 2AIQA 2ANMH 2OC1A 2OQUA 4X1RU 1WU1A 3MU5A 1ANCA 3ZYEA 1THRH 3SI4H 1DWCH 1TQ7B 2FOCA 2F9VA 2J92A 1ZRKA 4OS6A 1CT0E 3NCLA 4B71A 1GJ6A 1DICA 2VIPA 1O3KA 4IGDA 1GI9B 3U69H 1LVOA 3RXDA 4IN1A 2OTVA 1MUEB 1XKBC 2TGPZ 1C2HA 2OXSA 2QYIA 1MKWK 1Q3XA 7GCHF 1MTUA 4OS2A 1W2KH 4GCHF 4GVUA 2ZP0H 3MH4A 1QBNA 1LVYA 4OS5A 5DP5A 2Z94A 1EKBB 5ETXA 1C2DA 1WUNH 1FPCH 1O3FA 2QXJA 1LKBA 5T3HA 1THSH 3EDXB 3ZVFA 2AGGX 3V0XA 3BTFE 2J34A 3RU4T 4X1PU 3SUDA 3SV2H 2FM2A 3GCTF 1HJ8A 1ANDA 2B8OH 4ZXXH 1BTZA 1GHBF 1T4VH 2BY7X 3PLKA 5C1XA 2OINA 1ELAA 2P93A 4BXSA 3NKKA 1QL8A 3LGUA 1DSUA 3MNCA 2J94A 4DG4A 4ISNA 2A5KA 5IYTA 5L2YH 4INHA 3RLYH 2ZHDA 5I25A 3O8CA 5HM2A 1MD8A 1P02A 3A7TA 1RRKA 2BD8A 1JBUH 3T27A 4MPWA 3A86A 2ZFQH 4DVAU 1YP9A 3L6PA 3RUOA 4IBLH 2PV9B 1H9LB 4XSKU 1SGEE 5A8ZA 1C5RA 2FMJA 1GCTC 1PPZA 3RM2H 2GX4A 3KEEA 1L1NA 1XKAC 5FPSA 1CSOE 1GI0A 1V6DA 3RXFA 3RP2A 2B5TB 4FUGA 2SNVA 4SGBE 2D2DA 3PYHA 1EJNA 1ZHRA 5K0HA 2CJIA 2WYGA 3STIA 1CT4E 1FNIA 1TNJA 2FWWA 3RLWH 1ABJH 2BDIA 5GDSH 1ELGA 1VITF 4I8LA 2P16A 1P04A 1RJXB 4GAWA 2ZF0H 2FTLE 2ZCHP 1XVOA 4RSPA 5DP4A 1TGTA 2R9PA 4INKA 1WOFA 3TJOA 1MQ6A 1OWDA 1C2GA 4UE7H 2GGVB 3MO9A 2ULLA 2BLWA 4MDSA 5F8ZA 1O2HA 4FXGH 1TALA 1NY22 3BIUH 1MAXA 1MKWH 1O3PB 3A7WA 1OXGA 4HFPB 3C1KA 3GY5A 3QO6A 2F9UA 2FLRH 4H6TA 2G55A 3SGQE 3GCHC 1P10A 3DT0H 1KXDA 1KDQA 2FOFA 1GI2A 3E0PB 4UFFH 3A80A 3P92A 3T25A 1O2UA 2ZFSA 3SJ9A 3CP7A 3F9HA 2G52A 2J9NA 3LPRA 5ABWA 1OYTH 3RC4A 3K2UA 1IQLA 1DM4B 2Q1JA 2UWLA 1EZUC 3P8GA 1O3OA 3VB7A 2FPZA 1IHSH 1L2EA 2VGCC 1BJUA 1GHBG 1QA7A 1RFNA 2ZDVH 3U8OH 2VH0A 4BTUB 2XBYA 1YPMH 2P3FH 1L4DA 1V2VT 2EC9H 4AFZA 3TVJB 1DLEA 2HVXA 3E6PH 1AKSB 3AASA 4Y8YA 1A4WH 4ZKSU 4FUEA 1PPHE 5FBIA 4AGJA 2B9LA 3OU0A 1C1TA 7KMEH 1A0HB 1O39A 4MG3A 2H6MA 3FP7E 3ZVCA 4INLA 5FAHA 2LPRA 2J95A 4BAOB 2GZ9A 1SFIA 1G2LA 4U30A 3UTUH 1QA0A 1DPOA 3LGVA 5AHGH 3SNBA 2A1DB 2PKSC 2ZCKP 1C2MA 1O2VA 1BQYA 1GDQA 2GMTC 2LNCA 3WY8A 1T8NA 3R3GB 4WWYA 4BXWA 2XC0A 1QY6A 1NT1A 5G4BA 1AB9B 3ZVEA 1E0FD 2QXGA 5BPEA 4RKOB 4OGYA 5GCHF 5FCKA 3MU0A 4TPIZ 3ZZ7A 1LDTT 1BDAA 3P17H 1V2JT 1ZYOA 2IJOB 3P6ZB 3LIWA 1DWEH 1C5QA 1F0RA 2H9HA 1HUTH 5DGJA 1YPEH 3A81A 3KF2A 3H7TA 1SHYA 2BVRH 1A3BH 1FN8A 5HM9A 3RU4E 1EJMA 1FMGA 9ESTA 3ZZ9A 3A7ZA 3QTOH 3M5LA 1TGBA 1Z7KA 3BEIB 1V2LT 1HJAC 4ABJA 2QC2A 1RTLA 1HAZB 3BTHE 3Q3XA 2BD5A 4ZHLU 3P95A 4ISIH 1GL1A 1RTKA 1BHXF 4LOYH 1XXDA 4DJZB 1IQNA 4CRGA 1PPFE 1C5TA 1B0EA 4BANB 1WBGB 1T31A 2BOKA 4WF8A 2HRVA 1BUIA 5A0CA 1G3DA 1MMJN 4AN7A 1ZMNA 4YLUA 3A87A 4NZQA 2TGAA 1WQVH 2Z9GA 2ZGCA 3ATMA 3D23A 1DWBH 5EQQA 3SUFA 3E91A 1XUKA 1Z8IB 2QN5T 1EATA 3RXTA 1W7GH 2OLGA 3M37A 3MYWA 3RXQA 1EP5A 1O31A 4CHAB 4I8KA 3SQHE 2TGDA 3ZV8A 3ZVGA 4YESB 1KTTB 1W12U 5B6OA 1OWKA 1NRRH 1O0DH 2AMDA 1ELCA 1EZQA 4K2YA 2A5IA 1KXBA 2BLQA 5F8TA 1TGSZ 2GCHF 2FEQH 1O5AB 3E3TA 3P8FA 2BD2A 3HGNA 2ZDMA 1ZHMA 5GCHG 3SI3H 2ZI2H 1TA2A 2TGTA 1D3TB 1KXFA 5L2ZH 2HNTE 1TPAE 1PPGE 2NWNA 4ISHH 1XUJA 2W3KA 3LT3A 1O3MA 2ZDKA 1LCYA 2ALVA 2BQWB 3SNEA 1V2QT 1W10U 3SV6A 5GPIB 1SG8B 1NRQH 1TMTH 1GG6B 4HGCA 1IQIA 1C2KA 3K9XB 1O2YA 4FU8A 4K5ZA 1GBBA 1MKXK 1C5UA 1P01A 1XM1A 1AFQC 2SGAA 1TLDA 4GSOA 1BCUH 1HIAA 1OS8A 1O2LA 1YYY1 1XUFA 1YC0A 2ZFPH 1C5XB 2WUBA 3ODFA 4CRDA 1VITG 1ETTH 1CA8B 1DXWA 1TYNA 1NZQH 3EA9A 2VGCB 2Z6BD 1UVTH 5J4SA 2EI6A 2RCEA 3I29A 4JK6A 1ZHPA 3BF6H 3SV7A 2H9TH 1K1NA 4BTIB 3SU3A 1TPOA 1HAHH 1NM6A 1RIWB 4FUIA 3SOSA 1F92A 1EAUA 2ZTYA 1HAVB 3NZIA 3T29A 1L4ZA 2A45B 4AZ2B 2OD3B 1LQDB 1CO7E 1OPHB 1AB9C 1TX6A 1V2WT 3SZNA 2ZDNA 3PO1B 1HPGA 5E0HA 5FXLA 1PQAA 1TPPA 1C2IA 1N1LA 1OYQA 1RS0A 2PHBA 2BXUH 3V7TA 4ZKRU 2ZPSA 4R8TB 1BMLA 2PKAA 1UVOA 2ASUB 2BD7A 3OY6U 3BSQA 1GMHF 1A5HA 5FCRA 1YCPK 1A2CH 1E34B 1EUFA 1YPHC 1J14A 1WCZA 1P3EA 2ILNA 1UTMA 2AMQA 1VGCC 2ALPA 3M36A 1UCYE 2VJ1A 3FANA 2VVUA 2B0FA 2ZFRH 3D62A 