2DX8A

Crystal structure analysis of the phd domain of the transcription coactivator pygophus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pygopus homolog 1
publication title Crystal Structure Analysis of the PHD Domain of the Transcription Coactivator Pygopus
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2dx8A00
1Z60A 3N9PA 1LDKC 3ZTGA 3T7LA 3ZVZB 2CT2A 2G45A 3SOXA 2LV9A 5LCWB 4GNDA 2F6JA 4C9ZA 2ECTA 4UP0A 4AUQB 3QZVA 4LADB 4TKPB 4UI9B 2Y1NA 2K17A 5FEYA 5H1VA 2VNFA 2KR4A 1WEUA 4A4CA 2EGPA 2KIZA 4FO9A 3SOWA 1BORA 2LQ6A 4MVTA 5TDWA 3KV5A 1F62A 1WEQA 2K1JA 4PTBA 4YBMA 3O36A 1N87A 3FL2A 1Z6UA 4YC9A 5KH3A 2ECWA 5JG6A 1HYIA 2JMJA 5G04B 4IC3A 5EYAF 4S3OB 2ECJA 3KV6A 2I50A 2VP7A 4A4BA 1JOCA 4LK9A 4R2YA 4ZQLA 1WFKA 3L1XA 2PUYA 2DX8A 4N4FA 5H1UA 5B75A 2YUCA 2YW8A 1G25A 2D8SA 5TDRA 3O33A 4B86C 2L80A 2G6QA 4WZ3B 2YU4A 4L58A 2MA6A 3C5KA 4PPEA 2NAAA 4A0CD 2M85A 2ECNA 5TBNA 4ZDTA 4IC2A 5FB1A 3ASLA 4R8PK 2EA6A 1HYJA 1WEMA 2VJFA 2LGKA 4O64A 5AITA 2MNYA 2LRIC 2FUIA 5DKAA 2M3HA 4AP4A 1DVPA 5KH7A 1K2FA 5B78A 2KGIA 5I3LA 2MT5A 2AN6A 3HCSA 2YSJA 3MHHA 3N9OA 3U5MA 4YAXA 4X3GA 2ECGA 4FK5A 2LDRA 2OXQC 4R7EA 4XI1A 4FJCA 2E6RA 3SOUA 5D1LB 3U5OA 2C2LA 5LKXA 2HDPA 3O7AA 2L0BA 3EB6A 1WEPA 2BAYA 2YT5A 2KU3A 2RI7A 3N9NA 2Y43A 1FP0A 2VPDA 4YATA 3M99A 2LGLA 3GV4A 2YHOA 4YADA 4L7XA 4WA6A 5LKTA 4QF3A 2MUMA 3IHPA 3O37A 3RPGC 5H9MA 2YSMA 2QIZA 2LGGA 1Z2QA 2YURA 5B76A 2ECVA 2JRJA 2YQMA 2Y1MA 4V3LC 3HCUA 2VPEA 3HCTA 2CSZA 3PURA 2ECIA 5J3XA 2KREA 4NN2A 4BHWA 4N3WA 4I7DA 1XWHA 3M62A 1IYMA 4CCGX 4W4UA 2VPGA 2QJ0A 5C13A 4FIPA 2E6SA 4A49A 1VYXA 2H0DA 1WGMA 4GNEA 1WILA 2UZGA 5C11A 4GNFA 4GB0A 5FB0A 1FBVA 3I2DA 2VJFB 5AIUA 2LXHC 2LGVA 4WZ0A 3ZPV1 5B8DA 2MD8C 2YHNA 2FUUA 1JM7B 3SHBA 4AYCA 4P5OB 4F52B 5FERA 5B77A 1JM7A 3LQHA 2RSDA 3L1ZB 3HTKC 1WEWA 5H1TA 2M6MA 2YREA 1VD4A 4S3OC 3ZVYA 4LKAA 2VJEA 2KE1A 3U5NA 2F42A 5G0FA 3MHSA 4B7YC 3C6WA 1RMDA 4QF2A 1ZBDB 2ZETC 4I7BA 4LLBA 2CKLA 2EODA 5LKZA 3O35A 1U6GB 1WEOA 3V43A 2MNZA 4V3KC 1MM3A 3O34A 2L5UA 2KGGA 2QICA 1X4UA 3L11A 5TABA 4WZ2A 4AVXA 3N9MA 5D1MB 4MSXA 2KWNA 5B79A 2G43A 5DINA 3ZPVE 3EB5A 2XB1A 3T6RA 2KYUA 4CA1A 2L75A 4LJNA 3ZYQA 3PHDA 2K4DA 5KH9A 4YBSA 1MM2A 2MIQA 3KQIA 2MA5A 1WIMA 3KNVA 2H0DB 3NG2A 2C2VS 2FSAA 2IDAA 2M1RA 2L43A 2MD7B 1WEEA 1CHCA 4Q6FA 2XEUA 2F6NA 1X4IA 2VPBA 1T1HA 1WEVA 3LRQA 4UP5A 2K16A 4I7CA 4ZUXU 2YYRA 3N9LA 3DPLR 3LQJA 2JMDA 3VK6A 2KWOA 2PNXA 1V87A 4AYCB 1X4JA 2HYED 3GL6A 2LXPC 1E4UA 1VFYA 3LQIA 4YABA 2JMIA 2LN0A 3O70A 3RPGB 3ZNIA 2YQLA 5G05B 5D1KB 3DQVR 5TRBA 2VJEB 1WE9A 2CSYA 4YBTA 1WENA 4BBQA 1WESA 3M63A 5LKUA 2KWKA 2KWJA 3N9QA 3RTRB 3PUQA 3U5PA 1LDJB 4GNGA 2KFTA 2CKLB
