2DX8A

Crystal structure analysis of the phd domain of the transcription coactivator pygophus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure Analysis of the PHD Domain of the Transcription Coactivator Pygopus
rcsb
source organism Mus musculus
molecule tags Metal binding protein
molecule keywords Pygopus homolog 1
total genus 10
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2dx8A00
3LQHA 3ZVZB 3KNVA 2M6MA 3NG2A 4YADA 3N9NA 4AUQB 3I2DA 3ZPV1 5FB1A 4ZQLA 1WEVA 1VFYA 2FSAA 3KV6A 3HCTA 4YC9A 3HTKC 2F42A 2K17A 3LQJA 3V43A 3IHPA 1FP0A 1WEMA 2JMDA 2K16A 2LN0A 2ZETC 4N4FA 2MD8C 2PNXA 2VJEB 3LQIA 5FERA 5JG6A 2ECIA 2CSYA 2M3HA 2FUUA 1WE9A 2LGKA 3PUQA 2VPEA 2RSDA 2ECJA 2KFTA 2QICA 2YUCA 5B75A 1U6GB 2YU4A 3KQIA 4YBTA 2MT5A 4LJNA 3N9PA 1WIMA 1X4UA 5D1MB 2YSJA 3L1XA 5D1LB 4FIPA 2JMIA 2LRIC 4PTBA 1T1HA 2XEUA 2L5UA 2AN6A 1WEOA 2MIQA 2YQMA 2ECTA 2H0DB 5LKZA 2PUYA 2I50A 4B86C 2YT5A 2K1JA 2C2VS 1VD4A 3U5MA 4BHWA 2XB1A 1VYXA 4AYCA 1MM3A 1WGMA 2YQLA 4V3KC 3LRQA 3RPGB 5B77A 2Y1MA 5KH7A 4WZ0A 4YBSA 2LXPC 4N3WA 2L0BA 2YHOA 1BORA 4WZ3B 1WILA 2EODA 2MNYA 3SHBA 2ECWA 3L11A 4IC3A 4I7BA 4FK5A 5AITA 4F52B 3GV4A 5B79A 2OXQC 2L80A 2CT2A 3DQVR 2HYED 4PPEA 5I3LA 5TABA 3PHDA 3M62A 5FB0A 1WENA 1X4IA 2G45A 4V3LC 5J3XA 2KGIA 2HDPA 4ZDTA 4A49A 4A4CA 2Y1NA 4YATA 2E6SA 2E6RA 4QF2A 4AP4A 1LDKC 5LKUA 3ZPVE 4A0CD 2MUMA 5C13A 2KU3A 1MM2A 3N9QA 5LCWB 4LK9A 2KWJA 1X4JA 2K4DA 1RMDA 3O37A 1WEUA 2YHNA 4W4UA 4GNGA 2MNZA 2G6QA 4MVTA 5TRBA 1XWHA 5TDWA 2VJFB 5H1TA 4YAXA 5D1KB 1WEEA 4WA6A 5H9MA 5H1UA 3ZVYA 2G43A 4GNDA 4AYCB 4LLBA 5KH3A 5LKTA 1Z60A 3MHSA 2EA6A 1F62A 4WZ2A 3M99A 2F6JA 1CHCA 3N9MA 5AIUA 1LDJB 2M1RA 3T7LA 1K2FA 5DKAA 5G0FA 4LKAA 4CCGX 5H1VA 2LXHC 2CKLB 3SOUA 1JM7A 4Q6FA 2MA5A 3U5OA 2KWNA 4I7DA 4YBMA 3KV5A 4QF3A 5G05B 5B8DA 5LKXA 3U5NA 4P5OB 3GL6A 4A4BA 2LGGA 2C2LA 2DX8A 2KE1A 4R2YA 1DVPA 4I7CA 2D8SA 2ECGA 1WFKA 2QJ0A 2KIZA 5DINA 3VK6A 5EYAF 2FUIA 4S3OC 2CSZA 1Z2QA 4O64A 4S3OB 2LDRA 2JMJA 2LGLA 2VJEA 4FJCA 4NN2A 3U5PA 4FO9A 2MA6A 1V87A 1HYIA 2YW8A 2NAAA 5TBNA 1WESA 2YSMA 2VPDA 4R7EA 3O7AA 2L75A 2KWKA 3ZTGA 4IC2A 4GB0A 5TDRA 2QIZA 3L1ZB 4CA1A 3RTRB 4MSXA 4AVXA 1JOCA 4C9ZA 4YABA 4BBQA 3T6RA 2MD7B 5C11A 2YURA 3ASLA 2LGVA 3ZNIA 1HYJA 4L58A 2RI7A 5KH9A 2KGGA 2IDAA 3FL2A 3HCUA 2YREA 2L43A 1WEQA 2VJFA 1ZBDB 2H0DA 3EB5A 3M63A 2Y43A 4X3GA 5G04B 2KR4A 4ZUXU 2KWOA 2ECVA 3C6WA 2KYUA 2LV9A 4GNEA 2YYRA 3N9LA 2KREA 3MHHA 3O35A 3C5KA 2M85A 4B7YC 2BAYA 1N87A 3SOXA 2LQ6A 4XI1A 1WEPA 4UP0A 4R8PK 1Z6UA 2JRJA 4GNFA 2ECNA 2UZGA 2VP7A 4TKPB 3O33A 3O34A 3O36A 3QZVA 4UI9B 2EGPA 2VNFA 2F6NA 3ZYQA 5B78A 3N9OA 5B76A 1FBVA 4L7XA 2VPBA 4LADB 5FEYA 1IYMA 3SOWA 3HCSA 2CKLA 1JM7B 4UP5A 3PURA 1WEWA 3O70A 2VPGA 3RPGC 1E4UA 3DPLR 1G25A 3EB6A