1QB9A 1BMMH 1CGJE 3ATWA 5EOKA 2Y7ZA 4Y71A 5T6DA 1BTUA 1V2RT 4MTBA 1TE0A 1CA0C 3RMLH 4RKJB 3SBKA 3GDSA 4ZKNU 3RMOH 4AFQA 4B2BA 1UCYK 3PLPA 2FX4A 1O2KA 3I78A 1QB1A 3KQBA 4YOGA 4U2WA 5HMAA 1Y5AT 1QRZA 1INCA 2UWPA 4DIIH 1YM0A 1SLVB 2P8OC 3TIUA 4YT7H 1ZMJA 3UREA 2VH6A 3L33A 3RXPA 1HV7A 2AYWA 1NS3A 4KELA 2JH0D 1FY4A 1P09A 1AZZA 2OQ5A 2QAAA 2FOBA 1P2OA 1Q2WA 3EQ0H 3SU0A 2SGEE 2VVVA 2QXIA 3QTVH 2I6QA 1D3DB 1YPKH 1BBRE 3V3MA 4F4OC 5A8XA 1P9UA 1EAWA 4I8HA 5C1UA 5A2MH 1Z8RA 1Y3UA 3DFLA 3HK6B 5JBAS 1XUIA 4X8VH 1JXPA 5A09A 2BXTH 2PGBB 3KGPA 4I8GA 3GDUA 4UD9H 1ESBA 1O2JA 2OC7A 3QLPH 4MPVA 5EPYA 1WTGH 1DT2A 2XNIA 3BTDE 3SU1A 2YNAA 2R2MB 1E36B 2FP7B 4Q80A 2GZ8A 1SGIB 1XVMA 1IQJA 1UHBB 4LXBH 1ORFA 3ODDA 2C8ZB 1J8AA 1ETSH 3EA8A 1O3GA 5HYOA 1W14U 1LHEH 2NU3E 2CXVA 1HAXB 4FUJA 1MTNB 2SGDE 1GGDB 1ZOMA 3BTTE 1GCTB 5CMXH 4ZHAA 2VIWA 1P9SA 1O2TA 2RG3A 3GCOA 2ODPA 5EU8A 3FP6E 1TBZH 1XMNB 2GV6A 1S0QA 2OC0A 3VB4A 1Z71A 2C93B 4O97A 1LQEA 5DJ7A 1ELVA 1OWJA 2FI5E 3T28A 4BAQB 3DUXH 1H8IH 1QIXB 2PR3A 2ZNKH 4LK4A 5C3NA 2ZGJA 1GHXH 1C5SA 1QR3E 2CHAC 3UUZA 1YPLH 1CHOG 2ZGHA 2AMPA 1C5ZB 1AO5A 3O8RA 1K1MA 1O3EA 2Y7XA 2FXRA 4XOJA 1EB2A 1SLUB 1E37B 4JYUH 2XC5A 2A0QB 1GBIA 2A7CA 1Q31A 4K8BA 2HGTH 1D6WA 1P06A 1XXFA 3B23B 2BDCA 1UTNA 1GDUA 2ZWLH 2PSYA 1BIOA 3SNAA 1S0RA 2BLOA 5T6GA 2UUKB 1C1VH 4X8SH 1GL0E 1L1JA 1TX8A 2FZZA 2Y82A 1S6HA 4CRAA 1HBTH 3ATKA 3P8OA 3BEUA 4X2XA 2XCNA 3RXKA 5E0JA 3SORA 1YF4A 2SGQE 1NRSH 4Y11E 5EQRA 4A5TS 4AYVB 1ZLRA 2GT8A 2IPHA 1QBVH 4D7GA 1PJPA 1PQ7A 2TRMA 4O3UA 2FYQA 2GV7A 2PWXA 4D7FA 3RXAA 4HI3A 1GVZA 1F2SE 3TK6A 1GBHA 1N8OB 4AOQA 3H7OA 3ITIA 1DDJA 1NRPH 1S6FA 3UR9A 1DUAA 3RXGA 1E35B 2DUCA 3BTQE 5TCCA 2B7DH 4JZIA 4A1TA 2V6NA 3EA7A 1LHFH 3T5FH 1GCDA 1EASA 1FN6A 4FUBA 1CGIE 2ZPQA 1W7XH 2F3CE 3AAUA 1EPTB 1Z8JB 3S9AA 1FQ3A 2BX3A 4ZMAH 3PMBB 4GLYA 2BDBA 2FODA 4DT7B 3S0NA 1VJAU 3M5OA 1UTQA 3ZVAA 1TX7A 2BYAX 1BJVA 1J15A 3SQEE 3IG6B 2VIDA 1V2UT 3ZZDA 4XE4A 1GJ5H 1BRBE 3VXFH 1Y59T 3PM3A 4AFSA 2R3UA 2O8UA 4CHAC 5EXNA 1Y3XA
chains in the Genus database with same CATH superfamily
1C1PA 1C1WH 4ZDTA 4FVDA 1GBKA 2RDEA 6GCHG 1PQ8A 1B5GH 2A4RA 4CRBA 1B0FA 4FUHA 2QJ0A 2VPGA 3M62A 2Y5HA 3HCTA 2BMGB 1GI7B 2A4QA 3ZZ8A 4ASUD 1SGTA 1BZXE 1NPMA 1V2NT 2M3HA 5PTPA 1L1GA 1A0LA 1BITA 2XOZA 2QF0A 4D9QA 4KTUA 3K6YA 1SL3A 2H1UA 2Y6TA 5A0AE 3KCGH 2QCYA 1KXCA 3BG8A 4I7CA 1DCQA 3A8BA 3MTYA 1E79D 5C1YA 4OGEA 1AGJA 1A5GH 4IMZA 1ETRH 4HTCH 1MTNC 3TK5A 3HKJB 4ZH8A 1G3EA 2NU1E 1WEOA 1SB1H 1X7AC 1JIRA 3LGIA 4Y6DA 3TU7H 1JRSA 1OWEA 2AGIX 5KH9A 2ECWA 4WJG2 7GCHG 5AFYH 1ZPZA 1SI5H 1W13U 3LH1A 1SGFG 1KDQB 3M35A 3OY5U 2ANKH 2YT5A 2KYUA 2BLVA 2P95A 1UTKA 1YWUA 1DVAH 4MVNA 4F48B 2C90B 2LGGA 1GPZA 1DS2E 1MBMA 2ECJA 4Q7YA 1SSXA 4TY7A 4ZKOU 2KM0A 2XBXA 1V87A 3LJJA 2WV9A 3SV8A 2W3IA 1UK2A 1WDIA 3BG4B 1TQ0B 5G05B 1K21H 3SUEA 4XBDA 1FLEE 4D9RA 3A8CA 3UNRA 2BVSH 2XC4A 2ECVA 4F55A 3RXUA 4DW2U 1SGFA 2PGQB 3C27B 2W7SA 1QJ7B 1GI6A 3A7XA 1Y3VA 4BTTB 1UVPA 1VCPA 8LPRA 3EE0B 5C5NA 1AHTH 1O3BA 2IPQX 2ZPRA 3M7UA 2LRIC 2PTNA 1AFEH 3M3SA 4B2AA 1YLNA 3ZVYA 2EY4C 5DP9A 1EOLA 3U8RH 4FU7A 1O2WA 1HJAB 3RC6A 1NFUA 2LN0A 1HFDA 3VPKA 1AWHB 3PB1E 3DA9B 2WV4A 1Z2QA 4B7YC 3UR6A 2VNFA 3PLBA 1GBAA 3GISB 3M3VA 3KQDA 4ZCNA 2AEIH 4NA9H 4YC9A 1YPJH 3MFJA 5DPAA 4Y0ZE 2VBCA 2VWMA 3HCUA 3U5OA 5JPMH 1K2I1 2IJD1 1H9HE 1CU1A 2QGRA 2F83A 2J5UA 2M2AA 2Z3EA 1V2TT 3F0OA 3O36A 5CHAC 4LZ4B 2A5AA 3U5MA 3PWBA 2ZCLP 2OUAA 5AVDA 5HIZA 1ID5H 2W6ID 1G30B 3ATIA 3A8DA 2WPIS 2QIQA 2M13A 2Z9LA 4A7IB 5LH8A 2BD3A 3D65E 5AITA 1IQMA 2CHAB 4PPEA 1Z6EA 2D1JA 3U5NA 3BTKE 3B8JA 1O5EH 2QY0B 2BQ6B 1SQTA 4CRFA 7LPRA 1KYNA 4GNGA 2D8WA 3TITA 5L6NH 5LPEA 1UHBA 4H4FA 4XFQA 4A4CA 1IOEA 1DLKB 2GTBA 1C4U2 1O38A 1NO9H 1TRMA 2FUUA 3TJUA 2Y5GA 3QWCH 3RU4D 3LC3A 3N9PA 1E38B 2UZGA 1BOQA 