chains in the Genus database with same CATH superfamily
1Z60A 3N9PA 1LDKC 3ZTGA 3T7LA 3ZVZB 2CT2A 2G45A 3SOXA 2LV9A 3Q1DA 5LCWB 2L7PA 2DSMA 4GNDA 2F6JA 2B0OE 4C9ZA 2ECTA 4UP0A 4AUQB 3QZVA 4LADB 4TKPB 4UI9B 2Y1NA 2K17A 5FEYA 5H1VA 2VNFA 2KR4A 1WEUA 4A4CA 2EGPA 2KIZA 3T9KA 4FO9A 3SOWA 1BORA 2CSVA 2LQ6A 4MVTA 5TDWA 3KV5A 1F62A 1WEQA 2K1JA 5SVYA 4H9DA 4PTBA 4YBMA 3O36A 1N87A 2OWAA 3FL2A 1Z6UA 4YC9A 5KH3A 2ECWA 5JG6A 2P57A 1HYIA 2JMJA 5G04B 3LVQE 4Z0RA 3O47A 4IC3A 2LAUA 5EYAF 4S3OB 2ECJA 3KV6A 2I50A 2VP7A 4A4BA 1JOCA 4LK9A 4R2YA 4ZQLA 1WFKA 3L1XA 2PUYA 2DX8A 4N4FA 5H1UA 5B75A 2YUCA 3PLWA 2YW8A 1G25A 2D8SA 5TDRA 3O33A 4B86C 2L80A 2G6QA 4WZ3B 2YU4A 4L58A 2XP0A 2MA6A 3C5KA 4PPEA 3JUEA 2NAAA 4A0CD 2M85A 3H7HA 2ECNA 5TBNA 4ZDTA 4IC2A 4O62A 5FB1A 3ASLA 4R8PK 2IQJA 2EA6A 1HYJA 3FM8C 1WEMA 2VJFA 2LGKA 4O64A 5AITA 2MNYA 2CONA 2LRIC 2FUIA 5DKAA 2M3HA 4AP4A 1DVPA 5KH7A 1K2FA 5B78A 2KGIA 5I3LA 2MT5A 2AN6A 3HCSA 2YSJA 3MHHA 2JUNA 3N9OA 3FAOA 3U5MA 4YAXA 4X3GA 2ECGA 4FK5A 2LDRA 2OXQC 4R7EA 2E61A 4XI1A 4FJCA 2E6RA 3SOUA 5D1LB 2YVRA 3U5OA 2C2LA 5LKXA 2HDPA 1MBMA 3O7AA 2L0BA 3EB6A 1WEPA 2BAYA 2YT5A 2KU3A 2RI7A 4OGEA 3N9NA 2Y43A 1FP0A 2VPDA 4YATA 3M99A 2LGLA 3GV4A 2YHOA 4YADA 4L7XA 4WA6A 5LKTA 4QF3A 2MUMA 3IHPA 3O37A 3RPGC 5H9MA 2YSMA 2CRRA 5SVXA 2FD4A 2QIZA 2LGGA 1Z2QA 5K3QA 2YURA 5B76A 2ECVA 2JRJA 2YQMA 2Y1MA 4V3LC 3HCUA 2VPEA 3HCTA 2CSZA 3PURA 2ECIA 5J3XA 2KKYA 2KREA 2XOZA 3FANA 4NN2A 4BHWA 4N3WA 4I7DA 1XWHA 3M62A 4Z0OA 1IYMA 4CCGX 2D8UA 4W4UA 2VPGA 2QJ0A 5C13A 4FIPA 2E6SA 4A49A 1VYXA 2M13A 2H0DA 1WGMA 4GNEA 1WILA 3DDTA 2UZGA 5C11A 3KDEC 4GNFA 4GB0A 5FB0A 2XOCA 1FBVA 3I2DA 2VJFB 5AIUA 2LXHC 2LGVA 4WZ0A 3M7KA 3ZPV1 5B8DA 3E2DA 2MD8C 2YHNA 2FUUA 1JM7B 2MKEA 3LVRE 3SHBA 4AYCA 4P5OB 4F52B 5FERA 5B77A 1JM7A 5SVIA 3LQHA 2RSDA 3FEHA 3L1ZB 3HTKC 1WEWA 5H1TA 2M6MA 2YREA 3MDBC 1VD4A 4S3OC 2XOYA 3ZVYA 3LJUX 4LKAA 2VJEA 2KE1A 2JM3A 3U5NA 2F42A 5G0FA 3MHSA 4B7YC 3C6WA 1RMDA 4QF2A 1ZBDB 2ZETC 4I7BA 1DCQA 4LLBA 2CKLA 2EODA 5LKZA 3O35A 1U6GB 1WEOA 3V43A 2MNZA 4V3KC 1MM3A 3O34A 2L5UA 2KGGA 2QICA 1X4UA 3L11A 5TABA 4WZ2A 4AVXA 3N9MA 