2DX8A

Crystal structure analysis of the phd domain of the transcription coactivator pygophus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
b'PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pygopus homolog 1
publication title Crystal Structure Analysis of the PHD Domain of the Transcription Coactivator Pygopus
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2dx8A00
4ZUXU 3U5PA 2VPBA 5KH7A 4YC9A 2MIQA 2HYED 4V3KC 3ZVYA 3HTKC 4AVXA 2KREA 2Y1NA 4S3OC 4UI9B 2PNXA 3GL6A 5DKAA 3RTRB 3DPLR 3VK6A 1E4UA 2YSJA 3HCTA 3DQVR 2KWNA 2YQMA 4R8PK 3M62A 4GNGA 2MNYA 2PUYA 2LDRA 4FJCA 5LKTA 4IC2A 3SOXA 3ZPV1 3NG2A 2FUUA 1Z60A 3EB5A 1G25A 2KWOA 5G0FA 4A4BA 2ECIA 3PURA 4R2YA 3ASLA 3GV4A 1RMDA 3L1XA 5KH3A 2CT2A 2KU3A 1HYIA 2YREA 2ECTA 1LDKC 3T6RA 3LQIA 2YT5A 1V87A 3RPGC 1K2FA 4YBTA 4YADA 3HCUA 2LGLA 2VP7A 4FK5A 5B8DA 4YBSA 1WILA 1N87A 4LJNA 3KV6A 5TDWA 5TBNA 2MD8C 4AYCA 2OXQC 2QIZA 1WE9A 2ECJA 4I7CA 3N9PA 5AIUA 4LADB 4WZ2A 5FEYA 2MA6A 5FB1A 1Z6UA 2JMDA 1VD4A 4X3GA 3KQIA 2L80A 2YHNA 3ZYQA 1WENA 2G43A 2EODA 4Q6FA 2CSYA 1CHCA 4AYCB 3MHSA 2RI7A 5TRBA 2D8SA 2KWKA 1FBVA 2G6QA 3QZVA 1WEMA 5LKUA 5B75A 3O34A 3O33A 4L58A 2XEUA 2MA5A 2E6RA 3PHDA 1WEEA 2L0BA 2MUMA 5D1MB 2DX8A 2YUCA 5B79A 2LGGA 2MT5A 1T1HA 2LGVA 4YBMA 1WEVA 1IYMA 4GNEA 2CKLB 5TABA 3M99A 3O35A 2M3HA 3PUQA 3O7AA 4YAXA 2LRIC 4ZQLA 4R7EA 2YU4A 4A4CA 2EA6A 2ECGA 1LDJB 5LKXA 2MD7B 2K1JA 2G45A 2YQLA 5G05B 5B78A 1WGMA 5DINA 5I3LA 5FB0A 3O70A 1F62A 2LXHC 1MM2A 4N4FA 2KGGA 2YYRA 4WA6A 2KWJA 3C5KA 3LQHA 5H1TA 2VJFB 4LK9A 4IC3A 4MSXA 5LKZA 5LCWB 2RSDA 4FIPA 3U5NA 4V3LC 5JG6A 2KIZA 5H1UA 2VPGA 4LLBA 4S3OB 4AP4A 4WZ3B 5FERA 3LRQA 5EYAF 3SOWA 3V43A 3L1ZB 4PTBA 5KH9A 2JMJA 1ZBDB 4YABA 3FL2A 5B77A 1WESA 2HDPA 5C11A 3LQJA 1WEPA 1MM3A 2LQ6A 1JOCA 2CSZA 2BAYA 4QF3A 1BORA 3SOUA 3MHHA 2H0DB 2C2LA 3N9OA 4UP0A 3N9MA 2VPEA 2JRJA 2CKLA 2ECNA 3T7LA 2KFTA 2K16A 2QICA 4I7BA 5H9MA 1VYXA 3U5MA 2F6JA 4B7YC 2L75A 2LV9A 3C6WA 1U6GB 5J3XA 2K17A 2UZGA 3O36A 3N9LA 3ZPVE 2VJEA 1JM7A 1X4UA 5D1KB 2K4DA 3HCSA 4XI1A 3RPGB 1HYJA 4A49A 2F6NA 3L11A 3U5OA 2LN0A 2FSAA 1FP0A 4CA1A 2M1RA 2VPDA 4F52B 2KE1A 2Y1MA 4BBQA 1Z2QA 4C9ZA 2VJFA 2AN6A 2Y43A 2L5UA 1WEUA 2EGPA 1WEWA 4TKPB 2I50A 2VJEB 1JM7B 2ZETC 5C13A 4BHWA 2MNZA 4CCGX 3SHBA 2FUIA 4B86C 2NAAA 2QJ0A 2IDAA 4N3WA 3KV5A 1VFYA 4PPEA 4ZDTA 2VNFA 1DVPA 2YW8A 3ZNIA 4MVTA 4L7XA 2H0DA 2KR4A 3N9NA 2YURA 4GB0A 3ZVZB 4YATA 3I2DA 2LXPC 4NN2A 2JMIA 5G04B 2KYUA 5H1VA 2ECWA 3IHPA 3KNVA 4I7DA 2L43A 5B76A 3N9QA 5D1LB 1X4IA 2F42A 2YSMA 4GNDA 2ECVA 4W4UA 3O37A 4WZ0A 1WEOA 2C2VS 2YHOA 2KGIA 4LKAA 3EB6A 5TDRA 1WFKA 4GNFA 2M6MA 1WIMA 4A0CD 1XWHA 4UP5A 4QF2A 2XB1A 1WEQA 2M85A 2LGKA 3M63A 4P5OB 4AUQB 3ZTGA 1X4JA 4FO9A 4O64A 2E6SA 5AITA