5DKAA 1SLXB 1CE5A 1Z6JH 1BB0B 4Y10E 3KHVA 3GYMA 2PSXA 1O2NA 3MOCA 4A1XA 1TNIA 1KMHB 3QK1A 2PUYA 2H2ZA 4NIYA 2VJEB 1GBEA 3FAOA 3PWCA 1FXYA 4XBBA 4AC9A 4DCDA 2O8LA 2ODQA 2P59A 1KXAA 1KY9A 2ZHFH 5GXPA 4NGAH 5JB9S 4YOJA 5EIYA 1JIMA 1LVMA 3T62A 1O2MA 3ZZ4A 5JB8S 1GI3A 2ANYA 1EB1H 2SNWA 5JBBS 2G4UA 3ZNIA 1HYLA 3ELAH 4YADA 1O5DH 4CR5A 2PTCE 1RD3B 2KFTA 2ZU4A 3OTJE 4FUFA 1W8BH 2JIZD 1LPZB 4LZ1H 1YCPH 1UTLM 1CHOF 3TJNA 2YOLA 1GBMA 2M6MA 3LOXA 1P2QA 1P2KA 1C1OA 1C5LH 1MKXH 2QXHA 2F9BH 3RXBA 1DY8A 3SJ8A 1ZSJA 4YBSA 1ARCA 1ZPCA 1A0JA 1FIWA 3W1EA 3PLWA 2RFKC 1GBLA 2AFQB 2DE8A 4O9VA 3VB6A 5I46H 2ECGA 3MO6A 1F7ZA 3VB3A 3SU6A 1GMCG 1AWFH 4NFFA 2YYRA 5FX6A 1S83A 4NWLA 2VPEA 1AY6H 4IW4E 2EI7A 3TJVA 2FOAA 1F5KU 4YTAA 3JZ2B 2O8TA 3OEHD 1MZAA 4WA6A 2IOTA 3BTME 3OX7U 2PFEA 3RTRB 4X2VA 1TRYA 3RMNH 1C5OH 2AHME 4JCNA 5FL7D 5LCWB 4GNEA 1AD8H 4A6LA 1NU7B 4B76A 1SGQE 1XUHA 1HJ9A 2QF4A 4FVBA 3QGNB 3T6RA 2JRJA 2G4TA 3Q3KA 4I86A 2XBWA 4WH6A 3FVFB 3ESTA 3MI4A 2VPBA 4GCHG 1SGNE 4YATA 1O3JA 2YSJA 3S9CA 2YW8A 2BM2A 1W0JD 4MVTA 2BDYA 2BZ6H 1N87A 2CGAA 5TJXA 4GHTA 2FOEA 1GJ7B 2HOBA 1K1PA 4HZHA 1CHGA 2ZA5A 2ECTA 1MTWA 3MHWU 3EAJA 1H8HD 1Z8GA 2VIOA 3LU9B 2XXLA 1K1OA 1KLJH 4AUQB 1CGHA 3GL6A 4ABAA 2W7UA 2R0LA 1JMOH 3BV9B 3MU8A 3QZRA 4BHWA 2Z3DA 5C2ZA 1KIGH 2GMTB 2JH5D 3IWMA 2ZU5A 2CF9H 1HAOH 1TOCB 2NAAA 1WILA 2FO9A 3MMGA 1TIOA 2P3TB 1P2NA 1GJ4H 1MD7A 5JBTA 3RC5A 3SU2A 2OXQC 5E2OA 3KIDU 3RPGC 5C20A 3KDEC 1GJCB 2J97A 3TK9A 2C8WB 3TGJE 2VJEA 1EXFA 4D8NA 1T8LA 1H4WA 1D6RA 2BAYA 1QQ4A 1YCPM 1EFRD 1V2KT 1LMWB 1OWIA 3IITA 1ZSLA 3E8LA 1D3PB 1K1IA 2ODYB 2KGGA 2Q6GA 3HKIB 1UK4A 1YLDA 1UO6A 5TBNA 3PRDA 1PQ5A 4J1YA 2C2LA 2G45A 3GCHB 2XCFA 2KR4A 1S82A 2IN2A 5LPRA 1AQ7A 3BTGE 2Y81A 2GZ7A 2LXPC 1QNJA 1SVPA 3L3TA 8ESTE 5LKTA 4X8UH 1FI8A 1HXEH 1LPGB 1A46H 1ZTLA 3EGKH 1AN1E 2WSSD 1GI1A 4UFGH 3AW0A 2Z7FE 2C3SA 2M5TA 2WPDD 5CE1A 4AB9A 1UCYH 2VWOA 1AUJA 5H1UA 1GBFA 4K1TA 3HATH 3U5PA 4Y7AA 1C5MD 4DIHH 1E4UA 4BOHA 6CHAC 2MT5A 5C0UA 1W0ZU 1AVXA 1S85A 4H9DA 4LK9A 1K9OE 1O32A 4DY7B 1FPHH 2ZU2A 1AFQB 2CKLB 4KTCA 3RXHA 1G32B 6LPRA 1ZTKA 3RDZA 2ZDLA 4I7BA 2KX4A 3SUGA 1DITH 1WV7H 4DGJA 1T4UH 3RXVA 1HCGA 1P2JA 3ASLA 4ABBA 4ISOA 4AYYB 1BT7A 1NESE 2EGPA 3O35A 2C8YB 1BHXB 2ZTXA 1B7XB 1AVGH 1SQAA 3N99A 1F0SA 2VJFA 3M61U 2A2XH 3SHCH 3LH3A 1ZTJA 1Y3YA 4H6SB 2BD4A 2D8UA 4AORA 1RTFB 3N9OA 4PROA 3TGIE 3ENSB 4OS4A 4IS5A 2UWOA 4Y8XA 2L0BA 2FYRA 1T8OA 2GDEH 2ZQ1A 3A85A 3A89A 3A88A 3R0FA 3VGCB 3LQJA 2G51A 2XYAA 3P70B 4MSXA 3M99A 3F1SB 2K16A 2MUMA 3GCTG 2QV1A 2HPQH 3T2NA 3QZVA 5FPTA 2ZZUH 1O37A 1GJDB 1QJ6B 3Q3YA 4Y8ZA 2KWNA 2F9PA 3MH7A 1CA0B 1OOKB 1YY3A 2KWKA 4KGAA 1F5LA 1BRCE 4LADB 2BY9X 3W95A 3PHDA 3ZVBA 3A7VA 1O3CA 1SR5C 1HLTH 1QB6A 1NRNH 1FONA 3UOUA 4I8JA 3LDXH 3AVZA 3M5MA 2FDAA 4K3JA 4B75A 3LDYA 3GOVB 2EA3A 3NK8A 3S7KB 5I3LA 5DP7A 4ISLA 3U8TH 1ZMLA 1FIZA 2GCTB 3Q00A 2MD7B 3QGJA 2G00A 4BNRA 2JETC 2THFB 1DY9A 3OTPA 1DFPA 1F0UA 1O2GH 1SGYE 3F9GA 3ZZAA 3OFND 4F52B 1ZJDA 3I77A 3UNQA 1O3IA 5AF9H 3L1XA 3STJA 5TRBA 2CK3D 3PMAB 4F1PA 1THPB 2V35A 2FESH 3Q76A 1C9PA 4U01A 1G36A 3N7DA 2LELA 5E2PA 1O2SA 3MU4A 2W5EA 4ESTE 3GYLB 2ZG0H 3TLOA 1WYKA 2PW8H 1C5YB 1VJ9U 2ANWA 3SGAE 1HAYB 2Y1MA 4B86C 4J2YB 2SGFE 3DSOA 3LJOA 3N9LA 1FX0B 5EW2H 3PMJA 2W26A 4B74A 2BOHB 1H1BA 2GKVE 4F49A 4NIXA 2JKHA 3BN9A 2XTTB 2AH4X 1ZGIA 2MNZA 1IYMA 2WV5A 1C1QA 2AS9A 3SNDA 1GVKB 4BAKB 1HAGE 3QUMP 3FL2A 2AGEX 4U32A 1DE7H 2G5VA 3UWIA 4CR9A 3TH4H 4I33A 4UFEH 3GY4A 2M85A 4KTSA 1N8OC 2UUFB 2EEKA 3JZ1B 5DP8A 1ZJKA 4FU9A 2MNYA 2ZO3H 4X6PA 4X1NU 1MAYA 1EPTA 1V3XA 1LPKB 2J4IA 3AAVA 2YHOA 4GPGA 3KQCA 3BTEE 3RXSA 1FY8E 1O3HA 1EX3A 1GBJA 1GHAF 4A1VA 1FDPA 4KKDA 2FS9A 1FV9A 2DJAA 1O5FH 1F5RA 1J9CH 4SGAE 4CREA 2LXHC 1ELDE 4WY3A 1PYTD 4Y0YE 3KQEA 4E06H 1MU6B 2GCTC 1DX5M 4Q7XA 3LGTA 2PKAB 