2CRWA 5D1MB 4MSXA 2KWNA 5B79A 2G43A 5DINA 3ZPVE 3EB5A 2XB1A 3T6RA 2KYUA 4CA1A 2L75A 4LJNA 3ZYQA 3PHDA 2K4DA 5KH9A 4YBSA 1MM2A 2MIQA 3KQIA 2MA5A 1WIMA 3KNVA 3FJUB 2H0DB 3NG2A 2DJAA 2C2VS 2FSAA 2IDAA 2M1RA 2L43A 2MD7B 1WEEA 4F1PA 1CHCA 4Q6FA 2XEUA 2F6NA 1X4IA 2VPBA 1T1HA 1WEVA 3LRQA 4UP5A 2K16A 4I7CA 4ZUXU 2YYRA 3N9LA 3DPLR 3LQJA 2JMDA 3VK6A 2KWOA 2PNXA 1V87A 3SUBA 4AYCB 1X4JA 4OGCA 2HYED 3GL6A 5SVIB 2LXPC 1E4UA 1VFYA 3LQIA 4YABA 2JMIA 2LN0A 3DWDA 3O70A 3RPGB 3ZNIA 2EXUA 2YQLA 5G05B 2EGMA 5D1KB 3DQVR 5TRBA 2VJEB 1WE9A 2CSYA 3LDYA 4YBTA 1WENA 2RR4A 2KKXA 4BBQA 1WESA 4QQ4A 3M63A 5LKUA 2KWKA 2KWJA 3N9QA 3RTRB 3PUQA 3U5PA 2FFWA 1LDJB 4GNGA 2KFTA 2CKLB
chains in the Genus database with same CATH topology
1Z60A 3N9PA 1LDKC 3ZTGA 3T7LA 3ZVZB 2CT2A 2G45A 3SOXA 2LV9A 5LCWB 4GNDA 2F6JA 4C9ZA 2ECTA 4UP0A 4AUQB 3QZVA 4LADB 4TKPB 4UI9B 2Y1NA 2K17A 5FEYA 5H1VA 2VNFA 2KR4A 1WEUA 4A4CA 2EGPA 2KIZA 4FO9A 3SOWA 1BORA 2LQ6A 4MVTA 5TDWA 3KV5A 1F62A 1WEQA 2K1JA 4PTBA 4YBMA 3O36A 1N87A 3FL2A 1Z6UA 4YC9A 5KH3A 2ECWA 5JG6A 1HYIA 2JMJA 5G04B 4IC3A 5EYAF 4S3OB 2ECJA 3KV6A 2I50A 2VP7A 4A4BA 1JOCA 4LK9A 4R2YA 4ZQLA 1WFKA 3L1XA 2PUYA 2DX8A 4N4FA 5H1UA 5B75A 2YUCA 2YW8A 1G25A 2D8SA 5TDRA 3O33A 4B86C 2L80A 2G6QA 4WZ3B 2YU4A 4L58A 2MA6A 3C5KA 4PPEA 2NAAA 4A0CD 2M85A 2ECNA 5TBNA 4ZDTA 4IC2A 5FB1A 3ASLA 4R8PK 2EA6A 1HYJA 1WEMA 2VJFA 2LGKA 4O64A 5AITA 2MNYA 2LRIC 2FUIA 5DKAA 2M3HA 4AP4A 1DVPA 5KH7A 1K2FA 5B78A 2KGIA 5I3LA 2MT5A 2AN6A 3HCSA 2YSJA 3MHHA 3N9OA 3U5MA 4YAXA 4X3GA 2ECGA 4FK5A 2LDRA 2OXQC 4R7EA 4XI1A 4FJCA 2E6RA 3SOUA 5D1LB 3U5OA 2C2LA 5LKXA 2HDPA 3O7AA 2L0BA 3EB6A 1WEPA 2BAYA 2YT5A 2KU3A 2RI7A 3N9NA 2Y43A 1FP0A 2VPDA 4YATA 3M99A 2LGLA 3GV4A 2YHOA 4YADA 4L7XA 4WA6A 5LKTA 4QF3A 2MUMA 3IHPA 3O37A 3RPGC 5H9MA 2YSMA 2QIZA 2LGGA 1Z2QA 2YURA 5B76A 2ECVA 2JRJA 2YQMA 2Y1MA 4V3LC 3HCUA 2VPEA 3HCTA 2CSZA 3PURA 2ECIA 5J3XA 2KREA 4NN2A 4BHWA 4N3WA 4I7DA 1XWHA 3M62A 1IYMA 4CCGX 4W4UA 2VPGA 2QJ0A 5C13A 4FIPA 2E6SA 4A49A 1VYXA 2H0DA 1WGMA 4GNEA 1WILA 2UZGA 5C11A 4GNFA 4GB0A 5FB0A 1FBVA 3I2DA 2VJFB 5AIUA 2LXHC 2LGVA 4WZ0A 3ZPV1 5B8DA 2MD8C 2YHNA 2FUUA 1JM7B 3SHBA 4AYCA 4P5OB 4F52B 5FERA 5B77A 1JM7A 3LQHA 2RSDA 3L1ZB 3HTKC 1WEWA 5H1TA 2M6MA 2YREA 1VD4A 4S3OC 3ZVYA 4LKAA 2VJEA 2KE1A 3U5NA 2F42A 5G0FA 3MHSA 4B7YC 3C6WA 1RMDA 4QF2A 1ZBDB 2ZETC 4I7BA 4LLBA 2CKLA 2EODA 5LKZA 3O35A 1U6GB 1WEOA 3V43A 2MNZA 