chains in the Genus database with same CATH superfamily
3LQHA 3ZVZB 2P57A 3KNVA 2M6MA 3NG2A 4YADA 3N9NA 4AUQB 3I2DA 3ZPV1 5FB1A 5SVIA 4ZQLA 1WEVA 1VFYA 2FSAA 3DWDA 3KV6A 3HCTA 4YC9A 3HTKC 2F42A 2K17A 3LQJA 3V43A 3IHPA 1FP0A 1WEMA 2JMDA 2K16A 2LN0A 2ZETC 4N4FA 2MD8C 2PNXA 2VJEB 3LQIA 2XOZA 5FERA 5JG6A 2ECIA 2CSYA 2M3HA 2FUUA 1WE9A 3JUEA 2LGKA 3DDTA 3PUQA 2VPEA 2RSDA 2ECJA 4OGCA 2KFTA 2QICA 2YUCA 5B75A 1U6GB 2YU4A 5SVXA 2IQJA 3KDEC 3KQIA 3LDYA 4YBTA 2MT5A 4QQ4A 4LJNA 2L7PA 3N9PA 1WIMA 1X4UA 5D1MB 2YSJA 3L1XA 5D1LB 4FIPA 2JMIA 2LRIC 4PTBA 1T1HA 2XEUA 2L5UA 2AN6A 1WEOA 2MIQA 2YQMA 2ECTA 2H0DB 3M7KA 2FFWA 5LKZA 2YVRA 3E2DA 2PUYA 2I50A 4B86C 3LJUX 4OGEA 2YT5A 2C2VS 1VD4A 2K1JA 3U5MA 4BHWA 2XB1A 1VYXA 4AYCA 1MM3A 2E61A 1WGMA 2YQLA 4V3KC 3FAOA 3LRQA 3RPGB 5B77A 2Y1MA 5KH7A 3O47A 3MDBC 1MBMA 4WZ0A 4YBSA 2LXPC 4N3WA 2L0BA 2YHOA 1BORA 4WZ3B 1WILA 2EODA 2MNYA 3SHBA 2ECWA 3L11A 2EGMA 2M13A 4IC3A 4I7BA 4FK5A 5AITA 4F52B 3GV4A 5B79A 2OXQC 2L80A 2CT2A 3DQVR 2HYED 2MKEA 4PPEA 5I3LA 5TABA 3PHDA 3M62A 5FB0A 1WENA 5K3QA 1X4IA 2G45A 4V3LC 5J3XA 2KGIA 2HDPA 2CRWA 4ZDTA 4A49A 4A4CA 2Y1NA 2FD4A 4YATA 2E6SA 2E6RA 4QF2A 4AP4A 1LDKC 5LKUA 3ZPVE 4A0CD 2MUMA 3T9KA 2KKXA 5C13A 2KU3A 1MM2A 3N9QA 5LCWB 4LK9A 2KWJA 1X4JA 3LVQE 2K4DA 4H9DA 2LAUA 1RMDA 2D8UA 3O37A 1WEUA 2YHNA 4W4UA 4GNGA 2MNZA 2G6QA 4MVTA 5TRBA 1XWHA 5TDWA 2VJFB 5H1TA 4YAXA 5D1KB 1WEEA 4WA6A 5H9MA 5H1UA 3ZVYA 3FM8C 2XP0A 2G43A 4GNDA 4AYCB 4LLBA 5KH3A 5LKTA 1Z60A 3MHSA 2EA6A 1F62A 4WZ2A 5SVYA 3M99A 2F6JA 1CHCA 3N9MA 5AIUA 1LDJB 1DCQA 2M1RA 3T7LA 2JUNA 1K2FA 5DKAA 5G0FA 4LKAA 4CCGX 5H1VA 2LXHC 2CKLB 3SOUA 1JM7A 4Q6FA 2MA5A 3U5OA 2KWNA 4I7DA 4YBMA 3KV5A 2RR4A 4QF3A 5G05B 5B8DA 5LKXA 3U5NA 4P5OB 3GL6A 4A4BA 2LGGA 4O62A 2C2LA 2DX8A 2KE1A 4R2YA 1DVPA 4I7CA 2D8SA 2ECGA 1WFKA 2QJ0A 2CSVA 2KIZA 5DINA 3VK6A 3FANA 2EXUA 5EYAF 2FUIA 4S3OC 2CSZA 1Z2QA 4S3OB 4O64A 2LDRA 2JMJA 2LGLA 2VJEA 3FJUB 4FJCA 4NN2A 3U5PA 4FO9A 2MA6A 1V87A 1HYIA 2YW8A 2NAAA 2JM3A 5TBNA 3LVRE 1WESA 2YSMA 2VPDA 4R7EA 5SVIB 3O7AA 2L75A 2KWKA 3ZTGA 4IC2A 