2KR4A

U-box domain of the e3 ubiquitin ligase e4b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
85
structure length
85
Chain Sequence
b'PGSAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVPELKEQIQAWMREKQSSDH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin conjugation factor E4 B
publication title Structural and functional characterization of the monomeric U-box domain from E4B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 19
structure length 85
sequence length 85
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kr4A01
2JMIA 2M1RA 4AYCA 1BORA 3PUQA 1XWHA 2L75A 1X4IA 1ZBDB 2Y43A 2IDAA 3M63A 1VFYA 1WEEA 2L80A 5LKZA 3T6RA 5B79A 4A49A 4ZUXU 1U6GB 1FP0A 2E6SA 2MD7B 5FB1A 2DX8A 2EODA 4LADB 3N9OA 2YW8A 5DKAA 3T7LA 4IC3A 3O37A 2G6QA 5KH3A 2C2LA 2L0BA 2FUIA 4YBMA 4LJNA 2MUMA 4P5OB 4IC2A 2Y1MA 2MNYA 4LKAA 1X4JA 2MA6A 3MHSA 5DINA 3KQIA 2BAYA 2KE1A 2CKLA 3GV4A 2JRJA 3U5PA 5B76A 1WEQA 3HCTA 2KREA 3ZVZB 2YUCA 4V3KC 5C13A 2ECJA 5TDWA 2H0DA 5LKUA 2VJEB 3LRQA 3EB6A 2LGLA 1Z2QA 1VD4A 4A0CD 5H9MA 2YREA 2MD8C 5TRBA 4I7BA 3SOUA 2HDPA 5TBNA 2ZETC 2G43A 4WZ3B 5FB0A 4I7CA 4YAXA 4WZ0A 4AUQB 1WENA 4XI1A 2YQLA 4UP0A 2QJ0A 2MIQA 5H1VA 3ZNIA 2RSDA 3U5NA 3L1ZB 2YQMA 3KNVA 4MVTA 5LCWB 4N3WA 4LK9A 3RTRB 4FIPA 4R8PK 5G04B 2YYRA 2KFTA 1JM7A 5EYAF 2CT2A 4O64A 2LRIC 4YADA 1WFKA 3L1XA 2AN6A 3O36A 5AITA 1MM2A 3KV6A 4X3GA 1WEWA 2MNZA 4PPEA 4TKPB 2CKLB 2VJFA 2FSAA 3DQVR 1DVPA 4I7DA 3N9QA 2YSMA 3ZTGA 4CCGX 2G45A 3ZPV1 1WEVA 4YC9A 2H0DB 4AVXA 5B8DA 4L7XA 1WGMA 1JOCA 2E6RA 5H1TA 2K16A 2NAAA 1WILA 5KH9A 3U5OA 2L5UA 3SOXA 2ECTA 3ZYQA 1WEUA 3O33A 3N9PA 2ECWA 2KIZA 2UZGA 3GL6A 4B7YC 1V87A 1VYXA 2YHNA 3N9LA 2K1JA 2KYUA 5C11A 4FJCA 4YATA 2HYED 4A4CA 5JG6A 1RMDA 3O34A 2XEUA 3O70A 3PHDA 5D1MB 2QICA 3DPLR 5FEYA 1IYMA 5G0FA 3C6WA 2LGGA 3FL2A 4R2YA 2L43A 2F6JA 3ZPVE 1JM7B 2MA5A 5B77A 2KWNA 4AP4A 2KWOA 4FK5A 5H1UA 4AYCB 2KWKA 4LLBA 5I3LA 1K2FA 2KGIA 3RPGC 1MM3A 2PNXA 3VK6A 2YSJA 2VP7A 2CSZA 2VJFB 3HTKC 3I2DA 3PURA 1WEMA 2EA6A 4F52B 4QF3A 4PTBA 2KGGA 3U5MA 4R7EA 4GB0A 4L58A 3RPGB 4V3LC 2YURA 2KWJA 2F42A 3SOWA 2LDRA 1E4UA 2F6NA 3C5KA 2VPBA 2PUYA 4WA6A 3LQHA 4WZ2A 4W4UA 2KU3A 2K17A 1LDKC 5B75A 2M6MA 1WEPA 2JMJA 3QZVA 4B86C 2EGPA 2ECVA 5TABA 4YBTA 1T1HA 1WE9A 1LDJB 4S3OC 5B78A 2K4DA 2QIZA 2MT5A 1N87A 2M3HA 4YBSA 3NG2A 3L11A 3HCSA 