chains in the Genus database with same CATH superfamily
4ZUXU 3U5PA 2VPBA 5KH7A 4YC9A 2MIQA 2HYED 4V3KC 3ZVYA 3HTKC 4AVXA 2KREA 2Y1NA 4S3OC 4UI9B 2PNXA 3GL6A 5DKAA 3E2DA 3FM8C 3DPLR 3RTRB 3VK6A 1E4UA 2YSJA 3HCTA 3DQVR 2KWNA 2YVRA 2YQMA 4R8PK 3M62A 4GNGA 2MNYA 2PUYA 2LDRA 4FJCA 5LKTA 4IC2A 3SOXA 3ZPV1 2JM3A 3NG2A 2FUUA 1Z60A 2FD4A 3EB5A 1G25A 5SVYA 2KWOA 5G0FA 4A4BA 2ECIA 4QQ4A 3PURA 4R2YA 3ASLA 3GV4A 1RMDA 3L1XA 5KH3A 2CT2A 2KU3A 1HYIA 2YREA 2ECTA 3FANA 1LDKC 3T6RA 3LQIA 3LDYA 2YT5A 1V87A 3RPGC 1K2FA 4YBTA 4YADA 3HCUA 2LGLA 3DDTA 2VP7A 4FK5A 5B8DA 4YBSA 1WILA 1N87A 4LJNA 3KV6A 5TDWA 5TBNA 2MD8C 4AYCA 2OXQC 2QIZA 1WE9A 2ECJA 4I7CA 3N9PA 5AIUA 3Q1DA 4LADB 4Z0OA 4WZ2A 2MA6A 5FEYA 5FB1A 1Z6UA 2JMDA 1VD4A 4X3GA 3KQIA 2L80A 2IQJA 2YHNA 3ZYQA 1WENA 2G43A 2EODA 4Q6FA 3FAOA 2CSYA 1CHCA 4AYCB 3MHSA 2RI7A 5TRBA 2XOYA 2D8SA 2CONA 2KWKA 1FBVA 2G6QA 2EGMA 3QZVA 1WEMA 5LKUA 2JUNA 5B75A 3O34A 4F1PA 3O33A 4L58A 2XEUA 2MA5A 2E6RA 3PHDA 1WEEA 2L0BA 2MUMA 5D1MB 2DX8A 5SVIA 2YUCA 3SUBA 5B79A 2B0OE 2LGGA 2MT5A 1T1HA 2LGVA 4YBMA 1WEVA 3PLWA 4GNEA 4OGCA 1IYMA 2CKLB 5TABA 3FEHA 2FFWA 3M99A 3O35A 2M3HA 3PUQA 3O7AA 4YAXA 2EXUA 2OWAA 2LRIC 4ZQLA 4R7EA 2YU4A 4A4CA 2EA6A 2ECGA 1LDJB 5LKXA 5SVIB 2MD7B 2K1JA 2G45A 2YQLA 3DWDA 5G05B 2E61A 5B78A 1WGMA 5DINA 5I3LA 3FJUB 5FB0A 3O70A 1F62A 2LXHC 1MM2A 4N4FA 2KGGA 2YYRA 4WA6A 2KWJA 3C5KA 3LQHA 5H1TA 2VJFB 4LK9A 3LVRE 4IC3A 4MSXA 5LKZA 5LCWB 2RSDA 4FIPA 3U5NA 4V3LC 2XP0A 5JG6A 2KIZA 5H1UA 2DJAA 3LVQE 2VPGA 4LLBA 4S3OB 4AP4A 4WZ3B 5FERA 3LRQA 5EYAF 3SOWA 3V43A 3L1ZB 4PTBA 1DCQA 5KH9A 2JMJA 1ZBDB 4YABA 3FL2A 3MDBC 2XOZA 5B77A 1WESA 2HDPA 5C11A 3LQJA 1WEPA 1MM3A 2LQ6A 1JOCA 2CSZA 2BAYA 4QF3A 1BORA 2RR4A 3SOUA 3MHHA 2H0DB 2C2LA 2DSMA 2P57A 3N9OA 4UP0A 4O62A 5K3QA 3N9MA 2VPEA 2JRJA 2XOCA 2CKLA 2ECNA 3T7LA 2KFTA 3H7HA 2K16A 2QICA 4I7BA 5H9MA 1VYXA 3U5MA 2F6JA 2D8UA 4B7YC 2L75A 2LV9A 3C6WA 1U6GB 5J3XA 2K17A 2UZGA 3O36A 3N9LA 3ZPVE 2VJEA 1JM7A 3M7KA 1X4UA 5D1KB 2K4DA 3HCSA 4XI1A 4Z0RA 3RPGB 1HYJA 4A49A 2F6NA 3L11A 2CSVA 3U5OA 3KDEC 2LN0A 2FSAA 1FP0A 