4GB0A 5TDRA 2QIZA 3L1ZB 4CA1A 3RTRB 4MSXA 4Z0OA 4AVXA 1JOCA 4C9ZA 4YABA 4F1PA 4BBQA 3T6RA 2MD7B 5C11A 2YURA 3ASLA 2LGVA 3ZNIA 2DJAA 1HYJA 2XOYA 4L58A 2RI7A 5KH9A 2KGGA 2IDAA 3FL2A 4Z0RA 3HCUA 2YREA 2KKYA 2L43A 3H7HA 1WEQA 2VJFA 1ZBDB 2H0DA 3EB5A 3M63A 2Y43A 4X3GA 5G04B 2KR4A 4ZUXU 2KWOA 2ECVA 3C6WA 2KYUA 2LV9A 4GNEA 2YYRA 3N9LA 2KREA 3MHHA 3FEHA 3O35A 3C5KA 2M85A 4B7YC 2BAYA 1N87A 3SOXA 2B0OE 2LQ6A 4XI1A 2OWAA 1WEPA 4UP0A 4R8PK 1Z6UA 2JRJA 2CONA 3Q1DA 4GNFA 2ECNA 2UZGA 2VP7A 4TKPB 3O33A 3O34A 3O36A 2XOCA 3QZVA 3PLWA 4UI9B 2EGPA 2VNFA 2F6NA 3ZYQA 5B78A 3N9OA 5B76A 1FBVA 2CRRA 4L7XA 2VPBA 4LADB 3SUBA 2DSMA 5FEYA 1IYMA 3SOWA 3HCSA 2CKLA 1JM7B 4UP5A 3PURA 1WEWA 3O70A 2VPGA 3RPGC 1E4UA 3DPLR 1G25A 3EB6A
chains in the Genus database with same CATH topology
3LQHA 3ZVZB 3KNVA 2M6MA 3NG2A 4YADA 3N9NA 4AUQB 3I2DA 3ZPV1 5FB1A 4ZQLA 1WEVA 1VFYA 2FSAA 3KV6A 3HCTA 4YC9A 3HTKC 2F42A 2K17A 3LQJA 3V43A 3IHPA 1FP0A 1WEMA 2JMDA 2K16A 2LN0A 2ZETC 4N4FA 2MD8C 2PNXA 2VJEB 3LQIA 5FERA 5JG6A 2ECIA 2CSYA 2M3HA 2FUUA 1WE9A 2LGKA 3PUQA 2VPEA 2RSDA 2ECJA 2KFTA 2QICA 2YUCA 5B75A 1U6GB 2YU4A 3KQIA 4YBTA 2MT5A 4LJNA 3N9PA 1WIMA 1X4UA 5D1MB 2YSJA 3L1XA 5D1LB 4FIPA 2JMIA 2LRIC 4PTBA 1T1HA 2XEUA 2L5UA 2AN6A 1WEOA 2MIQA 2YQMA 2ECTA 2H0DB 5LKZA 2PUYA 2I50A 4B86C 2YT5A 2K1JA 2C2VS 1VD4A 3U5MA 4BHWA 2XB1A 1VYXA 4AYCA 1MM3A 1WGMA 2YQLA 4V3KC 3LRQA 3RPGB 5B77A 2Y1MA 5KH7A 4WZ0A 4YBSA 2LXPC 4N3WA 2L0BA 2YHOA 1BORA 4WZ3B 1WILA 2EODA 2MNYA 3SHBA 2ECWA 3L11A 4IC3A 4I7BA 4FK5A 5AITA 4F52B 3GV4A 5B79A 2OXQC 2L80A 2CT2A 3DQVR 2HYED 4PPEA 5I3LA 5TABA 3PHDA 3M62A 5FB0A 1WENA 1X4IA 2G45A 4V3LC 5J3XA 2KGIA 2HDPA 4ZDTA 4A49A 4A4CA 2Y1NA 4YATA 2E6SA 2E6RA 4QF2A 4AP4A 1LDKC 5LKUA 3ZPVE 4A0CD 2MUMA 5C13A 2KU3A 1MM2A 3N9QA 5LCWB 4LK9A 2KWJA 1X4JA 2K4DA 1RMDA 3O37A 1WEUA 2YHNA 4W4UA 4GNGA 2MNZA 2G6QA 4MVTA 5TRBA 1XWHA 5TDWA 2VJFB 5H1TA 4YAXA 5D1KB 1WEEA 4WA6A 5H9MA 5H1UA 3ZVYA 2G43A 4GNDA 4AYCB 4LLBA 5KH3A 5LKTA 1Z60A 3MHSA 2EA6A 1F62A 4WZ2A 3M99A 2F6JA 1CHCA 3N9MA 5AIUA 1LDJB 2M1RA 3T7LA 1K2FA 5DKAA 5G0FA 4LKAA 4CCGX 5H1VA 2LXHC 2CKLB 3SOUA 1JM7A 4Q6FA 2MA5A 3U5OA 2KWNA 4I7DA 4YBMA 3KV5A 4QF3A 5G05B 5B8DA 5LKXA 3U5NA 4P5OB 3GL6A 4A4BA 2LGGA 2C2LA 2DX8A 2KE1A 4R2YA 1DVPA 4I7CA 2D8SA 2ECGA 1WFKA 2QJ0A 2KIZA 5DINA 3VK6A 5EYAF 2FUIA 4S3OC 2CSZA 1Z2QA 4O64A 4S3OB 2LDRA 2JMJA 2LGLA 2VJEA 4FJCA 4NN2A 3U5PA 4FO9A 2MA6A 1V87A 