2KR4A 2VPDA 4YABA 2ECNA 1HYJA 2XB1A 4BBQA 4S3OB 1Z60A 2RI7A 3KV5A 2OXQC 4FO9A 4UP5A 5TDRA 2LGKA 4QF2A 2VPEA 2LXHC 4Q6FA 3V43A 5LKTA 2D8SA 4ZQLA 3LQIA 4GNFA 4GNDA 5J3XA 2LQ6A 3MHHA 4N4FA 1HYIA 2M85A 3M99A 3M62A 3SHBA 3ZVYA 5LKXA 4NN2A 4CA1A 3O7AA 5D1KB 4MSXA 2LGVA 5G05B 3N9NA 3IHPA 2CSYA 3HCUA 1CHCA 2LXPC 5KH7A 5AIUA 3N9MA 5FERA 1F62A 2ECGA 2Y1NA 4GNGA 1X4UA 2JMDA 2VPGA 2LN0A 4ZDTA 2YU4A 3O35A 4UI9B 2I50A 5D1LB 2ECIA 1FBVA 3ASLA 2FUUA 1WEOA 2C2VS 1Z6UA 2YHOA 2LV9A 2YT5A 1WESA 4BHWA 3LQJA 4A4BA 3EB5A 4GNEA 2VJEA 2VNFA 4C9ZA 1G25A 1WIMA
chains in the Genus database with same CATH superfamily
2JMIA 2M1RA 4AYCA 1BORA 3MDBC 3PUQA 1XWHA 2L75A 1X4IA 1ZBDB 2Y43A 2IDAA 3M63A 1VFYA 1WEEA 2L80A 5LKZA 3T6RA 5B79A 4A49A 4ZUXU 1U6GB 1FP0A 2E6SA 2MD7B 5FB1A 5SVIB 2DX8A 2EODA 4LADB 3N9OA 2YW8A 5DKAA 3T7LA 4IC3A 3O37A 2G6QA 5KH3A 2C2LA 2L0BA 3PLWA 4H9DA 2FUIA 4YBMA 4LJNA 2MUMA 4P5OB 3T9KA 4IC2A 2Y1MA 2MNYA 2CONA 4LKAA 1X4JA 2MA6A 3MHSA 5DINA 3KQIA 2BAYA 2KE1A 3LDYA 2CKLA 3GV4A 2JRJA 3U5PA 5B76A 1WEQA 3HCTA 2KREA 3ZVZB 2YUCA 4V3KC 5C13A 2ECJA 5TDWA 2H0DA 4O62A 5LKUA 2VJEB 2IQJA 3LRQA 3EB6A 2LGLA 1Z2QA 2RR4A 1VD4A 4A0CD 5H9MA 2YREA 2MD8C 2DJAA 5TRBA 4I7BA 3SOUA 2HDPA 5TBNA 2ZETC 2G43A 4WZ3B 5FB0A 4I7CA 3LJUX 4YAXA 4F1PA 2M13A 4WZ0A 4AUQB 1WENA 4XI1A 2YQLA 2XOCA 4UP0A 2QJ0A 2MIQA 5H1VA 3ZNIA 2RSDA 3U5NA 3L1ZB 2YQMA 3KNVA 4MVTA 5SVYA 5LCWB 4N3WA 4LK9A 3RTRB 4FIPA 4R8PK 5G04B 2OWAA 2YYRA 2KFTA 1JM7A 5EYAF 2CT2A 4O64A 2LRIC 4YADA 1DCQA 1WFKA 3L1XA 2AN6A 2XOYA 3O36A 2LAUA 5AITA 1MM2A 3KV6A 4X3GA 1WEWA 2MNZA 4PPEA 4TKPB 2CKLB 2VJFA 2FSAA 3DQVR 1DVPA 4I7DA 3N9QA 2YSMA 3FEHA 3ZTGA 4CCGX 4Z0RA 2G45A 3ZPV1 1WEVA 4YC9A 2H0DB 4AVXA 5B8DA 4L7XA 1WGMA 1JOCA 2E6RA 5H1TA 2K16A 5K3QA 2NAAA 1WILA 5KH9A 3LVRE 2L5UA 3U5OA 3SOXA 2ECTA 3ZYQA 1WEUA 3O33A 3N9PA 2ECWA 2KIZA 2UZGA 3GL6A 2L7PA 4B7YC 1V87A 1VYXA 2YHNA 3N9LA 2K1JA 2KYUA 5C11A 4FJCA 4YATA 2HYED 4A4CA 5JG6A 2JM3A 1RMDA 3O34A 2XEUA 3O70A 3PHDA 5D1MB 2QICA 3M7KA 3DPLR 5FEYA 1IYMA 3C6WA 5G0FA 2LGGA 3FL2A 4R2YA 2L43A 2F6JA 3ZPVE 1JM7B 2MA5A 5B77A 2KWNA 4AP4A 2KWOA 4FK5A 5H1UA 2E61A 2KKYA 3JUEA 4AYCB 2KWKA 4LLBA 5I3LA 1K2FA 2CSVA 2KGIA 3RPGC 1MM3A 2PNXA 3VK6A 5SVXA 2YSJA 2VP7A 2CSZA 2B0OE 2VJFB 3HTKC 3I2DA 3PURA 1WEMA 3E2DA 2EA6A 3FAOA 4F52B 4QF3A 4PTBA 3KDEC 2KGGA 3U5MA 4R7EA 4GB0A 4L58A 