2HLDD 2L74A 2P8OB 1ELBA 2BDGA 3BG4C 2OP9A 4WMDA 1HXFH 2V3HH 1GVLA 3F9FA 4NFEA 2HLCA 2SFAA 4WH8A 2XWBI 5C17A 5C94A 4YT6H 2VU8E 4NSYA 4X6OA 2ZFTA 2OBQA 3GCNA 3M7TA 2E6SA 2BY8X 2HYED 2MKEA 1YKTA 5E0GA 3GY6A 1ZR0A 4A92A 4LLBA 4WXIA 2VWNA 2O8WA 4UONA 2Y1NA 2KCAA 3TNTA 1IQEA 1FZZA 4R8PK 6GCHF 1QL9A 3SZEA 4IC6A 1O2XA 1K1LA 1V2MT 1O5CB 2KZ4A 2Z9KA 1P05A 5A0BA 2QF5A 5F6MA 2E61A 2HWLB 3O33A 1BRAA 1NU9A 1TAWA 2F91A 1OWHA 3L1ZB 3CENA 2AN6A 1DXPA 4HG6A 4Q63A 1VGCB 1A3EH 1KXEA 2HNTF 4UEHH 4NCYA 2WPHS 3UQVA 4B2CA 2F9OA 2GCHG 2LGLA 1O34A 4QF3A 1P57B 5H1VA 1SGPE 1AKSA 1TBQH 1MM2A 3RXMA 1FAXA 2J38A 4MNYA 2V3MA 1SLWB 3O34A 2O9QA 2PLXA 3O7AA 4QT8C 1AE8H 1P3CA 4ABGA 1GMDF 5EXLA 3C5KA 4P00A 4NG9H 3RXLA 2J98A 1O2OA 1TWXB 1LTOA 1O30A 2H9EH 5F03A 4ABDA 1GHVH 1QGFA 1BTPA 1GDNA 4OGCA 2ZETC 4YZUA 2YMSB 1MCTA 4NWKA 3SW2B 8GCHF 2BDAA 2ZHQH 3URCA 1QBOA 1WEPA 3DWDA 3ZPV1 3LKWA 4WXVA 1TNHA 4Z6AH 2WPMS 5B6LA 2ZIQH 1LDJB 1CBWB 4KP0A 4YBMA 1HIAB 1S84A 2W6JD 3GICB 5FX5A 4ZXYH 2ZHEH 3SHAH 4XD7D 3QDZB 6CHAB 1QRWA 5TCAA 5EW1H 2STBE 1C1MA 4FK5A 1G9IE 4ZROA 4JZFH 2TPIZ 1ELFA 4JZ1A 5BRRE 1D4PB 3DPLR 3RXOA 1LKAA 1Y5BT 3PV5A 1O36A 2BB4A 2CF8H 4JMYA 4MLFB 4JYVH 2RSDA 3MWIU 5KECA 4WVPE 5LPFA 5H4IB 1C1NA 1C2FA 2OCVB 2RA3A 2ZKSA 5EG4A 1SMFE 3PTBA 3HCSA 2G6QA 2J2UA 2FLBH 1C4V2 1T7CA 1TNGA 1WQSA 4FUDA 4NA8A 4B1TA 1C1SA 4K8YA 3E16B 3SNCA 4ZAEA 1UVUH 3QZQA 4GNDA 2KREA 1A1RA 1DUEA 4CBOA 4Q6FA 2ZC9H 1LVBA 1UTOA 1TFXA 2P3UB 3AW1A 3VEQB 1ANBA 5SVIB 3K6ZA 2EI8A 2YQLA 4FO9A 1XWHA 1SGDE 2WINI 5CHBA 1S81A 4Z0RA 3KV5A 4MPXA 1OHHD 4H42U 3TH3H 1SQOA 1IHTH 2ZGBH 4X8TH 6ESTA 3SOUA 1Z1IA 3GY7A 3EYDA 1GWAA 3S9BA 1VITH 3QX5H 1OP8A 2EODA 4YABA 1BTXA 3TPIZ 3AK5A 1P2IA 2Q6FA 5DP3A 2DE9A 5C67A 1Y5UT 2LQ6A 4E05H 4I7YH 3CS7A 1LHCH 2F42A 2JMDA 2UUYA 4GB0A 3V43A 1WEMA 2PNXA 1RIWC 1SGRE 1P8VC 1O2ZA 4NIWA 4RN6A 1QURH 1AMHA 1ESAA 1C9TA 1YLCA 1MTSA 4ASHA 2XEUA 1AZ8A 3PTNA 2CSZA 4FETA 4ZHMU 1A61H 2KIZA 1EP6A 1BMAA 2FI4E 1MBQA 2ESTE 1LHDH 2CRRA 1IQKA 2C2VS 2ECNA 3MH6A 2A4GA 2FX6A 3E90B 2NU0E 3ZV9A 5C5OA 2LDRA 4L58A 1JM7A 4NZLA 5EPNA 5SVXA 3PUQA 1BA8B 2Y80A 2HALA 2R3YA 4Y79A 1GI8B 1TRNA 3ZPVE 2BVXH 2Z9JA 1CBWC 4V3KC 1JWTA 1GJ9B 2GD4B 3O8DA 2PUQH 4R0IA 4K60A 1IQGA 2XW9A 1WEVA 1ELTA 4AYCA 3UWJH 2I6SA 4I32A 1UJ1A 2JMJA 2BY5X 1SPJA 4YXWD 1T32A 4Q7ZA 1O3DA 2V3OH 1G25A 1DVPA 1C1RA 2FOGA 1BMNH 1C2JA 2WYJA 4WMFA 3MO3A 1ANEA 1N6XA 2RDLA 5J3XA 1P2MA 5JYIA 3BEFB 2BTCE 3W94A 2XRCA 1NFXA 4GUXA 3S7HB 1LHGH 1NFWA 2XOKD 3KN2A 1SGCA 2V7QD 3F2GA 3RXRA 3RXEA 1QQUA 2VWLA 1PFXC 4IN2A 1HAIH 4YAXA 1TPSA 2TIOA 1P0SH 2G8TA 2VVCA 3HGPA 3E0NB 1QCPA 1GMCF 1H8DH 1EAXA 3PROA 2OK5A 1TGCA 2OC8A 5DK1A 1WEWA 2J98B 1GBDA 2KGIA 1EZXC 5FPYA 3TNSA 3VFEA 1IQFA 1C5NH 1COWD 5B79A 4ABFA 3UY9A 3SHBA 2ZGXH 2RA0A 2NU4E 2F9NA 2C4FH 2QA9E 1G37A 1M9UA 5EODA 2HNTC 4X2WA 3A8AA 3QN7A 2ZECA 3V13A 3F9EA 1EAIA 1NROH 4NA7A 2H5DA 1MH0A 3M3TA 2GVFA 4Y7BA 4THNH 4AGKA 3GY8A 2ZDAH 3RXJA 2K8IA 1WAYB 2DSMA 1T8MA 2WPLS 4N3WA 1WSSH 3PMHB 3MQKC 1RGQA 2L5UA 3ZTGA 1U6QA 4MNVA 1KSNA 4CH2B 1WIMA 3ZZ6A 2JETB 1NC6A 1TB6H 1HRTH 2YHNA 4B73A 2CMYA 3DQVR 1GI5A 3SUBA 1QTFA 1YPHE 1VZQH 4MPUA 3MNXA 1C5PA 1QFKH 1O3NA 2MA6A 3PV4A 2WPKS 1UMAH 4Q2KA 2Z9IA 4Y76A 3URDA 2FS8A 3N7OA 1A5IA 1QHRB 5H9MA 4OS7A 4TPYA 1EOJA 3T26A 2LGKA 1LO6A 1GGDC 1S6LA 5DG6A 2RR4A 2YU4A 4YBTA 4Z0OA 3ZZ5A 2JH6D 1VCQA 2ZHWH 2QICA 2BD9A 3OSYA 1YGCH 2KR7A 1F0TA 1D9IA 2HVYB 2P57A 1EPTC 1SOTA 3ZZCA 1PPCE 4JZEH 3LGWA 3RMMH 1MU8B 2ZU3A 2QIZA 3E1XB 1WFKA 1JM7B 1PYTC 3LONA 1K1JA 2KAIA 1P03A 3UAIC 3VG8A 3VGCC 4AG1A 4D76A 1C4Y2 1UTPA 1HB0B 3LC5A 4XI1A 3U1IB 1GMHG 1ZGVA 3SN8A 3TH2H 1TABE 1X4IA 5SVYA 3G01A 1Z1JA 1OKXA 1PPEE 1V2OT 1OSSA 1ZSKA 5IDKA 2YURA 1O2PA 2YMSD 2BY6X 3EB5A 5TABA 4YLQH 1MCVA 3O8BA 4ABIA 1BTYA 3EB6A 1ZRBA 3FKSD 3GY2A 4QQ4A 2QF3A 2YMSC 