1HYIA 2YW8A 2NAAA 5TBNA 1WESA 2YSMA 2VPDA 4R7EA 3O7AA 2L75A 2KWKA 3ZTGA 4IC2A 4GB0A 5TDRA 2QIZA 3L1ZB 4CA1A 3RTRB 4MSXA 4AVXA 1JOCA 4C9ZA 4YABA 4BBQA 3T6RA 2MD7B 5C11A 2YURA 3ASLA 2LGVA 3ZNIA 1HYJA 4L58A 2RI7A 5KH9A 2KGGA 2IDAA 3FL2A 3HCUA 2YREA 2L43A 1WEQA 2VJFA 1ZBDB 2H0DA 3EB5A 3M63A 2Y43A 4X3GA 5G04B 2KR4A 4ZUXU 2KWOA 2ECVA 3C6WA 2KYUA 2LV9A 4GNEA 2YYRA 3N9LA 2KREA 3MHHA 3O35A 3C5KA 2M85A 4B7YC 2BAYA 1N87A 3SOXA 2LQ6A 4XI1A 1WEPA 4UP0A 4R8PK 1Z6UA 2JRJA 4GNFA 2ECNA 2UZGA 2VP7A 4TKPB 3O33A 3O34A 3O36A 3QZVA 4UI9B 2EGPA 2VNFA 2F6NA 3ZYQA 5B78A 3N9OA 5B76A 1FBVA 4L7XA 2VPBA 4LADB 5FEYA 1IYMA 3SOWA 3HCSA 2CKLA 1JM7B 4UP5A 3PURA 1WEWA 3O70A 2VPGA 3RPGC 1E4UA 3DPLR 1G25A 3EB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQH A;  3ZVZ B;  3KNV A;  2M6M A;  3NG2 A;  4YAD A;  3N9N A;  4AUQ B;  3I2D A;  3ZPV 1;  5FB1 A;  4ZQL A;  1WEV A;  1VFY A;  2FSA A;  3KV6 A;  3HCT A;  4YC9 A;  3HTK C;  2F42 A;  2K17 A;  3LQJ A;  3V43 A;  3IHP A;  1FP0 A;  1WEM A;  2JMD A;  2K16 A;  2LN0 A;  2ZET C;  4N4F A;  2MD8 C;  2PNX A;  2VJE B;  3LQI A;  5FER A;  5JG6 A;  2ECI A;  2CSY A;  2M3H A;  2FUU A;  1WE9 A;  2LGK A;  3PUQ A;  2VPE A;  2RSD A;  2ECJ A;  2KFT A;  2QIC A;  2YUC A;  5B75 A;  1U6G B;  2YU4 A;  3KQI A;  4YBT A;  2MT5 A;  4LJN A;  3N9P A;  1WIM A;  1X4U A;  5D1M B;  2YSJ A;  3L1X A;  5D1L B;  4FIP A;  2JMI A;  2LRI C;  4PTB A;  1T1H A;  2XEU A;  2L5U A;  2AN6 A;  1WEO A;  2MIQ A;  2YQM A;  2ECT A;  2H0D B;  5LKZ A;  2PUY A;  2I50 A;  4B86 C;  2YT5 A;  2K1J A;  2C2V S;  1VD4 A;  3U5M A;  4BHW A;  2XB1 A;  1VYX A;  4AYC A;  1MM3 A;  1WGM A;  2YQL A;  4V3K C;  3LRQ A;  3RPG B;  5B77 A;  2Y1M A;  5KH7 A;  4WZ0 A;  4YBS A;  2LXP C;  4N3W A;  2L0B A;  2YHO A;  1BOR A;  4WZ3 B;  1WIL A;  2EOD A;  2MNY A;  3SHB A;  2ECW A;  3L11 A;  4IC3 A;  4I7B A;  4FK5 A;  5AIT A;  4F52 B;  3GV4 A;  5B79 A;  2OXQ C;  2L80 A;  2CT2 A;  3DQV R;  2HYE D;  4PPE A;  5I3L A;  5TAB A;  3PHD A;  3M62 A;  5FB0 A;  1WEN A;  1X4I A;  2G45 A;  4V3L C;  5J3X A;  2KGI A;  2HDP A;  4ZDT A;  4A49 A;  4A4C A;  2Y1N A;  4YAT A;  2E6S A;  2E6R A;  4QF2 A;  4AP4 A;  1LDK C;  5LKU A;  3ZPV E;  4A0C D;  2MUM A;  5C13 A;  2KU3 A;  1MM2 A;  3N9Q A;  5LCW B;  4LK9 A;  2KWJ A;  1X4J A;  2K4D A;  1RMD A;  3O37 A;  1WEU A;  2YHN A;  4W4U A;  4GNG A;  2MNZ A;  2G6Q A;  4MVT A;  5TRB A;  1XWH A;  5TDW A;  2VJF B;  5H1T