4CA1A 2M1RA 2VPDA 4F52B 2KE1A 2Y1MA 4BBQA 2CRWA 1Z2QA 4C9ZA 2VJFA 2AN6A 2Y43A 2L5UA 2CRRA 1WEUA 2EGPA 1WEWA 4TKPB 2I50A 2VJEB 1JM7B 2ZETC 5C13A 4BHWA 2MNZA 4CCGX 3SHBA 2FUIA 3O47A 4B86C 2NAAA 2QJ0A 2IDAA 2KKYA 4N3WA 3KV5A 1VFYA 4PPEA 4ZDTA 2VNFA 1DVPA 2MKEA 2YW8A 3ZNIA 4MVTA 4L7XA 2H0DA 2KR4A 3N9NA 2YURA 4GB0A 3ZVZB 4YATA 3I2DA 2LXPC 4NN2A 4H9DA 2JMIA 5G04B 2KYUA 4OGEA 3JUEA 2KKXA 3LJUX 5H1VA 2ECWA 2L7PA 3IHPA 3KNVA 4I7DA 5SVXA 2L43A 5B76A 3N9QA 5D1LB 1X4IA 2F42A 2YSMA 4GNDA 2ECVA 2LAUA 3O37A 4W4UA 4WZ0A 1MBMA 2M13A 1WEOA 2C2VS 2YHOA 2KGIA 4LKAA 3EB6A 5TDRA 1WFKA 4GNFA 2M6MA 1WIMA 3T9KA 4A0CD 1XWHA 4UP5A 4QF2A 2XB1A 1WEQA 2M85A 2LGKA 3M63A 4P5OB 4AUQB 3ZTGA 1X4JA 4FO9A 4O64A 2E6SA 5AITA
chains in the Genus database with same CATH topology
4ZUXU 3U5PA 2VPBA 5KH7A 4YC9A 2MIQA 2HYED 4V3KC 3ZVYA 3HTKC 4AVXA 2KREA 2Y1NA 4S3OC 4UI9B 2PNXA 3GL6A 5DKAA 3RTRB 3DPLR 3VK6A 1E4UA 2YSJA 3HCTA 3DQVR 2KWNA 2YQMA 4R8PK 3M62A 4GNGA 2MNYA 2PUYA 2LDRA 4FJCA 5LKTA 4IC2A 3SOXA 3ZPV1 3NG2A 2FUUA 1Z60A 3EB5A 1G25A 2KWOA 5G0FA 4A4BA 2ECIA 3PURA 4R2YA 3ASLA 3GV4A 1RMDA 3L1XA 5KH3A 2CT2A 2KU3A 1HYIA 2YREA 2ECTA 1LDKC 3T6RA 3LQIA 2YT5A 1V87A 3RPGC 1K2FA 4YBTA 4YADA 3HCUA 2LGLA 2VP7A 4FK5A 5B8DA 4YBSA 1WILA 1N87A 4LJNA 3KV6A 5TDWA 5TBNA 2MD8C 4AYCA 2OXQC 2QIZA 1WE9A 2ECJA 4I7CA 3N9PA 5AIUA 4LADB 4WZ2A 5FEYA 2MA6A 5FB1A 1Z6UA 2JMDA 1VD4A 4X3GA 3KQIA 2L80A 2YHNA 3ZYQA 1WENA 2G43A 2EODA 4Q6FA 2CSYA 1CHCA 4AYCB 3MHSA 2RI7A 5TRBA 2D8SA 2KWKA 1FBVA 2G6QA 3QZVA 1WEMA 5LKUA 5B75A 3O34A 3O33A 4L58A 2XEUA 2MA5A 2E6RA 3PHDA 1WEEA 2L0BA 2MUMA 5D1MB 2DX8A 2YUCA 5B79A 2LGGA 2MT5A 1T1HA 2LGVA 4YBMA 1WEVA 1IYMA 4GNEA 2CKLB 5TABA 3M99A 3O35A 2M3HA 3PUQA 3O7AA 4YAXA 2LRIC 4ZQLA 4R7EA 2YU4A 4A4CA 2EA6A 2ECGA 1LDJB 5LKXA 2MD7B 2K1JA 2G45A 2YQLA 5G05B 5B78A 1WGMA 5DINA 5I3LA 5FB0A 3O70A 1F62A 2LXHC 1MM2A 4N4FA 2KGGA 2YYRA 4WA6A 2KWJA 3C5KA 3LQHA 5H1TA 2VJFB 4LK9A 4IC3A 4MSXA 5LKZA 5LCWB 2RSDA 4FIPA 3U5NA 4V3LC 5JG6A 2KIZA 5H1UA 2VPGA 4LLBA 4S3OB 4AP4A 4WZ3B 5FERA 3LRQA 5EYAF 3SOWA 3V43A 3L1ZB 4PTBA 5KH9A 2JMJA 1ZBDB 4YABA 3FL2A 5B77A 1WESA 2HDPA 5C11A 3LQJA 1WEPA 1MM3A 2LQ6A 1JOCA 2CSZA 2BAYA 4QF3A 1BORA 3SOUA 3MHHA 2H0DB 2C2LA 3N9OA 4UP0A 3N9MA 2VPEA 2JRJA 2CKLA 2ECNA 3T7LA 2KFTA 2K16A 2QICA 4I7BA 5H9MA 1VYXA 3U5MA 2F6JA 4B7YC 2L75A 2LV9A 3C6WA 1U6GB 5J3XA 2K17A 2UZGA 3O36A 3N9LA 3ZPVE 2VJEA 1JM7A 1X4UA 5D1KB 