1VD4A 1H9IE 3UNSA 1OX1A 2WPJS 4TY6A 4AFUA 1Y3WA 3T7LA 2OBOA 4ZUHA 1EQ9A 1AI8H 2BHGA 3SU4A 1CHCA 3RM0H 2SGPE 1MQ5A 5IK2D 1P12E 2ZTZA 3SV9A 3SGBE 1UVSH 2BX4A 1Z6UA 2D26C 1EZSC 1KLTA 1Y8TA 2A31A 4TT3D 1GHWH 3K65B 3V12A 1G2MA 1HNEE 1O5GH 3NXPA 2TBSA 3SU5A 2XWAA 5DSFA 1AE5A 3SJKA 4BAMB 4CBNA 3F6UH 3U98H 5FBEA 3FJUB 5E8EH 4XRNA 5DP6A 4CA1A 2Q6DA 4CH8B 1MTVA 1XX9A 7ESTE 1ESTA 1C5VA 2C8XB 3A7YA 4X6NA 2FOHA 1O33A 5JDUB 4I31A 1O3LA 5J4QA 1BBRK 5T6FA 3Q77A 1GJAB 1TONA 2CN0H 3BIVH 4NSVA 4V3LC 5B75A 2A4OA 1YPGH 3U9AH 3ATLA 2A32A 1C2EA 1O5BB 1ZPBA 1W0KD 1O2RA 3WWFA 4X6MA 3B9FH 9LPRA 2H5CA 4VGCB 3H09A 3MNBA 1VR1H 1GG6C 5F53A 3SJOA 1FY1A 3FZZA 3A82A 4K1SA 1MABB 1ARBA 2GT7A 2Y5FA 4O64A 1HAPH 1G3BA 2L6OA 3LGYA 4R7EA 2XNDD 3A83A 1W0YH 4XBCA 1W3CA 3MNSA 4OGXA 3DFJA 4WZ2A 3SJIA 1IQHA 2CONA 3UIRA 5D1LB 3Q1DA 3RXCA 2YREA 2HPPH 2A2QH 3HPTB 4JK5A 3UOPA 2GP9B 1N6YA 1GMDG 2YQMA 1HYJA 1C1UH 1UK3A 5GIBA 5FHTA 3UFAA 3DDTA 3ZZBA 5LGOA 3ZZ3A 1QRXA 1O2QA 2O8MA 1AIXH 1DOJA 1FAKH 1A7SA 4OS1A 1HGTH 1FUJA 1GI4A 3GY3A 3M7QA 1RMDA 5GJ4B 1OP2A 2ZEBA 4WZ0A 1TMBH 2KAIB 3PURA 1BBRH 4X1QU 2FTMA 1ZZZA 1O2IA 2FIRH 3UQOA 1V2PT 2VB0A 2ZQ2A 1UTJA 5A8YA 3BTWE 4AP4A 4MNXA 1O3AA 1C5WB 2E6RA 4O03A 5DO4H 4M7GA 2ZU1A 1GHZA 3F3BA 1DSTA 4FUCA 3GV4A 1K28D 1PPBH 4O62A 4UFDH 4X1SU 1CQQA 2BDHA 5EQSA 4NN2A 1RXPA 4ABHA 4BAHB 1BRUP 4WMEA 2RI7A 1DANH 2KE1A 1BTWA 4CRCA 1P11E 1DWDH 3SOWA 4TWYA 4K1EA 3D49H 3UPEA 3NRLA 1SOZA 4O3TA 3U28C 2BQ7B 2R0KA 1ELEE 5LKZA 1BTHH 1GBTA 5HXFA 2EQNA 4X2YA 1SHHB 2F6NA 2VIVA 3KL6A 4DOQA 1NN6A 2A7HA 4IMQA 2A7JA 2PKSB 1L0ZA 1EJAA 2CV3A 2FOMB 2K1QA 1FY5A 1GHAG 1IAUA 3S69A 1J16A 5AFZH 3GDVA 3KQ5A 5K7RA 3DD2H 3MU1A 3P8NA 3FP8E 5SGAE 2OWAA 2YNBA 1SFQB 2NU2E 5GWZA 3MH5A 4AG2A 1XUGA 5CHAB 2G5NA 2GDDA 4ZUXU 2KWOA 4MNWA 1GBCA 4K69A 2Z3CA 3U1JB 1CVWH 3KNXA 5HGGA 2WUCA 1HAVA 2VINA 1JOUB 1TMUH 1TNLA 1GHYH 5EGMA 2STAE 1VCWA 1OP0A 4YOIA 1ABIH 1K22H 3FZDA 1KTSB 1QJ1B 5L30H 5C11A 4MQAA 2V0BA 3VB5A 3H5CB 1MZDA 4JZDH 2XOYA 3HK3B 3TGKE 1FJSA 3NUMA 1J17T 5F8XA 8GCHG 2XBVA 4YO9A 4CCGX 3FFGA 1G3CA 2VIQA 1AU8A 2ZFFH 1X4UA 5DINA 2FI3E 2AIPA 1SC8U 3RXIA 2G81E 2P94A 1TNKA 2BZAA 1NBME 1NFYA 1WTHD 4TYDA 4E7NA 4AB8A 4TWWA 4XDEA 1TGNA 2UUJB 3M5NA 1JRTA 5ESTE 4DURA 1QL7A 3ZVDA 1GJ8B 5EXMA 8KME2 1C2LA 3VXEH 1ACBE 3PO1C 1W11U 1D3QB 2F4LA 1SBWA 2VNTA 4VGCC 1NTPA 1O35A 3M63A 1CT2E 3DHKH 1TA6A 4Z0KA 3CS0A 2AERH 1AUTC 4TSFD 1HDTH 4E7RG 1YBWA 4JYTA 4IC5A 2YUCA 1S5SA 1TOMH 3WWBA 5JBCS 4UDWH 1FY3A 4S3OC 4UI9B 3SO3A 2PUXB 4YM9A 2R2WU 5EYAF 4GHQA 2FUIA 4ABEA 5DKMA 1GJBB 1V2ST 3F0PA 3ZYDA 3LVQE 2KWJA 1AVWA 3NWUA 3OYPA 3F68H 4NIVA 3A84A 4X0WU 1TBRH 3NPSA 5ESBA 2K0QA 4AX9H 1KLIH 2AIQA 2ANMH 4DT4A 2OC1A 2OQUA 4X1RU 1WU1A 3MU5A 1ANCA 3ZYEA 1THRH 3SI4H 1DWCH 1TQ7B 2FOCA 2F6JA 2F9VA 2J92A 1ZRKA 4OS6A 1CT0E 4LJNA 3NCLA 4B71A 1GJ6A 1DICA 2VIPA 1O3KA 4IGDA 1GI9B 3U69H 1LVOA 3RXDA 4N4FA 4IN1A 2OTVA 1MUEB 1XKBC 4RT1A 2TGPZ 1C2HA 2OXSA 2QYIA 2F43B 4A4BA 1MKWK 1Q3XA 7GCHF 1MTUA 4OS2A 1W2KH 4GCHF 4GVUA 1QZ8A 2ZP0H 3MH4A 2QE7D 1QBNA 5EJZA 1LVYA 4OS5A 2EXUA 5DP5A 2Z94A 1EKBB 5ETXA 1C2DA 1WUNH 1FPCH 1O3FA 2QXJA 1LKBA 5T3HA 1THSH 3EDXB 3ZVFA 2AGGX 4L7XA 3V0XA 3BTFE 1VYXA 2J34A 3RU4T 4X1PU 3SUDA 3SV2H 1WGMA 2FM2A 3GCTF 1HJ8A 1ANDA 2B8OH 4ZXXH 2IQJA 1VKYA 1BTZA 1GHBF 1T4VH 2BY7X 3PLKA 5C1XA 2OINA 1ELAA 2P93A 4BXSA 3F2HA 1QL8A 3LGUA 3NKKA 1DSUA 3MNCA 2J94A 4DG4A 4ISNA 4I7DA 2A5KA 5TDRA 5IYTA 5L2YH 4INHA 3RLYH 2ZHDA 5I25A 3O8CA 5HM2A 1MD8A 1P02A 1E1QD 3A7TA 4P5OB 3LQHA 1RRKA 2L43A 2BD8A 1JBUH 3T27A 4MPWA 3A86A 2ZFQH 2MA5A 4DVAU 4IC2A 1SQRA 1YP9A 2K1JA 3L6PA 3RUOA 4IBLH 2JDID 2PV9B 3OAAD 1H9LB 4XSKU 1SGEE 5A8ZA 1C5RA 2FMJA 1GCTC 4ZQLA 1PPZA 2L80A 2HDPA 3RM2H 2GX4A 3KEEA 1L1NA 1XKAC 5FPSA 1CSOE 1GI0A 1V6DA 3RXFA 5EJ1A 3RP2A 2B5TB 1WXRA 4FUGA 2SNVA 