4V3KC 1MM3A 3O34A 2L5UA 2KGGA 2QICA 1X4UA 3L11A 5TABA 4WZ2A 4AVXA 3N9MA 5D1MB 4MSXA 2KWNA 5B79A 2G43A 5DINA 3ZPVE 3EB5A 2XB1A 3T6RA 2KYUA 4CA1A 2L75A 4LJNA 3ZYQA 3PHDA 2K4DA 5KH9A 4YBSA 1MM2A 2MIQA 3KQIA 2MA5A 1WIMA 3KNVA 2H0DB 3NG2A 2C2VS 2FSAA 2IDAA 2M1RA 2L43A 2MD7B 1WEEA 1CHCA 4Q6FA 2XEUA 2F6NA 1X4IA 2VPBA 1T1HA 1WEVA 3LRQA 4UP5A 2K16A 4I7CA 4ZUXU 2YYRA 3N9LA 3DPLR 3LQJA 2JMDA 3VK6A 2KWOA 2PNXA 1V87A 4AYCB 1X4JA 2HYED 3GL6A 2LXPC 1E4UA 1VFYA 3LQIA 4YABA 2JMIA 2LN0A 3O70A 3RPGB 3ZNIA 2YQLA 5G05B 5D1KB 3DQVR 5TRBA 2VJEB 1WE9A 2CSYA 4YBTA 1WENA 4BBQA 1WESA 3M63A 5LKUA 2KWKA 2KWJA 3N9QA 3RTRB 3PUQA 3U5PA 1LDJB 4GNGA 2KFTA 2CKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z60 A;  3N9P A;  1LDK C;  3ZTG A;  3T7L A;  3ZVZ B;  2CT2 A;  2G45 A;  3SOX A;  2LV9 A;  5LCW B;  4GND A;  2F6J A;  4C9Z A;  2ECT A;  4UP0 A;  4AUQ B;  3QZV A;  4LAD B;  4TKP B;  4UI9 B;  2Y1N A;  2K17 A;  5FEY A;  5H1V A;  2VNF A;  2KR4 A;  1WEU A;  4A4C A;  2EGP A;  2KIZ A;  4FO9 A;  3SOW A;  1BOR A;  2LQ6 A;  4MVT A;  5TDW A;  3KV5 A;  1F62 A;  1WEQ A;  2K1J A;  4PTB A;  4YBM A;  3O36 A;  1N87 A;  3FL2 A;  1Z6U A;  4YC9 A;  5KH3 A;  2ECW A;  5JG6 A;  1HYI A;  2JMJ A;  5G04 B;  4IC3 A;  5EYA F;  4S3O B;  2ECJ A;  3KV6 A;  2I50 A;  2VP7 A;  4A4B A;  1JOC A;  4LK9 A;  4R2Y A;  4ZQL A;  1WFK A;  3L1X A;  2PUY A;  2DX8 A;  4N4F A;  5H1U A;  5B75 A;  2YUC A;  2YW8 A;  1G25 A;  2D8S A;  5TDR A;  3O33 A;  4B86 C;  2L80 A;  2G6Q A;  4WZ3 B;  2YU4 A;  4L58 A;  2MA6 A;  3C5K A;  4PPE A;  2NAA A;  4A0C D;  2M85 A;  2ECN A;  5TBN A;  4ZDT A;  4IC2 A;  5FB1 A;  3ASL A;  4R8P K;  2EA6 A;  1HYJ A;  1WEM A;  2VJF A;  2LGK A;  4O64 A;  5AIT A;  2MNY A;  2LRI C;  2FUI A;  5DKA A;  2M3H A;  4AP4 A;  1DVP A;  5KH7 A;  1K2F A;  5B78 A;  2KGI A;  5I3L A;  2MT5 A;  2AN6 A;  3HCS A;  2YSJ A;  3MHH A;  3N9O A;  3U5M A;  4YAX A;  4X3G A;  2ECG A;  4FK5 A;  2LDR A;  2OXQ C;  4R7E A;  4XI1 A;  4FJC A;  2E6R A;  3SOU A;  5D1L B;  3U5O A;  2C2L A;  5LKX A;  2HDP A;  3O7A A;  2L0B A;  3EB6 A;  1WEP A;  2BAY A;  2YT5 A;  2KU3 A;  2RI7 A;  3N9N A;  2Y43 A;  1FP0 A;  2VPD A;  4YAT A;  3M99 A;  2LGL A;  3GV4 A;  2YHO A;  4YAD A;  4L7X A;  4WA6 A;  5LKT A;  4QF3 A;  2MUM A;  3IHP A;  3O37 A;  3RPG C;  5H9M A;  2YSM A;  2QIZ A;  2LGG A;  1Z2Q A;  2YUR A;  5B76 A;  2ECV A;  2JRJ A;  2YQM A;  2Y1M A;  4V3L C;  3HCU