2K4DA 3HCSA 4XI1A 3RPGB 1HYJA 4A49A 2F6NA 3L11A 3U5OA 2LN0A 2FSAA 1FP0A 4CA1A 2M1RA 2VPDA 4F52B 2KE1A 2Y1MA 4BBQA 1Z2QA 4C9ZA 2VJFA 2AN6A 2Y43A 2L5UA 1WEUA 2EGPA 1WEWA 4TKPB 2I50A 2VJEB 1JM7B 2ZETC 5C13A 4BHWA 2MNZA 4CCGX 3SHBA 2FUIA 4B86C 2NAAA 2QJ0A 2IDAA 4N3WA 3KV5A 1VFYA 4PPEA 4ZDTA 2VNFA 1DVPA 2YW8A 3ZNIA 4MVTA 4L7XA 2H0DA 2KR4A 3N9NA 2YURA 4GB0A 3ZVZB 4YATA 3I2DA 2LXPC 4NN2A 2JMIA 5G04B 2KYUA 5H1VA 2ECWA 3IHPA 3KNVA 4I7DA 2L43A 5B76A 3N9QA 5D1LB 1X4IA 2F42A 2YSMA 4GNDA 2ECVA 4W4UA 3O37A 4WZ0A 1WEOA 2C2VS 2YHOA 2KGIA 4LKAA 3EB6A 5TDRA 1WFKA 4GNFA 2M6MA 1WIMA 4A0CD 1XWHA 4UP5A 4QF2A 2XB1A 1WEQA 2M85A 2LGKA 3M63A 4P5OB 4AUQB 3ZTGA 1X4JA 4FO9A 4O64A 2E6SA 5AITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX U;  3U5P A;  2VPB A;  5KH7 A;  4YC9 A;  2MIQ A;  2HYE D;  4V3K C;  3ZVY A;  3HTK C;  4AVX A;  2KRE A;  2Y1N A;  4S3O C;  4UI9 B;  2PNX A;  3GL6 A;  5DKA A;  3RTR B;  3DPL R;  3VK6 A;  1E4U A;  2YSJ A;  3HCT A;  3DQV R;  2KWN A;  2YQM A;  4R8P K;  3M62 A;  4GNG A;  2MNY A;  2PUY A;  2LDR A;  4FJC A;  5LKT A;  4IC2 A;  3SOX A;  3ZPV 1;  3NG2 A;  2FUU A;  1Z60 A;  3EB5 A;  1G25 A;  2KWO A;  5G0F A;  4A4B A;  2ECI A;  3PUR A;  4R2Y A;  3ASL A;  3GV4 A;  1RMD A;  3L1X A;  5KH3 A;  2CT2 A;  2KU3 A;  1HYI A;  2YRE A;  2ECT A;  1LDK C;  3T6R A;  3LQI A;  2YT5 A;  1V87 A;  3RPG C;  1K2F A;  4YBT A;  4YAD A;  3HCU A;  2LGL A;  2VP7 A;  4FK5 A;  5B8D A;  4YBS A;  1WIL A;  1N87 A;  4LJN A;  3KV6 A;  5TDW A;  5TBN A;  2MD8 C;  4AYC A;  2OXQ C;  2QIZ A;  1WE9 A;  2ECJ A;  4I7C A;  3N9P A;  5AIU A;  4LAD B;  4WZ2 A;  5FEY A;  2MA6 A;  5FB1 A;  1Z6U A;  2JMD A;  1VD4 A;  4X3G A;  3KQI A;  2L80 A;  2YHN A;  3ZYQ A;  1WEN A;  2G43 A;  2EOD A;  4Q6F A;  2CSY A;  1CHC A;  4AYC B;  3MHS A;  2RI7 A;  5TRB A;  2D8S A;  2KWK A;  1FBV A;  2G6Q A;  3QZV A;  1WEM A;  5LKU A;  5B75 A;  3O34 A;  3O33 A;  4L58 A;  2XEU A;  2MA5 A;  2E6R A;  3PHD A;  1WEE A;  2L0B A;  2MUM A;  5D1M B;  2DX8 A;  2YUC A;  5B79 A;  2LGG A;  2MT5 A;  1T1H A;  2LGV A;  4YBM A;  1WEV A;  1IYM A;  4GNE A;  2CKL B;  5TAB A;  3M99 A;  3O35 A;  2M3H A;  3PUQ A;  3O7A A;  4YAX A;  2LRI C;  4ZQL A;  4R7E A;  2YU4 A;  4A4C A;  2EA6 A;  2ECG A;  1LDJ B;  5LKX A;  2MD7 B;  2K1J A;  2G45 A;  2YQL A;  5G05 B;  5B78 A;  1WGM A;  5DIN A;  5I3L A;  5FB0 A;  3O70 A;  1F62 A;  2LXH C;  1MM2 A;  4N4F A;  2KGG A;  2YYR