4SGBE 2D2DA 4FIPA 3PYHA 1EJNA 1ZHRA 3PV2A 2VJFB 5KGOA 5K0HA 2CJIA 1WESA 2WYGA 3STIA 4GNFA 1CT4E 1FNIA 1TNJA 1FP0A 2FWWA 3RLWH 1ABJH 2BDIA 5GDSH 2JM3A 1ELGA 1VFYA 4Z1MD 4B6EA 1VITF 4I8LA 2P16A 1P04A 1RJXB 2WHXA 4GAWA 2ZF0H 2FTLE 2ZCHP 1XVOA 4RSPA 5DP4A 1TGTA 2R9PA 4INKA 1WOFA 3TJOA 1MQ6A 1OWDA 1C2GA 4UE7H 2GGVB 3MO9A 2ULLA 2BLWA 4MDSA 4S3OB 5F8ZA 1O2HA 4FXGH 1TALA 1NY22 3BIUH 1MAXA 2LAUA 1MKWH 1O3PB 3A7WA 1OXGA 4HFPB 3C1KA 3GY5A 3QO6A 2F9UA 2FLRH 4H6TA 2G55A 5FB1A 3SGQE 4ACBA 3GCHC 1P10A 2I50A 5D1KB 3DT0H 1KXDA 5DN6D 1KDQA 2FOFA 1GI2A 3E0PB 4UFFH 2XB1A 3A80A 3P92A 3T25A 1O2UA 2ZFSA 3SJ9A 3CP7A 3F9HA 2G52A 2J9NA 3LPRA 5ABWA 1OYTH 3RC4A 5TDWA 3K2UA 3T9KA 1IQLA 4RI0A 3KV6A 5LKUA 1DM4B 2Q1JA 2UWLA 5B78A 1EZUC 3P8GA 1O3OA 3VB7A 2FPZA 1IHSH 1L2EA 2VGCC 1BJUA 1GHBG 1QA7A 1RFNA 2ZDVH 2DX8A 1NBMD 3U8OH 1WEQA 2VH0A 4BTUB 2FD4A 2XBYA 4ACAA 1YPMH 2P3FH 1L4DA 3ZIAD 1V2VT 2EC9H 4AFZA 3TVJB 1DLEA 2HVXA 3E6PH 1AKSB 3AASA 4Y8YA 1A4WH 4ZKSU 4FUEA 1PPHE 5FBIA 4AGJA 4Q4LA 2B9LA 2L7PA 3OU0A 4M9FA 5B77A 1C1TA 5C0TA 7KMEH 3EE7A 1A0HB 1O39A 4B6FA 4MG3A 2H6MA 2B0OE 3FP7E 3ZVCA 2FFWA 4INLA 5FAHA 2LPRA 2J95A 1E1RD 4BAOB 4W4UA 4TKPB 2XOCA 2GZ9A 1SFIA 1G2LA 4U30A 3UTUH 1WENA 1QA0A 1DPOA 3LGVA 5AHGH 2ECIA 3SNBA 2A1DB 1WEEA 3MDBC 2PKSC 2ZCKP 1C2MA 1O2VA 1BQYA 1GDQA 2GMTC 2LNCA 3WY8A 1T8NA 5T1VA 5CDFE 3O37A 3R3GB 1WEUA 4WWYA 4BXWA 2XC0A 1QY6A 1NT1A 5G4BA 1AB9B 3ZVEA 3HTKC 1E0FD 5KEDA 2QXGA 5BPEA 4RKOB 4OGYA 5GCHF 5FCKA 3MU0A 4TPIZ 3ZZ7A 1LDTT 1BDAA 3P17H 1K0HA 1V2JT 1ZYOA 2H0DB 2IJOB 3P6ZB 3LIWA 1DWEH 2JJ1D 1C5QA 1F0RA 2H9HA 1HUTH 5DGJA 1YPEH 3A81A 3KF2A 3H7TA 1SHYA 2BVRH 1A3BH 1FN8A 5HM9A 3N9MA 3RU4E 1EJMA 1FMGA 9ESTA 3ZZ9A 5JG6A 3A7ZA 3QTOH 4A49A 3M5LA 1TGBA 1Z7KA 3BEIB 1V2LT 2MIQA 1MM3A 1HJAC 4ABJA 3IHPA 2QC2A 1RTLA 2Y43A 1H8ED 1HAZB 3BTHE 3Q3XA 2BD5A 4ZHLU 4PTBA 3P95A 4ISIH 1GL1A 1RTKA 3LQIA 2KKXA 1BHXF 4LOYH 1XXDA 4DJZB 1IQNA 4CRGA 1PPFE 1C5TA 1B0EA 4BANB 1WBGB 1T31A 2BOKA 5B76A 4WF8A 2HRVA 2K4DA 1BUIA 5A0CA 1G3DA 1MMJN 4AN7A 1ZMNA 4YLUA 3A87A 4NZQA 3MHSA 2TGAA 3ZVZB 2PP6A 1K2FA 1WQVH 2Z9GA 2ZGCA 3ATMA 3RPGB 3D23A 1DWBH 5EQQA 3SUFA 4AVXA 3E91A 1XUKA 1Z8IB 2QN5T 1EATA 3MHHA 3RXTA 1W7GH 2OLGA 3M37A 3MYWA 3RXQA 1EP5A 1O31A 4CHAB 4I8KA 3SQHE 2TGDA 3OE7D 3ZV8A 3ZVGA 4YESB 1KTTB 4QF2A 1W12U 5B6OA 1OWKA 1NRRH 1O0DH 2AMDA 5B8DA 1ELCA 1EZQA 4K2YA 2A5IA 1KXBA 2BLQA 5F8TA 5FB0A 1TGSZ 2GCHF 2FEQH 1O5AB 2KCPA 3E3TA 3P8FA 3H7HA 2BD2A 3HGNA 2ZDMA 1ZHMA 5GCHG 3SI3H 1F62A 4LKAA 2ZI2H 1TA2A 2TGTA 4P02A 1D3TB 1KXFA 5L2ZH 5EJLA 1UW7A 2HNTE 1TPAE 1PPGE 2NWNA 4ISHH 1XUJA 2KFWA 2W3KA 3LT3A 1O3MA 2ZDKA 4UP0A 1LCYA 2ALVA 2BQWB 3DSPA 3SNEA 1V2QT 1W10U 2KCYA 3SV6A 5GPIB 1SG8B 1NRQH 1TMTH 1GG6B 4HGCA 1IQIA 1C2KA 3K9XB 3E2DA 2H0DA 5G04B 1O2YA 3KYGA 4FU8A 1GBBA 4K5ZA 1MKXK 1C5UA 1P01A 1XM1A 1AFQC 2SGAA 1X4JA 5LKXA 1TLDA 4GSOA 1BCUH 1HIAA 1OS8A 3LVRE 1O2LA 1YYY1 1XUFA 1YC0A 2ZFPH 1C5XB 2WUBA 3ODFA 2G43A 4CRDA 5D1MB 1VITG 1ETTH 1CA8B 1T1HA 1DXWA 1TYNA 1NZQH 3EA9A 2VGCB 2Z6BD 5K3QA 1UVTH 5J4SA 3VK6A 2EI6A 2RCEA 3I29A 4JK6A 1ZHPA 3N7EA 3BF6H 3SV7A 2H9TH 3KYFA 1K1NA 4BTIB 3SU3A 1TPOA 1BMFD 1HAHH 1NM6A 1RIWB 4FUIA 3SOSA 1F92A 1EAUA 2ZTYA 1HAVB 3NZIA 3T29A 1L4ZA 2A45B 4AZ2B 2OD3B 1LQDB 1CO7E 1OPHB 1AB9C 1TX6A 1V2WT 3SZNA 2ZDNA 3PO1B 1HPGA 5E0HA 5FXLA 1PQAA 1TPPA 1C2IA 1N1LA 3NG2A 1OYQA 3KQIA 2PHBA 1RS0A 2BXUH 3V7TA 4ZKRU 2ZPSA 4R8TB 1BMLA 4C9ZA 2PKAA 1UVOA 2ASUB 2BD7A 3OY6U 3BSQA 1GMHF 1A5HA 5FCRA 1YCPK 1A2CH 1E34B 1EUFA 1YPHC 1J14A 1WCZA 1P3EA 3LRQA 2ILNA 1UTMA 5GNDA 3ZYQA 4WZ3B 4A0CD 2AMQA 1VGCC 2ALPA 3M36A 1UCYE 2VJ1A 3FANA 2VVUA 3FM8C 2VP7A 2B0FA 2ZFRH 3D62A 1QB9A 5HKKD 1BMMH 1CGJE 3ATWA 5EOKA 2Y7ZA 4Y71A 5T6DA 1BTUA 1V2RT 4MTBA 2IDAA 1TE0A 1CA0C 3RMLH 4RKJB 3SBKA 3GDSA 4ZKNU 3RMOH 2XP0A 3N9QA 5FERA 4AFQA 4B2BA 