A;  4YAX A;  5D1K B;  1WEE A;  4WA6 A;  5H9M A;  5H1U A;  3ZVY A;  2G43 A;  4GND A;  4AYC B;  4LLB A;  5KH3 A;  5LKT A;  1Z60 A;  3MHS A;  2EA6 A;  1F62 A;  4WZ2 A;  3M99 A;  2F6J A;  1CHC A;  3N9M A;  5AIU A;  1LDJ B;  2M1R A;  3T7L A;  1K2F A;  5DKA A;  5G0F A;  4LKA A;  4CCG X;  5H1V A;  2LXH C;  2CKL B;  3SOU A;  1JM7 A;  4Q6F A;  2MA5 A;  3U5O A;  2KWN A;  4I7D A;  4YBM A;  3KV5 A;  4QF3 A;  5G05 B;  5B8D A;  5LKX A;  3U5N A;  4P5O B;  3GL6 A;  4A4B A;  2LGG A;  2C2L A;  2DX8 A;  2KE1 A;  4R2Y A;  1DVP A;  4I7C A;  2D8S A;  2ECG A;  1WFK A;  2QJ0 A;  2KIZ A;  5DIN A;  3VK6 A;  5EYA F;  2FUI A;  4S3O C;  2CSZ A;  1Z2Q A;  4O64 A;  4S3O B;  2LDR A;  2JMJ A;  2LGL A;  2VJE A;  4FJC A;  4NN2 A;  3U5P A;  4FO9 A;  2MA6 A;  1V87 A;  1HYI A;  2YW8 A;  2NAA A;  5TBN A;  1WES A;  2YSM A;  2VPD A;  4R7E A;  3O7A A;  2L75 A;  2KWK A;  3ZTG A;  4IC2 A;  4GB0 A;  5TDR A;  2QIZ A;  3L1Z B;  4CA1 A;  3RTR B;  4MSX A;  4AVX A;  1JOC A;  4C9Z A;  4YAB A;  4BBQ A;  3T6R A;  2MD7 B;  5C11 A;  2YUR A;  3ASL A;  2LGV A;  3ZNI A;  1HYJ A;  4L58 A;  2RI7 A;  5KH9 A;  2KGG A;  2IDA A;  3FL2 A;  3HCU A;  2YRE A;  2L43 A;  1WEQ A;  2VJF A;  1ZBD B;  2H0D A;  3EB5 A;  3M63 A;  2Y43 A;  4X3G A;  5G04 B;  2KR4 A;  4ZUX U;  2KWO A;  2ECV A;  3C6W A;  2KYU A;  2LV9 A;  4GNE A;  2YYR A;  3N9L A;  2KRE A;  3MHH A;  3O35 A;  3C5K A;  2M85 A;  4B7Y C;  2BAY A;  1N87 A;  3SOX A;  2LQ6 A;  4XI1 A;  1WEP A;  4UP0 A;  4R8P K;  1Z6U A;  2JRJ A;  4GNF A;  2ECN A;  2UZG A;  2VP7 A;  4TKP B;  3O33 A;  3O34 A;  3O36 A;  3QZV A;  4UI9 B;  2EGP A;  2VNF A;  2F6N A;  3ZYQ A;  5B78 A;  3N9O A;  5B76 A;  1FBV A;  4L7X A;  2VPB A;  4LAD B;  5FEY A;  1IYM A;  3SOW A;  3HCS A;  2CKL A;  1JM7 B;  4UP5 A;  3PUR A;  1WEW A;  3O70 A;  2VPG A;  3RPG C;  1E4U A;  3DPL R;  1G25 A;  3EB6 A; 
#chains in the Genus database with same CATH topology
 3LQH A;  3ZVZ B;  2P57 A;  3KNV A;  2M6M A;  3NG2 A;  4YAD A;  3N9N A;  4AUQ B;  3I2D A;  3ZPV 1;  5FB1 A;  5SVI A;  4ZQL A;  1WEV A;  1VFY A;  2FSA A;  3DWD A;  3KV6 A;  3HCT A;  4YC9 A;  3HTK C;  2F42 A;  2K17 A;  3LQJ A;  3V43 A;  3IHP A;  1FP0 A;  1WEM A;  2JMD A;  2K16 A;  2LN0 A;  2ZET C;  4N4F A;  2MD8 C;  2PNX A;  2VJE B;  3LQI A;  2XOZ A;  5FER A;  5JG6 A;  2ECI A;  2CSY A;  2M3H A;  2FUU A;  1WE9 A;  3JUE A;  2LGK A;  3DDT A;  3PUQ A;  2VPE A;  2RSD A;  2ECJ A;  4OGC