A;  2VPE A;  3HCT A;  2CSZ A;  3PUR A;  2ECI A;  5J3X A;  2KRE A;  4NN2 A;  4BHW A;  4N3W A;  4I7D A;  1XWH A;  3M62 A;  1IYM A;  4CCG X;  4W4U A;  2VPG A;  2QJ0 A;  5C13 A;  4FIP A;  2E6S A;  4A49 A;  1VYX A;  2H0D A;  1WGM A;  4GNE A;  1WIL A;  2UZG A;  5C11 A;  4GNF A;  4GB0 A;  5FB0 A;  1FBV A;  3I2D A;  2VJF B;  5AIU A;  2LXH C;  2LGV A;  4WZ0 A;  3ZPV 1;  5B8D A;  2MD8 C;  2YHN A;  2FUU A;  1JM7 B;  3SHB A;  4AYC A;  4P5O B;  4F52 B;  5FER A;  5B77 A;  1JM7 A;  3LQH A;  2RSD A;  3L1Z B;  3HTK C;  1WEW A;  5H1T A;  2M6M A;  2YRE A;  1VD4 A;  4S3O C;  3ZVY A;  4LKA A;  2VJE A;  2KE1 A;  3U5N A;  2F42 A;  5G0F A;  3MHS A;  4B7Y C;  3C6W A;  1RMD A;  4QF2 A;  1ZBD B;  2ZET C;  4I7B A;  4LLB A;  2CKL A;  2EOD A;  5LKZ A;  3O35 A;  1U6G B;  1WEO A;  3V43 A;  2MNZ A;  4V3K C;  1MM3 A;  3O34 A;  2L5U A;  2KGG A;  2QIC A;  1X4U A;  3L11 A;  5TAB A;  4WZ2 A;  4AVX A;  3N9M A;  5D1M B;  4MSX A;  2KWN A;  5B79 A;  2G43 A;  5DIN A;  3ZPV E;  3EB5 A;  2XB1 A;  3T6R A;  2KYU A;  4CA1 A;  2L75 A;  4LJN A;  3ZYQ A;  3PHD A;  2K4D A;  5KH9 A;  4YBS A;  1MM2 A;  2MIQ A;  3KQI A;  2MA5 A;  1WIM A;  3KNV A;  2H0D B;  3NG2 A;  2C2V S;  2FSA A;  2IDA A;  2M1R A;  2L43 A;  2MD7 B;  1WEE A;  1CHC A;  4Q6F A;  2XEU A;  2F6N A;  1X4I A;  2VPB A;  1T1H A;  1WEV A;  3LRQ A;  4UP5 A;  2K16 A;  4I7C A;  4ZUX U;  2YYR A;  3N9L A;  3DPL R;  3LQJ A;  2JMD A;  3VK6 A;  2KWO A;  2PNX A;  1V87 A;  4AYC B;  1X4J A;  2HYE D;  3GL6 A;  2LXP C;  1E4U A;  1VFY A;  3LQI A;  4YAB A;  2JMI A;  2LN0 A;  3O70 A;  3RPG B;  3ZNI A;  2YQL A;  5G05 B;  5D1K B;  3DQV R;  5TRB A;  2VJE B;  1WE9 A;  2CSY A;  4YBT A;  1WEN A;  4BBQ A;  1WES A;  3M63 A;  5LKU A;  2KWK A;  2KWJ A;  3N9Q A;  3RTR B;  3PUQ A;  3U5P A;  1LDJ B;  4GNG A;  2KFT A;  2CKL B; 
#chains in the Genus database with same CATH topology
 1Z60 A;  3N9P A;  1LDK C;  3ZTG A;  3T7L A;  3ZVZ B;  2CT2 A;  2G45 A;  3SOX A;  2LV9 A;  3Q1D A;  5LCW B;  2L7P A;  2DSM A;  4GND A;  2F6J A;  2B0O E;  4C9Z A;  2ECT A;  4UP0 A;  4AUQ B;  3QZV A;  4LAD B;  4TKP B;  4UI9 B;  2Y1N A;  2K17 A;  5FEY A;  5H1V A;  2VNF A;  2KR4 A;  1WEU A;  4A4C A;  2EGP A;  2KIZ A;  3T9K A;  4FO9 A;  3SOW A;  1BOR A;  2CSV A;  2LQ6 A;  4MVT A;  5TDW A;  3KV5 A;  1F62 A;  1WEQ A;  2K1J A;  5SVY A;  4H9D A;  4PTB A;  4YBM A;  3O36 A;  1N87 A;  2OWA A;  3FL2 A;  1Z6U A;  