1UCYK 3PLPA 2FX4A 1O2KA 3I78A 1QB1A 3KQBA 4YOGA 4U2WA 5HMAA 1Y5AT 1QRZA 1INCA 2UWPA 4FOUC 4DIIH 1YM0A 1Z60A 2VPDA 5G0FA 1SLVB 2P8OC 3TIUA 4YT7H 1ZMJA 3UREA 2VH6A 3L33A 3RXPA 1HV7A 1JOCA 2AYWA 3UB0A 1NS3A 4KELA 2JH0D 4BBQA 3N9NA 1FY4A 1P09A 2MD8C 1AZZA 2OQ5A 2QAAA 2FOBA 1P2OA 1Q2WA 3EQ0H 3SU0A 2SGEE 2VVVA 2QXIA 3QTVH 2I6QA 1D3DB 1YPKH 1BBRE 3V3MA 4F4OC 5A8XA 1P9UA 1EAWA 4I8HA 5C1UA 5A2MH 1Z8RA 1Y3UA 3DFLA 5C13A 3HK6B 5JBAS 1XUIA 3JUEA 4X8VH 1JXPA 5A09A 2YSMA 2BXTH 2PGBB 3KGPA 4I8GA 3GDUA 4UD9H 1ESBA 1O2JA 2OC7A 3QLPH 4MPVA 5EPYA 1WTGH 1DT2A 2XNIA 3BTDE 3SU1A 2YNAA 2R2MB 1E36B 2FP7B 4Q80A 2GZ8A 1SGIB 1XVMA 2LGVA 1IQJA 1UHBB 3F2FA 3M7KA 4LXBH 1ORFA 3ODDA 2C8ZB 3DSGA 1J8AA 3KNVA 1ETSH 3EA8A 1O3GA 5HYOA 1W14U 1LHEH 4OM9A 2NU3E 2CXVA 1HAXB 4FUJA 1MTNB 2SGDE 2KU3A 1GGDB 1ZOMA 2FSAA 3BTTE 1GCTB 1SKYE 1ZBDB 2CT2A 5CMXH 3I2DA 4ZHAA 5SVIA 2VIWA 1P9SA 1O2TA 1LDKC 2RG3A 3GCOA 2ODPA 5H1TA 3FO8D 3O70A 2JUNA 3OEED 5EU8A 3FP6E 1FBVA 1TBZH 1XMNB 2GV6A 1S0QA 2OC0A 3VB4A 5HIYA 1Z71A 2C93B 4O97A 1LQEA 5DJ7A 1ELVA 1OWJA 2FI5E 3T28A 1U6GB 1BORA 2L75A 4BAQB 3DUXH 2JJ2D 1H8IH 1QIXB 2PR3A 2ZNKH 4LK4A 5C3NA 1HYIA 2ZGJA 1GHXH 1C5SA 1QR3E 2CHAC 3UUZA 1YPLH 1CHOG 2CSYA 2ZGHA 2AMPA 1C5ZB 1AO5A 3O8RA 1K1MA 1O3EA 2Y7XA 2FXRA 4XOJA 1EB2A 1SLUB 1E37B 4JYUH 2CSVA 2XC5A 5KH7A 2A0QB 2LV9A 3CNRA 1GBIA 2A7CA 1Q31A 5FEYA 4K8BA 2KKYA 2HGTH 1D6WA 1P06A 1XXFA 3B23B 2BDCA 1UTNA 2CKLA 3PRBA 1GDUA 2ZWLH 2JMIA 2EGMA 2PSYA 2WZQA 1BIOA 3SNAA 1S0RA 2BLOA 5T6GA 4UP5A 2UUKB 1C1VH 2LP6A 4X8SH 1GL0E 4AYCB 1L1JA 1TX8A 2FZZA 2Y82A 1S6HA 3GS9A 3C6WA 4CRAA 1HBTH 3ATKA 3L11A 3P8OA 3BEUA 3FOAA 2XCNA 4X2XA 3RXKA 3FN8A 5E0JA 2GJGA 3SORA 1YF4A 2SGQE 5AIUA 1NRSH 4Y11E 5EQRA 4A5TS 4AYVB 1ZLRA 4FJCA 2GT8A 2IPHA 1QBVH 4D7GA 1PJPA 1PQ7A 2D8SA 2TRMA 3FEHA 4O3UA 2FYQA 2GV7A 3DCLA 2PWXA 4D7FA 2KCOA 3RXAA 4HI3A 1GVZA 1F2SE 3TK6A 1GBHA 1N8OB 4AOQA 2M1RA 3H7OA 3ITIA 3SOXA 1DDJA 1NRPH 1S6FA 3UR9A 2YVRA 1DUAA 3RXGA 1E35B 2DUCA 3BTQE 5TCCA 3LJUX 2B7DH 4JZIA 4A1TA 2V6NA 3O47A 3EA7A 5KH3A 1LHFH 3T5FH 2EA6A 1GCDA 1EASA 4X3GA 1FN6A 2K17A 4FUBA 1CGIE 2ZPQA 1W7XH 2F3CE 2CRWA 3WW7A 3AAUA 1EPTB 1Z8JB 3S9AA 1FQ3A 2BX3A 4ZMAH 3PMBB 4IC3A 4GLYA 2BDBA 1WE9A 2FODA 4DT7B 3S0NA 1VJAU 3M5OA 1UTQA 3ZVAA 4RT0A 1TX7A 2BYAX 4R2YA 1BJVA 1J15A 3SQEE 3IG6B 2VIDA 1V2UT 3SYJA 3ZZDA 4XE4A 1GJ5H 1BRBE 3VXFH 1Y59T 3PM3A 4AFSA 2R3UA 2O8UA 4CHAC 5EXNA 1Y3XA
chains in the Genus database with same CATH topology
1C1PA 1C1WH 4FVDA 1GBKA 6GCHG 1PQ8A 1B5GH 2A4RA 4CRBA 1B0FA 4FUHA 2Y5HA 2BMGB 1GI7B 2A4QA 3ZZ8A 1SGTA 1BZXE 1NPMA 1V2NT 5PTPA 1L1GA 1A0LA 1BITA 2QF0A 4D9QA 4KTUA 3K6YA 1SL3A 2H1UA 2Y6TA 5A0AE 3KCGH 2QCYA 1KXCA 3BG8A 3A8BA 3MTYA 5C1YA 1AGJA 1A5GH 4IMZA 1ETRH 4HTCH 1MTNC 3TK5A 3HKJB 4ZH8A 1G3EA 2NU1E 1SB1H 1X7AC 1JIRA 3LGIA 4Y6DA 3TU7H 1JRSA 1OWEA 2AGIX 4WJG2 7GCHG 5AFYH 1ZPZA 1SI5H 1W13U 3LH1A 1SGFG 1KDQB 3M35A 3OY5U 2ANKH 2BLVA 2P95A 1UTKA 1DVAH 4MVNA 2C90B 1GPZA 1DS2E 1MBMA 4Q7YA 1SSXA 4TY7A 4ZKOU 2XBXA 3LJJA 3SV8A 2W3IA 1UK2A 3BG4B 1TQ0B 1K21H 3SUEA 4XBDA 1FLEE 4D9RA 3A8CA 3UNRA 2BVSH 2XC4A 3RXUA 4DW2U 1SGFA 2PGQB 3C27B 2W7SA 1QJ7B 1GI6A 3A7XA 1Y3VA 4BTTB 1UVPA 1VCPA 8LPRA 3EE0B 5C5NA 1AHTH 1O3BA 3M7UA 2ZPRA 2PTNA 1AFEH 3M3SA 4B2AA 5DP9A 1EOLA 3U8RH 4FU7A 1O2WA 1HJAB 3RC6A 1NFUA 1HFDA 3VPKA 1AWHB 3PB1E 3DA9B 2WV4A 3UR6A 3PLBA 1GBAA 3GISB 3M3VA 3KQDA 2AEIH 4NA9H 1YPJH 3MFJA 5DPAA 4Y0ZE 2VWMA 5JPMH 1K2I1 1H9HE 1CU1A 2QGRA 2F83A 2Z3EA 1V2TT 5CHAC 4LZ4B 2A5AA 3PWBA 2ZCLP 2OUAA 5AVDA 1ID5H 1G30B 3ATIA 3A8DA 2WPIS 2QIQA 2Z9LA 4A7IB 5LH8A 2BD3A 3D65E 1IQMA 2CHAB 1Z6EA 2D1JA 3BTKE 3B8JA 1O5EH 2QY0B 2BQ6B 1SQTA 4CRFA 7LPRA 1KYNA 2D8WA 3TITA 5L6NH 5LPEA 1UHBA 4H4FA 4XFQA 1IOEA 1DLKB 2GTBA 1C4U2 1O38A 1NO9H 1TRMA 3TJUA 2Y5GA 3QWCH 3RU4D 3LC3A 1E38B 1BOQA 1SLXB 