A;  4WA6 A;  2KWJ A;  3C5K A;  3LQH A;  5H1T A;  2VJF B;  4LK9 A;  4IC3 A;  4MSX A;  5LKZ A;  5LCW B;  2RSD A;  4FIP A;  3U5N A;  4V3L C;  5JG6 A;  2KIZ A;  5H1U A;  2VPG A;  4LLB A;  4S3O B;  4AP4 A;  4WZ3 B;  5FER A;  3LRQ A;  5EYA F;  3SOW A;  3V43 A;  3L1Z B;  4PTB A;  5KH9 A;  2JMJ A;  1ZBD B;  4YAB A;  3FL2 A;  5B77 A;  1WES A;  2HDP A;  5C11 A;  3LQJ A;  1WEP A;  1MM3 A;  2LQ6 A;  1JOC A;  2CSZ A;  2BAY A;  4QF3 A;  1BOR A;  3SOU A;  3MHH A;  2H0D B;  2C2L A;  3N9O A;  4UP0 A;  3N9M A;  2VPE A;  2JRJ A;  2CKL A;  2ECN A;  3T7L A;  2KFT A;  2K16 A;  2QIC A;  4I7B A;  5H9M A;  1VYX A;  3U5M A;  2F6J A;  4B7Y C;  2L75 A;  2LV9 A;  3C6W A;  1U6G B;  5J3X A;  2K17 A;  2UZG A;  3O36 A;  3N9L A;  3ZPV E;  2VJE A;  1JM7 A;  1X4U A;  5D1K B;  2K4D A;  3HCS A;  4XI1 A;  3RPG B;  1HYJ A;  4A49 A;  2F6N A;  3L11 A;  3U5O A;  2LN0 A;  2FSA A;  1FP0 A;  4CA1 A;  2M1R A;  2VPD A;  4F52 B;  2KE1 A;  2Y1M A;  4BBQ A;  1Z2Q A;  4C9Z A;  2VJF A;  2AN6 A;  2Y43 A;  2L5U A;  1WEU A;  2EGP A;  1WEW A;  4TKP B;  2I50 A;  2VJE B;  1JM7 B;  2ZET C;  5C13 A;  4BHW A;  2MNZ A;  4CCG X;  3SHB A;  2FUI A;  4B86 C;  2NAA A;  2QJ0 A;  2IDA A;  4N3W A;  3KV5 A;  1VFY A;  4PPE A;  4ZDT A;  2VNF A;  1DVP A;  2YW8 A;  3ZNI A;  4MVT A;  4L7X A;  2H0D A;  2KR4 A;  3N9N A;  2YUR A;  4GB0 A;  3ZVZ B;  4YAT A;  3I2D A;  2LXP C;  4NN2 A;  2JMI A;  5G04 B;  2KYU A;  5H1V A;  2ECW A;  3IHP A;  3KNV A;  4I7D A;  2L43 A;  5B76 A;  3N9Q A;  5D1L B;  1X4I A;  2F42 A;  2YSM A;  4GND A;  2ECV A;  4W4U A;  3O37 A;  4WZ0 A;  1WEO A;  2C2V S;  2YHO A;  2KGI A;  4LKA A;  3EB6 A;  5TDR A;  1WFK A;  4GNF A;  2M6M A;  1WIM A;  4A0C D;  1XWH A;  4UP5 A;  4QF2 A;  2XB1 A;  1WEQ A;  2M85 A;  2LGK A;  3M63 A;  4P5O B;  4AUQ B;  3ZTG A;  1X4J A;  4FO9 A;  4O64 A;  2E6S A;  5AIT A; 
#chains in the Genus database with same CATH topology
 4ZUX U;  3U5P A;  2VPB A;  5KH7 A;  4YC9 A;  2MIQ A;  2HYE D;  4V3K C;  3ZVY A;  3HTK C;  4AVX A;  2KRE A;  2Y1N A;  4S3O C;  4UI9 B;  2PNX A;  3GL6 A;  5DKA A;  3E2D A;  3FM8 C;  3DPL R;  3RTR B;  3VK6 A;  1E4U A;  2YSJ A;  3HCT A;  3DQV R;  2KWN A;  2YVR A;  2YQM A;  4R8P K;  3M62 A;  4GNG A;  2MNY A;  2PUY A;  2LDR A;  4FJC A;  5LKT A;  4IC2 A;  3SOX A;  3ZPV 1;  2JM3 A;  3NG2 A;  2FUU A;  1Z60 A;  2FD4 A;  3EB5 A;  1G25 A;  5SVY A;  2KWO A;  5G0F A;  4A4B A;  2ECI A;  4QQ4 A;  