4YC9 A;  5KH3 A;  2ECW A;  5JG6 A;  2P57 A;  1HYI A;  2JMJ A;  5G04 B;  3LVQ E;  4Z0R A;  3O47 A;  4IC3 A;  2LAU A;  5EYA F;  4S3O B;  2ECJ A;  3KV6 A;  2I50 A;  2VP7 A;  4A4B A;  1JOC A;  4LK9 A;  4R2Y A;  4ZQL A;  1WFK A;  3L1X A;  2PUY A;  2DX8 A;  4N4F A;  5H1U A;  5B75 A;  2YUC A;  3PLW A;  2YW8 A;  1G25 A;  2D8S A;  5TDR A;  3O33 A;  4B86 C;  2L80 A;  2G6Q A;  4WZ3 B;  2YU4 A;  4L58 A;  2XP0 A;  2MA6 A;  3C5K A;  4PPE A;  3JUE A;  2NAA A;  4A0C D;  2M85 A;  3H7H A;  2ECN A;  5TBN A;  4ZDT A;  4IC2 A;  4O62 A;  5FB1 A;  3ASL A;  4R8P K;  2IQJ A;  2EA6 A;  1HYJ A;  3FM8 C;  1WEM A;  2VJF A;  2LGK A;  4O64 A;  5AIT A;  2MNY A;  2CON A;  2LRI C;  2FUI A;  5DKA A;  2M3H A;  4AP4 A;  1DVP A;  5KH7 A;  1K2F A;  5B78 A;  2KGI A;  5I3L A;  2MT5 A;  2AN6 A;  3HCS A;  2YSJ A;  3MHH A;  2JUN A;  3N9O A;  3FAO A;  3U5M A;  4YAX A;  4X3G A;  2ECG A;  4FK5 A;  2LDR A;  2OXQ C;  4R7E A;  2E61 A;  4XI1 A;  4FJC A;  2E6R A;  3SOU A;  5D1L B;  2YVR A;  3U5O A;  2C2L A;  5LKX A;  2HDP A;  1MBM A;  3O7A A;  2L0B A;  3EB6 A;  1WEP A;  2BAY A;  2YT5 A;  2KU3 A;  2RI7 A;  4OGE A;  3N9N A;  2Y43 A;  1FP0 A;  2VPD A;  4YAT A;  3M99 A;  2LGL A;  3GV4 A;  2YHO A;  4YAD A;  4L7X A;  4WA6 A;  5LKT A;  4QF3 A;  2MUM A;  3IHP A;  3O37 A;  3RPG C;  5H9M A;  2YSM A;  2CRR A;  5SVX A;  2FD4 A;  2QIZ A;  2LGG A;  1Z2Q A;  5K3Q A;  2YUR A;  5B76 A;  2ECV A;  2JRJ A;  2YQM A;  2Y1M A;  4V3L C;  3HCU A;  2VPE A;  3HCT A;  2CSZ A;  3PUR A;  2ECI A;  5J3X A;  2KKY A;  2KRE A;  2XOZ A;  3FAN A;  4NN2 A;  4BHW A;  4N3W A;  4I7D A;  1XWH A;  3M62 A;  4Z0O A;  1IYM A;  4CCG X;  2D8U A;  4W4U A;  2VPG A;  2QJ0 A;  5C13 A;  4FIP A;  2E6S A;  4A49 A;  1VYX A;  2M13 A;  2H0D A;  1WGM A;  4GNE A;  1WIL A;  3DDT A;  2UZG A;  5C11 A;  3KDE C;  4GNF A;  4GB0 A;  5FB0 A;  2XOC A;  1FBV A;  3I2D A;  2VJF B;  5AIU A;  2LXH C;  2LGV A;  4WZ0 A;  3M7K A;  3ZPV 1;  5B8D A;  3E2D A;  2MD8 C;  2YHN A;  2FUU A;  1JM7 B;  2MKE A;  3LVR E;  3SHB A;  4AYC A;  4P5O B;  4F52 B;  5FER A;  5B77 A;  1JM7 A;  5SVI A;  3LQH A;  2RSD A;  3FEH A;  3L1Z B;  3HTK C;  1WEW A;  5H1T A;  2M6M A;  2YRE A;  3MDB C;  1VD4 A;  4S3O C;  2XOY A;  3ZVY A;  3LJU X;  4LKA A;  2VJE A;  2KE1 A;  2JM3 A;  3U5N A;  2F42 A;  5G0F A;  3MHS A;  4B7Y C;  3C6W A;  1RMD A;  4QF2 A;  1ZBD B;  2ZET C;  4I7B A;  1DCQ A;  4LLB A;  2CKL A;  2EOD A;  