1CE5A 1Z6JH 1BB0B 4Y10E 3KHVA 3GYMA 2PSXA 1O2NA 3MOCA 4A1XA 1TNIA 3QK1A 2H2ZA 4NIYA 1GBEA 3FAOA 3PWCA 1FXYA 4XBBA 4DCDA 2O8LA 2ODQA 2P59A 1KXAA 1KY9A 2ZHFH 5GXPA 4NGAH 5JB9S 4YOJA 1JIMA 1LVMA 3T62A 1O2MA 3ZZ4A 5JB8S 1GI3A 2ANYA 1EB1H 2SNWA 5JBBS 2G4UA 1HYLA 3ELAH 1O5DH 4CR5A 2PTCE 1RD3B 2ZU4A 3OTJE 4FUFA 1W8BH 1LPZB 4LZ1H 1YCPH 1UTLM 1CHOF 3TJNA 2YOLA 1GBMA 3LOXA 1P2QA 1P2KA 1C1OA 1C5LH 1MKXH 2QXHA 2F9BH 3RXBA 1DY8A 3SJ8A 1ZSJA 1ARCA 1ZPCA 1A0JA 1FIWA 1GBLA 2AFQB 2DE8A 4O9VA 3VB6A 5I46H 3MO6A 1F7ZA 3VB3A 3SU6A 1GMCG 1AWFH 4NFFA 5FX6A 1S83A 4NWLA 1AY6H 4IW4E 2EI7A 3TJVA 2FOAA 1F5KU 4YTAA 3JZ2B 2O8TA 1MZAA 2IOTA 3BTME 3OX7U 2PFEA 4X2VA 1TRYA 3RMNH 1C5OH 4JCNA 1AD8H 4A6LA 1NU7B 4B76A 1SGQE 1XUHA 1HJ9A 4FVBA 3QGNB 2G4TA 3Q3KA 2XBWA 4WH6A 3FVFB 3ESTA 3MI4A 4GCHG 1SGNE 1O3JA 3S9CA 2BM2A 2BDYA 2BZ6H 2CGAA 5TJXA 4GHTA 2FOEA 1GJ7B 2HOBA 1K1PA 4HZHA 1CHGA 2ZA5A 1MTWA 3MHWU 3EAJA 1Z8GA 2VIOA 3LU9B 2XXLA 1K1OA 1KLJH 1CGHA 4ABAA 2W7UA 2R0LA 1JMOH 3BV9B 3MU8A 3QZRA 2Z3DA 5C2ZA 1KIGH 2GMTB 2JH5D 3IWMA 2ZU5A 2CF9H 1HAOH 1TOCB 2FO9A 3MMGA 1TIOA 2P3TB 1P2NA 1GJ4H 1MD7A 5JBTA 3RC5A 3SU2A 5E2OA 3KIDU 5C20A 1GJCB 3TK9A 2C8WB 3TGJE 1EXFA 4D8NA 1T8LA 1H4WA 1D6RA 1QQ4A 1YCPM 1V2KT 1LMWB 1OWIA 3IITA 1ZSLA 3E8LA 1D3PB 1K1IA 2ODYB 2Q6GA 3HKIB 1UK4A 1YLDA 1UO6A 1PQ5A 4J1YA 3GCHB 2XCFA 1S82A 2IN2A 5LPRA 1AQ7A 3BTGE 2Y81A 2GZ7A 1QNJA 1SVPA 3L3TA 8ESTE 4X8UH 1FI8A 1HXEH 1LPGB 1A46H 1ZTLA 3EGKH 1AN1E 1GI1A 4UFGH 3AW0A 2Z7FE 2C3SA 2M5TA 5CE1A 4AB9A 2VWOA 1UCYH 1AUJA 1GBFA 4K1TA 3HATH 4Y7AA 1C5MD 4DIHH 4BOHA 6CHAC 1W0ZU 1AVXA 1S85A 1K9OE 1O32A 4DY7B 1FPHH 2ZU2A 1AFQB 4KTCA 3RXHA 1G32B 6LPRA 1ZTKA 3RDZA 2ZDLA 3SUGA 1DITH 1WV7H 4DGJA 1T4UH 3RXVA 1HCGA 1P2JA 4ABBA 4ISOA 4AYYB 1BT7A 1NESE 2C8YB 1BHXB 2ZTXA 1B7XB 1AVGH 1SQAA 1F0SA 3M61U 2A2XH 3SHCH 3LH3A 1ZTJA 1Y3YA 4H6SB 2BD4A 4AORA 1RTFB 4PROA 3TGIE 3ENSB 4OS4A 4IS5A 2UWOA 4Y8XA 2FYRA 1T8OA 2GDEH 2ZQ1A 3A85A 3A89A 3A88A 3R0FA 3VGCB 2G51A 2XYAA 3P70B 3F1SB 3GCTG 2QV1A 2HPQH 3T2NA 5FPTA 2ZZUH 1O37A 1GJDB 1QJ6B 3Q3YA 4Y8ZA 2F9PA 3MH7A 1CA0B 1OOKB 4KGAA 1F5LA 1BRCE 2BY9X 3W95A 3ZVBA 3A7VA 1O3CA 1SR5C 1HLTH 1QB6A 1NRNH 1FONA 3UOUA 4I8JA 3LDXH 3AVZA 3M5MA 2FDAA 4K3JA 4B75A 3GOVB 2EA3A 3NK8A 3S7KB 5DP7A 4ISLA 3U8TH 1ZMLA 1FIZA 2GCTB 3Q00A 3QGJA 2G00A 4BNRA 2JETC 2THFB 1DY9A 1DFPA 1F0UA 1O2GH 1SGYE 3F9GA 3ZZAA 1ZJDA 3I77A 3UNQA 1O3IA 5AF9H 3STJA 3PMAB 1THPB 2V35A 2FESH 3Q76A 1C9PA 4U01A 1G36A 5E2PA 1O2SA 3MU4A 2W5EA 4ESTE 3GYLB 2ZG0H 3TLOA 1WYKA 2PW8H 1C5YB 1VJ9U 2ANWA 3SGAE 1HAYB 4J2YB 2SGFE 3LJOA 5EW2H 3PMJA 2W26A 4B74A 2BOHB 1H1BA 2GKVE 4F49A 4NIXA 2JKHA 3BN9A 2XTTB 2AH4X 1ZGIA 2WV5A 1C1QA 2AS9A 3SNDA 1GVKB 4BAKB 1HAGE 3QUMP 2AGEX 4U32A 1DE7H 2G5VA 3UWIA 4CR9A 3TH4H 4I33A 4UFEH 3GY4A 4KTSA 1N8OC 2UUFB 2EEKA 3JZ1B 5DP8A 1ZJKA 4FU9A 2ZO3H 4X6PA 4X1NU 1MAYA 1EPTA 1V3XA 1LPKB 2J4IA 3AAVA 4GPGA 3KQCA 3BTEE 3RXSA 1FY8E 1O3HA 1EX3A 1GBJA 1GHAF 4A1VA 1FDPA 4KKDA 2FS9A 1FV9A 1O5FH 1F5RA 1J9CH 4SGAE 4CREA 1ELDE 4WY3A 1PYTD 4Y0YE 3KQEA 4E06H 1MU6B 2GCTC 1DX5M 4Q7XA 3LGTA 2PKAB 2P8OB 1ELBA 2BDGA 3BG4C 2OP9A 4WMDA 1HXFH 2V3HH 1GVLA 3F9FA 4NFEA 2HLCA 2SFAA 4WH8A 2XWBI 4YT6H 2VU8E 4NSYA 4X6OA 2ZFTA 2OBQA 3GCNA 3M7TA 2BY8X 1YKTA 5E0GA 3GY6A 1ZR0A 4A92A 4WXIA 2VWNA 2O8WA 4UONA 3TNTA 1IQEA 1FZZA 6GCHF 1QL9A 4IC6A 1O2XA 1K1LA 1V2MT 1O5CB 2Z9KA 1P05A 5A0BA 5F6MA 2HWLB 1BRAA 1NU9A 1TAWA 2F91A 1OWHA 3CENA 1DXPA 1VGCB 1A3EH 1KXEA 2HNTF 4UEHH 4NCYA 2WPHS 3UQVA 4B2CA 2F9OA 2GCHG 1O34A 1P57B 1SGPE 1AKSA 1TBQH 3RXMA 1FAXA 2J38A 4MNYA 1SLWB 2O9QA 2PLXA 4QT8C 1AE8H 1P3CA 4ABGA 1GMDF 5EXLA 4NG9H 3RXLA 1O2OA 1TWXB 1LTOA 1O30A 2H9EH 5F03A 4ABDA 1GHVH 1QGFA 1BTPA 1GDNA 4YZUA 8GCHF 1MCTA 4NWKA 3SW2B 2BDAA 2ZHQH 3URCA 1QBOA 3LKWA 4WXVA 1TNHA 4Z6AH 2WPMS 2ZIQH 1CBWB 4KP0A 1HIAB<