3PUR A;  4R2Y A;  3ASL A;  3GV4 A;  1RMD A;  3L1X A;  5KH3 A;  2CT2 A;  2KU3 A;  1HYI A;  2YRE A;  2ECT A;  3FAN A;  1LDK C;  3T6R A;  3LQI A;  3LDY A;  2YT5 A;  1V87 A;  3RPG C;  1K2F A;  4YBT A;  4YAD A;  3HCU A;  2LGL A;  3DDT A;  2VP7 A;  4FK5 A;  5B8D A;  4YBS A;  1WIL A;  1N87 A;  4LJN A;  3KV6 A;  5TDW A;  5TBN A;  2MD8 C;  4AYC A;  2OXQ C;  2QIZ A;  1WE9 A;  2ECJ A;  4I7C A;  3N9P A;  5AIU A;  3Q1D A;  4LAD B;  4Z0O A;  4WZ2 A;  2MA6 A;  5FEY A;  5FB1 A;  1Z6U A;  2JMD A;  1VD4 A;  4X3G A;  3KQI A;  2L80 A;  2IQJ A;  2YHN A;  3ZYQ A;  1WEN A;  2G43 A;  2EOD A;  4Q6F A;  3FAO A;  2CSY A;  1CHC A;  4AYC B;  3MHS A;  2RI7 A;  5TRB A;  2XOY A;  2D8S A;  2CON A;  2KWK A;  1FBV A;  2G6Q A;  2EGM A;  3QZV A;  1WEM A;  5LKU A;  2JUN A;  5B75 A;  3O34 A;  4F1P A;  3O33 A;  4L58 A;  2XEU A;  2MA5 A;  2E6R A;  3PHD A;  1WEE A;  2L0B A;  2MUM A;  5D1M B;  2DX8 A;  5SVI A;  2YUC A;  3SUB A;  5B79 A;  2B0O E;  2LGG A;  2MT5 A;  1T1H A;  2LGV A;  4YBM A;  1WEV A;  3PLW A;  4GNE A;  4OGC A;  1IYM A;  2CKL B;  5TAB A;  3FEH A;  2FFW A;  3M99 A;  3O35 A;  2M3H A;  3PUQ A;  3O7A A;  4YAX A;  2EXU A;  2OWA A;  2LRI C;  4ZQL A;  4R7E A;  2YU4 A;  4A4C A;  2EA6 A;  2ECG A;  1LDJ B;  5LKX A;  5SVI B;  2MD7 B;  2K1J A;  2G45 A;  2YQL A;  3DWD A;  5G05 B;  2E61 A;  5B78 A;  1WGM A;  5DIN A;  5I3L A;  3FJU B;  5FB0 A;  3O70 A;  1F62 A;  2LXH C;  1MM2 A;  4N4F A;  2KGG A;  2YYR A;  4WA6 A;  2KWJ A;  3C5K A;  3LQH A;  5H1T A;  2VJF B;  4LK9 A;  3LVR E;  4IC3 A;  4MSX A;  5LKZ A;  5LCW B;  2RSD A;  4FIP A;  3U5N A;  4V3L C;  2XP0 A;  5JG6 A;  2KIZ A;  5H1U A;  2DJA A;  3LVQ E;  2VPG A;  4LLB A;  4S3O B;  4AP4 A;  4WZ3 B;  5FER A;  3LRQ A;  5EYA F;  3SOW A;  3V43 A;  3L1Z B;  4PTB A;  1DCQ A;  5KH9 A;  2JMJ A;  1ZBD B;  4YAB A;  3FL2 A;  3MDB C;  2XOZ A;  5B77 A;  1WES A;  2HDP A;  5C11 A;  3LQJ A;  1WEP A;  1MM3 A;  2LQ6 A;  1JOC A;  2CSZ A;  2BAY A;  4QF3 A;  1BOR A;  2RR4 A;  3SOU A;  3MHH A;  2H0D B;  2C2L A;  2DSM A;  2P57 A;  3N9O A;  4UP0 A;  4O62 A;  5K3Q A;  3N9M A;  2VPE A;  2JRJ A;  2XOC A;  2CKL A;  2ECN A;  3T7L A;  2KFT A;  3H7H A;  2K16 A;  2QIC A;  4I7B A;  5H9M A;  1VYX A;  3U5M A;  2F6J A;  2D8U A;  4B7Y C;  2L75 A;  2LV9 A;  3C6W A;  1U6G B;  5J3X A;  2K17 A;  2UZG A;  3O36 A;  3N9L A;  3ZPV E;  2VJE A;  1JM7 A;  3M7K A;  1X4U A;  5D1K B;  2K4D A;  3HCS A;  4XI1 