A;  2KFT A;  2QIC A;  2YUC A;  5B75 A;  1U6G B;  2YU4 A;  5SVX A;  2IQJ A;  3KDE C;  3KQI A;  3LDY A;  4YBT A;  2MT5 A;  4QQ4 A;  4LJN A;  2L7P A;  3N9P A;  1WIM A;  1X4U A;  5D1M B;  2YSJ A;  3L1X A;  5D1L B;  4FIP A;  2JMI A;  2LRI C;  4PTB A;  1T1H A;  2XEU A;  2L5U A;  2AN6 A;  1WEO A;  2MIQ A;  2YQM A;  2ECT A;  2H0D B;  3M7K A;  2FFW A;  5LKZ A;  2YVR A;  3E2D A;  2PUY A;  2I50 A;  4B86 C;  3LJU X;  4OGE A;  2YT5 A;  2C2V S;  1VD4 A;  2K1J A;  3U5M A;  4BHW A;  2XB1 A;  1VYX A;  4AYC A;  1MM3 A;  2E61 A;  1WGM A;  2YQL A;  4V3K C;  3FAO A;  3LRQ A;  3RPG B;  5B77 A;  2Y1M A;  5KH7 A;  3O47 A;  3MDB C;  1MBM A;  4WZ0 A;  4YBS A;  2LXP C;  4N3W A;  2L0B A;  2YHO A;  1BOR A;  4WZ3 B;  1WIL A;  2EOD A;  2MNY A;  3SHB A;  2ECW A;  3L11 A;  2EGM A;  2M13 A;  4IC3 A;  4I7B A;  4FK5 A;  5AIT A;  4F52 B;  3GV4 A;  5B79 A;  2OXQ C;  2L80 A;  2CT2 A;  3DQV R;  2HYE D;  2MKE A;  4PPE A;  5I3L A;  5TAB A;  3PHD A;  3M62 A;  5FB0 A;  1WEN A;  5K3Q A;  1X4I A;  2G45 A;  4V3L C;  5J3X A;  2KGI A;  2HDP A;  2CRW A;  4ZDT A;  4A49 A;  4A4C A;  2Y1N A;  2FD4 A;  4YAT A;  2E6S A;  2E6R A;  4QF2 A;  4AP4 A;  1LDK C;  5LKU A;  3ZPV E;  4A0C D;  2MUM A;  3T9K A;  2KKX A;  5C13 A;  2KU3 A;  1MM2 A;  3N9Q A;  5LCW B;  4LK9 A;  2KWJ A;  1X4J A;  3LVQ E;  2K4D A;  4H9D A;  2LAU A;  1RMD A;  2D8U A;  3O37 A;  1WEU A;  2YHN A;  4W4U A;  4GNG A;  2MNZ A;  2G6Q A;  4MVT A;  5TRB A;  1XWH A;  5TDW A;  2VJF B;  5H1T A;  4YAX A;  5D1K B;  1WEE A;  4WA6 A;  5H9M A;  5H1U A;  3ZVY A;  3FM8 C;  2XP0 A;  2G43 A;  4GND A;  4AYC B;  4LLB A;  5KH3 A;  5LKT A;  1Z60 A;  3MHS A;  2EA6 A;  1F62 A;  4WZ2 A;  5SVY A;  3M99 A;  2F6J A;  1CHC A;  3N9M A;  5AIU A;  1LDJ B;  1DCQ A;  2M1R A;  3T7L A;  2JUN A;  1K2F A;  5DKA A;  5G0F A;  4LKA A;  4CCG X;  5H1V A;  2LXH C;  2CKL B;  3SOU A;  1JM7 A;  4Q6F A;  2MA5 A;  3U5O A;  2KWN A;  4I7D A;  4YBM A;  3KV5 A;  2RR4 A;  4QF3 A;  5G05 B;  5B8D A;  5LKX A;  3U5N A;  4P5O B;  3GL6 A;  4A4B A;  2LGG A;  4O62 A;  2C2L A;  2DX8 A;  2KE1 A;  4R2Y A;  1DVP A;  4I7C A;  2D8S A;  2ECG A;  1WFK A;  2QJ0 A;  2CSV A;  2KIZ A;  5DIN A;  3VK6 A;  3FAN A;  2EXU A;  5EYA F;  2FUI A;  4S3O C;  2CSZ A;  1Z2Q A;  4S3O B;  4O64 A;  2LDR A;  2JMJ A;  2LGL A;  2VJE A;  3FJU B;  4FJC A;  4NN2 A;  3U5P A;  4FO9 A;  2MA6 A;  1V87 A;  1HYI A;  2YW8 A;  2NAA A;  2JM3 A;  5TBN A;  