5LKZ A;  3O35 A;  1U6G B;  1WEO A;  3V43 A;  2MNZ A;  4V3K C;  1MM3 A;  3O34 A;  2L5U A;  2KGG A;  2QIC A;  1X4U A;  3L11 A;  5TAB A;  4WZ2 A;  4AVX A;  3N9M A;  2CRW A;  5D1M B;  4MSX A;  2KWN A;  5B79 A;  2G43 A;  5DIN A;  3ZPV E;  3EB5 A;  2XB1 A;  3T6R A;  2KYU A;  4CA1 A;  2L75 A;  4LJN A;  3ZYQ A;  3PHD A;  2K4D A;  5KH9 A;  4YBS A;  1MM2 A;  2MIQ A;  3KQI A;  2MA5 A;  1WIM A;  3KNV A;  3FJU B;  2H0D B;  3NG2 A;  2DJA A;  2C2V S;  2FSA A;  2IDA A;  2M1R A;  2L43 A;  2MD7 B;  1WEE A;  4F1P A;  1CHC A;  4Q6F A;  2XEU A;  2F6N A;  1X4I A;  2VPB A;  1T1H A;  1WEV A;  3LRQ A;  4UP5 A;  2K16 A;  4I7C A;  4ZUX U;  2YYR A;  3N9L A;  3DPL R;  3LQJ A;  2JMD A;  3VK6 A;  2KWO A;  2PNX A;  1V87 A;  3SUB A;  4AYC B;  1X4J A;  4OGC A;  2HYE D;  3GL6 A;  5SVI B;  2LXP C;  1E4U A;  1VFY A;  3LQI A;  4YAB A;  2JMI A;  2LN0 A;  3DWD A;  3O70 A;  3RPG B;  3ZNI A;  2EXU A;  2YQL A;  5G05 B;  2EGM A;  5D1K B;  3DQV R;  5TRB A;  2VJE B;  1WE9 A;  2CSY A;  3LDY A;  4YBT A;  1WEN A;  2RR4 A;  2KKX A;  4BBQ A;  1WES A;  4QQ4 A;  3M63 A;  5LKU A;  2KWK A;  2KWJ A;  3N9Q A;  3RTR B;  3PUQ A;  3U5P A;  2FFW A;  1LDJ B;  4GNG A;  2KFT A;  2CKL B; 
#chains in the Genus database with same CATH homology
 1Z60 A;  3N9P A;  1LDK C;  3ZTG A;  3T7L A;  3ZVZ B;  2CT2 A;  2G45 A;  3SOX A;  2LV9 A;  5LCW B;  4GND A;  2F6J A;  4C9Z A;  2ECT A;  4UP0 A;  4AUQ B;  3QZV A;  4LAD B;  4TKP B;  4UI9 B;  2Y1N A;  2K17 A;  5FEY A;  5H1V A;  2VNF A;  2KR4 A;  1WEU A;  4A4C A;  2EGP A;  2KIZ A;  4FO9 A;  3SOW A;  1BOR A;  2LQ6 A;  4MVT A;  5TDW A;  3KV5 A;  1F62 A;  1WEQ A;  2K1J A;  4PTB A;  4YBM A;  3O36 A;  1N87 A;  3FL2 A;  1Z6U A;  4YC9 A;  5KH3 A;  2ECW A;  5JG6 A;  1HYI A;  2JMJ A;  5G04 B;  4IC3 A;  5EYA F;  4S3O B;  2ECJ A;  3KV6 A;  2I50 A;  2VP7 A;  4A4B A;  1JOC A;  4LK9 A;  4R2Y A;  4ZQL A;  1WFK A;  3L1X A;  2PUY A;  2DX8 A;  4N4F A;  5H1U A;  5B75 A;  2YUC A;  2YW8 A;  1G25 A;  2D8S A;  5TDR A;  3O33 A;  4B86 C;  2L80 A;  2G6Q A;  4WZ3 B;  2YU4 A;  4L58 A;  2MA6 A;  3C5K A;  4PPE A;  2NAA A;  4A0C D;  2M85 A;  2ECN A;  5TBN A;  4ZDT A;  4IC2 A;  5FB1 A;  3ASL A;  4R8P K;  2EA6 A;  1HYJ A;  1WEM A;  2VJF A;  2LGK A;  4O64 A;  5AIT A;  2MNY A;  2LRI C;  2FUI A;  5DKA A;  2M3H A;  4AP4 A;  1DVP A;  5KH7 A;  1K2F A;  5B78 A;  2KGI A;  5I3L A;  2MT5 A;  2AN6 A;  3HCS A;  2YSJ A;  3MHH A;  3N9O A;  3U5M A;  4YAX A;  4X3G A;  2ECG A;  4FK5 A;  2LDR A;  2OXQ C;  4R7E A;  4XI1 A;  4FJC A;  2E6R A;  3SOU A;  5D1L B;  3U5O A;  2C2L A;  5LKX A;  2HDP A;  3O7A A;  2L0B A;  3EB6 A;  1WEP A;  2BAY A;  2YT5 A;  2KU3 A;  2RI7 A;  3N9N A;  2Y43 A;  1FP0 A;  2VPD A;  4YAT A;  3M99 A;  2LGL A;  3GV4 A;  2YHO A;  4YAD A;  4L7X A;  4WA6 A;  5LKT A;  4QF3 A;  2MUM A;  3IHP A;  3O37 A;  3RPG C;  5H9M A;  2YSM A;  2QIZ A;  2LGG A;  1Z2Q A;  2YUR A;  5B76 A;  2ECV A;  2JRJ A;  2YQM A;  2Y1M A;  4V3L C;  3HCU A;  2VPE A;  3HCT A;  2CSZ A;  3PUR A;  2ECI A;  5J3X A;  2KRE A;  4NN2 A;  4BHW A;  4N3W A;  4I7D A;  1XWH A;  3M62 A;  1IYM A;  4CCG X;  4W4U A;  2VPG A;  2QJ0 A;  5C13 A;  4FIP A;  2E6S A;  4A49 A;  1VYX A;  2H0D A;  1WGM A;  4GNE A;  1WIL A;  2UZG A;  5C11 A;  4GNF A;  4GB0 A;  5FB0 A;  1FBV A;  3I2D A;  2VJF B;  5AIU A;  2LXH C;  2LGV A;  4WZ0 A;  3ZPV 1;  5B8D A;  2MD8 C;  2YHN A;  2FUU A;  1JM7 B;  3SHB A;  4AYC A;  4P5O B;  4F52 B;  5FER A;  5B77 A;  1JM7 A;  3LQH A;  2RSD A;  3L1Z B;  3HTK C;  1WEW A;  5H1T A;  2M6M A;  2YRE A;  1VD4 A;  4S3O C;  3ZVY A;  4LKA A;  2VJE A;  2KE1 A;  3U5N A;  2F42 A;  5G0F A;  3MHS A;  4B7Y C;  3C6W A;  1RMD A;  4QF2 A;  1ZBD B;  2ZET C;  4I7B A;  4LLB A;  2CKL A;  2EOD A;  5LKZ A;  3O35 A;  1U6G B;  1WEO A;  3V43 A;  2MNZ A;  4V3K C;  1MM3 A;  3O34 A;  2L5U A;  2KGG A;  2QIC A;  1X4U A;  3L11 A;  5TAB A;  4WZ2 A;  4AVX A;  3N9M A;  5D1M B;  4MSX A;  2KWN A;  5B79 A;  2G43 A;  5DIN A;  3ZPV E;  3EB5 A;  2XB1 A;  3T6R A;  2KYU A;  4CA1 A;  2L75 A;  4LJN A;  3ZYQ A;  3PHD A;  2K4D A;  5KH9 A;  4YBS A;  1MM2 A;  2MIQ A;  3KQI A;  2MA5 A;  1WIM A;  3KNV A;  2H0D B;  3NG2 A;  2C2V S;  2FSA A;  2IDA A;  2M1R A;  2L43 A;  2MD7 B;  1WEE A;  1CHC A;  4Q6F A;  2XEU A;  2F6N A;  1X4I A;  2VPB A;  1T1H A;  1WEV A;  3LRQ A;  4UP5 A;  2K16 A;  4I7C A;  4ZUX U;  2YYR A;  3N9L A;  3DPL R;  3LQJ A;  2JMD A;  3VK6 A;  2KWO A;  2PNX A;  1V87 A;  4AYC B;  1X4J A;  2HYE D;  3GL6 A;  2LXP C;  1E4U A;  1VFY A;  3LQI A;  4YAB A;  2JMI A;  2LN0 A;  3O70 A;  3RPG B;  3ZNI A;  2YQL A;  5G05 B;  5D1K B;  3DQV R;  5TRB A;  2VJE B;  1WE9 A;  2CSY A;  4YBT A;  1WEN A;  4BBQ A;  1WES A;  3M63 A;  5LKU A;  2KWK A;  2KWJ A;  3N9Q A;  3RTR B;  3PUQ A;  3U5P A;  1LDJ B;  4GNG A;  2KFT A;  2CKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...