A;  4Z0R A;  3RPG B;  1HYJ A;  4A49 A;  2F6N A;  3L11 A;  2CSV A;  3U5O A;  3KDE C;  2LN0 A;  2FSA A;  1FP0 A;  4CA1 A;  2M1R A;  2VPD A;  4F52 B;  2KE1 A;  2Y1M A;  4BBQ A;  2CRW A;  1Z2Q A;  4C9Z A;  2VJF A;  2AN6 A;  2Y43 A;  2L5U A;  2CRR A;  1WEU A;  2EGP A;  1WEW A;  4TKP B;  2I50 A;  2VJE B;  1JM7 B;  2ZET C;  5C13 A;  4BHW A;  2MNZ A;  4CCG X;  3SHB A;  2FUI A;  3O47 A;  4B86 C;  2NAA A;  2QJ0 A;  2IDA A;  2KKY A;  4N3W A;  3KV5 A;  1VFY A;  4PPE A;  4ZDT A;  2VNF A;  1DVP A;  2MKE A;  2YW8 A;  3ZNI A;  4MVT A;  4L7X A;  2H0D A;  2KR4 A;  3N9N A;  2YUR A;  4GB0 A;  3ZVZ B;  4YAT A;  3I2D A;  2LXP C;  4NN2 A;  4H9D A;  2JMI A;  5G04 B;  2KYU A;  4OGE A;  3JUE A;  2KKX A;  3LJU X;  5H1V A;  2ECW A;  2L7P A;  3IHP A;  3KNV A;  4I7D A;  5SVX A;  2L43 A;  5B76 A;  3N9Q A;  5D1L B;  1X4I A;  2F42 A;  2YSM A;  4GND A;  2ECV A;  2LAU A;  3O37 A;  4W4U A;  4WZ0 A;  1MBM A;  2M13 A;  1WEO A;  2C2V S;  2YHO A;  2KGI A;  4LKA A;  3EB6 A;  5TDR A;  1WFK A;  4GNF A;  2M6M A;  1WIM A;  3T9K A;  4A0C D;  1XWH A;  4UP5 A;  4QF2 A;  2XB1 A;  1WEQ A;  2M85 A;  2LGK A;  3M63 A;  4P5O B;  4AUQ B;  3ZTG A;  1X4J A;  4FO9 A;  4O64 A;  2E6S A;  5AIT A; 
#chains in the Genus database with same CATH homology
 4ZUX U;  3U5P A;  2VPB A;  5KH7 A;  4YC9 A;  2MIQ A;  2HYE D;  4V3K C;  3ZVY A;  3HTK C;  4AVX A;  2KRE A;  2Y1N A;  4S3O C;  4UI9 B;  2PNX A;  3GL6 A;  5DKA A;  3RTR B;  3DPL R;  3VK6 A;  1E4U A;  2YSJ A;  3HCT A;  3DQV R;  2KWN A;  2YQM A;  4R8P K;  3M62 A;  4GNG A;  2MNY A;  2PUY A;  2LDR A;  4FJC A;  5LKT A;  4IC2 A;  3SOX A;  3ZPV 1;  3NG2 A;  2FUU A;  1Z60 A;  3EB5 A;  1G25 A;  2KWO A;  5G0F A;  4A4B A;  2ECI A;  3PUR A;  4R2Y A;  3ASL A;  3GV4 A;  1RMD A;  3L1X A;  5KH3 A;  2CT2 A;  2KU3 A;  1HYI A;  2YRE A;  2ECT A;  1LDK C;  3T6R A;  3LQI A;  2YT5 A;  1V87 A;  3RPG C;  1K2F A;  4YBT A;  4YAD A;  3HCU A;  2LGL A;  2VP7 A;  4FK5 A;  5B8D A;  4YBS A;  1WIL A;  1N87 A;  4LJN A;  3KV6 A;  5TDW A;  5TBN A;  2MD8 C;  4AYC A;  2OXQ C;  2QIZ A;  1WE9 A;  2ECJ A;  4I7C A;  3N9P A;  5AIU A;  4LAD B;  4WZ2 A;  5FEY A;  2MA6 A;  5FB1 A;  1Z6U A;  2JMD A;  1VD4 A;  4X3G A;  3KQI A;  2L80 A;  2YHN A;  3ZYQ A;  1WEN A;  2G43 A;  2EOD A;  4Q6F A;  2CSY A;  1CHC A;  4AYC B;  3MHS A;  2RI7 A;  5TRB A;  2D8S A;  2KWK A;  1FBV A;  2G6Q A;  3QZV A;  1WEM A;  5LKU A;  5B75 A;  3O34 A;  