3LVR E;  1WES A;  2YSM A;  2VPD A;  4R7E A;  5SVI B;  3O7A A;  2L75 A;  2KWK A;  3ZTG A;  4IC2 A;  4GB0 A;  5TDR A;  2QIZ A;  3L1Z B;  4CA1 A;  3RTR B;  4MSX A;  4Z0O A;  4AVX A;  1JOC A;  4C9Z A;  4YAB A;  4F1P A;  4BBQ A;  3T6R A;  2MD7 B;  5C11 A;  2YUR A;  3ASL A;  2LGV A;  3ZNI A;  2DJA A;  1HYJ A;  2XOY A;  4L58 A;  2RI7 A;  5KH9 A;  2KGG A;  2IDA A;  3FL2 A;  4Z0R A;  3HCU A;  2YRE A;  2KKY A;  2L43 A;  3H7H A;  1WEQ A;  2VJF A;  1ZBD B;  2H0D A;  3EB5 A;  3M63 A;  2Y43 A;  4X3G A;  5G04 B;  2KR4 A;  4ZUX U;  2KWO A;  2ECV A;  3C6W A;  2KYU A;  2LV9 A;  4GNE A;  2YYR A;  3N9L A;  2KRE A;  3MHH A;  3FEH A;  3O35 A;  3C5K A;  2M85 A;  4B7Y C;  2BAY A;  1N87 A;  3SOX A;  2B0O E;  2LQ6 A;  4XI1 A;  2OWA A;  1WEP A;  4UP0 A;  4R8P K;  1Z6U A;  2JRJ A;  2CON A;  3Q1D A;  4GNF A;  2ECN A;  2UZG A;  2VP7 A;  4TKP B;  3O33 A;  3O34 A;  3O36 A;  2XOC A;  3QZV A;  3PLW A;  4UI9 B;  2EGP A;  2VNF A;  2F6N A;  3ZYQ A;  5B78 A;  3N9O A;  5B76 A;  1FBV A;  2CRR A;  4L7X A;  2VPB A;  4LAD B;  3SUB A;  2DSM A;  5FEY A;  1IYM A;  3SOW A;  3HCS A;  2CKL A;  1JM7 B;  4UP5 A;  3PUR A;  1WEW A;  3O70 A;  2VPG A;  3RPG C;  1E4U A;  3DPL R;  1G25 A;  3EB6 A; 
#chains in the Genus database with same CATH homology
 3LQH A;  3ZVZ B;  3KNV A;  2M6M A;  3NG2 A;  4YAD A;  3N9N A;  4AUQ B;  3I2D A;  3ZPV 1;  5FB1 A;  4ZQL A;  1WEV A;  1VFY A;  2FSA A;  3KV6 A;  3HCT A;  4YC9 A;  3HTK C;  2F42 A;  2K17 A;  3LQJ A;  3V43 A;  3IHP A;  1FP0 A;  1WEM A;  2JMD A;  2K16 A;  2LN0 A;  2ZET C;  4N4F A;  2MD8 C;  2PNX A;  2VJE B;  3LQI A;  5FER A;  5JG6 A;  2ECI A;  2CSY A;  2M3H A;  2FUU A;  1WE9 A;  2LGK A;  3PUQ A;  2VPE A;  2RSD A;  2ECJ A;  2KFT A;  2QIC A;  2YUC A;  5B75 A;  1U6G B;  2YU4 A;  3KQI A;  4YBT A;  2MT5 A;  4LJN A;  3N9P A;  1WIM A;  1X4U A;  5D1M B;  2YSJ A;  3L1X A;  5D1L B;  4FIP A;  2JMI A;  2LRI C;  4PTB A;  1T1H A;  2XEU A;  2L5U A;  2AN6 A;  1WEO A;  2MIQ A;  2YQM A;  2ECT A;  2H0D B;  5LKZ A;  2PUY A;  2I50 A;  4B86 C;  2YT5 A;  2K1J A;  2C2V S;  1VD4 A;  3U5M A;  4BHW A;  2XB1 A;  1VYX A;  4AYC A;  1MM3 A;  1WGM A;  2YQL A;  4V3K C;  3LRQ A;  3RPG B;  5B77 A;  2Y1M A;  5KH7 A;  4WZ0 A;  4YBS A;  2LXP C;  4N3W A;  2L0B A;  2YHO A;  1BOR A;  4WZ3 B;  1WIL A;  2EOD A;  2MNY A;  3SHB A;  2ECW A;  3L11 A;  4IC3 A;  4I7B A;  4FK5 A;  5AIT A;  4F52 B;  3GV4 A;  5B79 A;  2OXQ C;  2L80 A;  2CT2 A;  3DQV R;  2HYE D;  4PPE A;  5I3L A;  5TAB A;  3PHD A;  3M62 A;  5FB0 A;  1WEN A;  1X4I A;  2G45 A;  4V3L C;  5J3X A;  2KGI A;  2HDP A;  4ZDT A;  4A49 A;  4A4C A;  2Y1N A;  4YAT A;  2E6S A;  2E6R A;  4QF2 A;  4AP4 A;  1LDK C;  5LKU A;  3ZPV E;  4A0C D;  2MUM A;  5C13 A;  2KU3 A;  1MM2 A;  3N9Q A;  5LCW B;  4LK9 A;  2KWJ A;  1X4J A;  2K4D A;  1RMD A;  3O37 A;  1WEU A;  2YHN A;  4W4U A;  4GNG A;  2MNZ A;  2G6Q A;  4MVT A;  5TRB A;  1XWH A;  5TDW A;  2VJF B;  5H1T A;  4YAX A;  5D1K B;  1WEE A;  4WA6 A;  5H9M A;  5H1U A;  3ZVY A;  2G43 A;  4GND A;  4AYC B;  4LLB A;  5KH3 A;  5LKT A;  1Z60 A;  3MHS A;  2EA6 A;  1F62 A;  4WZ2 A;  3M99 A;  2F6J A;  1CHC A;  3N9M A;  5AIU A;  1LDJ B;  2M1R A;  3T7L A;  1K2F A;  5DKA A;  5G0F A;  4LKA A;  4CCG X;  5H1V A;  2LXH C;  2CKL B;  3SOU A;  1JM7 A;  4Q6F A;  2MA5 A;  3U5O A;  2KWN A;  4I7D A;  4YBM A;  3KV5 A;  4QF3 A;  5G05 B;  5B8D A;  5LKX A;  3U5N A;  4P5O B;  3GL6 A;  4A4B A;  2LGG A;  2C2L A;  2DX8 A;  2KE1 A;  4R2Y A;  1DVP A;  4I7C A;  2D8S A;  2ECG A;  1WFK A;  2QJ0 A;  2KIZ A;  5DIN A;  3VK6 A;  5EYA F;  2FUI A;  4S3O C;  2CSZ A;  1Z2Q A;  4O64 A;  4S3O B;  2LDR A;  2JMJ A;  2LGL A;  2VJE A;  4FJC A;  4NN2 A;  3U5P A;  4FO9 A;  2MA6 A;  1V87 A;  1HYI A;  2YW8 A;  2NAA A;  5TBN A;  1WES A;  2YSM A;  2VPD A;  4R7E A;  3O7A A;  2L75 A;  2KWK A;  3ZTG A;  4IC2 A;  4GB0 A;  5TDR A;  2QIZ A;  3L1Z B;  4CA1 A;  3RTR B;  4MSX A;  4AVX A;  1JOC A;  4C9Z A;  4YAB A;  4BBQ A;  3T6R A;  2MD7 B;  5C11 A;  2YUR A;  3ASL A;  2LGV A;  3ZNI A;  1HYJ A;  4L58 A;  2RI7 A;  5KH9 A;  2KGG A;  2IDA A;  3FL2 A;  3HCU A;  2YRE A;  2L43 A;  1WEQ A;  2VJF A;  1ZBD B;  2H0D A;  3EB5 A;  3M63 A;  2Y43 A;  4X3G A;  5G04 B;  2KR4 A;  4ZUX U;  2KWO A;  2ECV A;  3C6W A;  2KYU A;  2LV9 A;  4GNE A;  2YYR A;  3N9L A;  2KRE A;  3MHH A;  3O35 A;  3C5K A;  2M85 A;  4B7Y C;  2BAY A;  1N87 A;  3SOX A;  2LQ6 A;  4XI1 A;  1WEP A;  4UP0 A;  4R8P K;  1Z6U A;  2JRJ A;  4GNF A;  2ECN A;  2UZG A;  2VP7 A;  4TKP B;  3O33 A;  3O34 A;  3O36 A;  3QZV A;  4UI9 B;  2EGP A;  2VNF A;  2F6N A;  3ZYQ A;  5B78 A;  3N9O A;  5B76 A;  1FBV A;  4L7X A;  2VPB A;  4LAD B;  5FEY A;  1IYM A;  3SOW A;  3HCS A;  2CKL A;  1JM7 B;  4UP5 A;  3PUR A;  1WEW A;  3O70 A;  2VPG A;  3RPG C;  1E4U A;  3DPL R;  1G25 A;  3EB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...