3O33 A;  4L58 A;  2XEU A;  2MA5 A;  2E6R A;  3PHD A;  1WEE A;  2L0B A;  2MUM A;  5D1M B;  2DX8 A;  2YUC A;  5B79 A;  2LGG A;  2MT5 A;  1T1H A;  2LGV A;  4YBM A;  1WEV A;  1IYM A;  4GNE A;  2CKL B;  5TAB A;  3M99 A;  3O35 A;  2M3H A;  3PUQ A;  3O7A A;  4YAX A;  2LRI C;  4ZQL A;  4R7E A;  2YU4 A;  4A4C A;  2EA6 A;  2ECG A;  1LDJ B;  5LKX A;  2MD7 B;  2K1J A;  2G45 A;  2YQL A;  5G05 B;  5B78 A;  1WGM A;  5DIN A;  5I3L A;  5FB0 A;  3O70 A;  1F62 A;  2LXH C;  1MM2 A;  4N4F A;  2KGG A;  2YYR A;  4WA6 A;  2KWJ A;  3C5K A;  3LQH A;  5H1T A;  2VJF B;  4LK9 A;  4IC3 A;  4MSX A;  5LKZ A;  5LCW B;  2RSD A;  4FIP A;  3U5N A;  4V3L C;  5JG6 A;  2KIZ A;  5H1U A;  2VPG A;  4LLB A;  4S3O B;  4AP4 A;  4WZ3 B;  5FER A;  3LRQ A;  5EYA F;  3SOW A;  3V43 A;  3L1Z B;  4PTB A;  5KH9 A;  2JMJ A;  1ZBD B;  4YAB A;  3FL2 A;  5B77 A;  1WES A;  2HDP A;  5C11 A;  3LQJ A;  1WEP A;  1MM3 A;  2LQ6 A;  1JOC A;  2CSZ A;  2BAY A;  4QF3 A;  1BOR A;  3SOU A;  3MHH A;  2H0D B;  2C2L A;  3N9O A;  4UP0 A;  3N9M A;  2VPE A;  2JRJ A;  2CKL A;  2ECN A;  3T7L A;  2KFT A;  2K16 A;  2QIC A;  4I7B A;  5H9M A;  1VYX A;  3U5M A;  2F6J A;  4B7Y C;  2L75 A;  2LV9 A;  3C6W A;  1U6G B;  5J3X A;  2K17 A;  2UZG A;  3O36 A;  3N9L A;  3ZPV E;  2VJE A;  1JM7 A;  1X4U A;  5D1K B;  2K4D A;  3HCS A;  4XI1 A;  3RPG B;  1HYJ A;  4A49 A;  2F6N A;  3L11 A;  3U5O A;  2LN0 A;  2FSA A;  1FP0 A;  4CA1 A;  2M1R A;  2VPD A;  4F52 B;  2KE1 A;  2Y1M A;  4BBQ A;  1Z2Q A;  4C9Z A;  2VJF A;  2AN6 A;  2Y43 A;  2L5U A;  1WEU A;  2EGP A;  1WEW A;  4TKP B;  2I50 A;  2VJE B;  1JM7 B;  2ZET C;  5C13 A;  4BHW A;  2MNZ A;  4CCG X;  3SHB A;  2FUI A;  4B86 C;  2NAA A;  2QJ0 A;  2IDA A;  4N3W A;  3KV5 A;  1VFY A;  4PPE A;  4ZDT A;  2VNF A;  1DVP A;  2YW8 A;  3ZNI A;  4MVT A;  4L7X A;  2H0D A;  2KR4 A;  3N9N A;  2YUR A;  4GB0 A;  3ZVZ B;  4YAT A;  3I2D A;  2LXP C;  4NN2 A;  2JMI A;  5G04 B;  2KYU A;  5H1V A;  2ECW A;  3IHP A;  3KNV A;  4I7D A;  2L43 A;  5B76 A;  3N9Q A;  5D1L B;  1X4I A;  2F42 A;  2YSM A;  4GND A;  2ECV A;  4W4U A;  3O37 A;  4WZ0 A;  1WEO A;  2C2V S;  2YHO A;  2KGI A;  4LKA A;  3EB6 A;  5TDR A;  1WFK A;  4GNF A;  2M6M A;  1WIM A;  4A0C D;  1XWH A;  4UP5 A;  4QF2 A;  2XB1 A;  1WEQ A;  2M85 A;  2LGK A;  3M63 A;  4P5O B;  4AUQ B;  3ZTG A;  1X4J A;  4FO9 A;  4O64 A;  2E6S A;  5AIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...