3RPGB 3LVQE 3FM8C 4V3LC 2YURA 2KWJA 2F42A 2CRWA 3SOWA 2LDRA 1E4UA 2F6NA 3C5KA 2VPBA 2PUYA 4WA6A 3LQHA 4OGEA 4WZ2A 4W4UA 2KU3A 2K17A 1LDKC 3FANA 5B75A 2D8UA 2M6MA 1WEPA 2JMJA 3QZVA 4B86C 2EGPA 2ECVA 5TABA 2CRRA 4YBTA 1T1HA 1WE9A 1LDJB 4S3OC 5B78A 2K4DA 2QIZA 2MT5A 1MBMA 1N87A 2MKEA 2M3HA 3DWDA 4YBSA 3NG2A 2DSMA 3L11A 3HCSA 2KR4A 2VPDA 4YABA 2ECNA 1HYJA 2XB1A 3SUBA 4S3OB 4BBQA 1Z60A 3H7HA 2RI7A 3KV5A 2OXQC 3DDTA 4FO9A 2JUNA 4UP5A 5TDRA 2LGKA 2FD4A 4QF2A 2VPEA 2LXHC 4Q6FA 3V43A 5LKTA 2D8SA 4ZQLA 3LQIA 4GNFA 4GNDA 5J3XA 2LQ6A 3MHHA 4N4FA 1HYIA 2M85A 3M99A 2XOZA 3M62A 3SHBA 3ZVYA 5LKXA 2XP0A 4NN2A 4CA1A 3O7AA 2FFWA 5D1KB 4MSXA 2YVRA 2LGVA 4QQ4A 5SVIA 5G05B 3N9NA 3IHPA 2CSYA 3HCUA 1CHCA 2LXPC 5KH7A 4OGCA 5AIUA 3N9MA 5FERA 1F62A 2ECGA 2Y1NA 4GNGA 1X4UA 2JMDA 2VPGA 3FJUB 2KKXA 2LN0A 2YU4A 4UI9B 3O35A 4ZDTA 2I50A 5D1LB 2ECIA 1FBVA 3Q1DA 3ASLA 2FUUA 1WEOA 2C2VS 1Z6UA 2YHOA 2LV9A 2YT5A 3O47A 1WESA 4BHWA 3LQJA 4A4BA 3EB5A 4GNEA 2VJEA 2P57A 4Z0OA 2VNFA 4C9ZA 2EGMA 1G25A 2EXUA 1WIMA
chains in the Genus database with same CATH topology
2JMIA 2M1RA 4AYCA 1BORA 3PUQA 1XWHA 2L75A 1X4IA 1ZBDB 2Y43A 2IDAA 3M63A 1VFYA 1WEEA 2L80A 5LKZA 3T6RA 5B79A 4A49A 4ZUXU 1U6GB 1FP0A 2E6SA 2MD7B 5FB1A 2DX8A 2EODA 4LADB 3N9OA 2YW8A 5DKAA 3T7LA 4IC3A 3O37A 2G6QA 5KH3A 2C2LA 2L0BA 2FUIA 4YBMA 4LJNA 2MUMA 4P5OB 4IC2A 2Y1MA 2MNYA 4LKAA 1X4JA 2MA6A 3MHSA 5DINA 3KQIA 2BAYA 2KE1A 2CKLA 3GV4A 2JRJA 3U5PA 5B76A 1WEQA 3HCTA 2KREA 3ZVZB 2YUCA 4V3KC 5C13A 2ECJA 5TDWA 2H0DA 5LKUA 2VJEB 3LRQA 3EB6A 2LGLA 1Z2QA 1VD4A 4A0CD 5H9MA 2YREA 2MD8C 5TRBA 4I7BA 3SOUA 2HDPA 5TBNA 2ZETC 2G43A 4WZ3B 5FB0A 4I7CA 4YAXA 4WZ0A 4AUQB 1WENA 4XI1A 2YQLA 4UP0A 2QJ0A 2MIQA 5H1VA 3ZNIA 2RSDA 3U5NA 3L1ZB 2YQMA 3KNVA 4MVTA 5LCWB 4N3WA 4LK9A 3RTRB 4FIPA 4R8PK 5G04B 2YYRA 2KFTA 1JM7A 5EYAF 2CT2A 4O64A 2LRIC 4YADA 1WFKA 3L1XA 2AN6A 3O36A 5AITA 1MM2A 3KV6A 4X3GA 1WEWA 2MNZA 4PPEA 4TKPB 2CKLB 2VJFA 2FSAA 3DQVR 1DVPA 4I7DA 3N9QA 2YSMA 3ZTGA 4CCGX 2G45A 3ZPV1 1WEVA 4YC9A 2H0DB 4AVXA 5B8DA 4L7XA 1WGMA 1JOCA 2E6RA 5H1TA 2K16A 2NAAA 1WILA 5KH9A 3U5OA 2L5UA 3SOXA 2ECTA 3ZYQA 1WEUA 3O33A 3N9PA 2ECWA 2KIZA 2UZGA 3GL6A 4B7YC 1V87A 1VYXA 2YHNA 3N9LA 2K1JA 2KYUA 5C11A 4FJCA 4YATA 2HYED 4A4CA 5JG6A 1RMDA 3O34A 2XEUA 3O70A 3PHDA 5D1MB 2QICA 3DPLR 5FEYA 1IYMA 5G0FA 3C6WA 2LGGA 3FL2A 4R2YA 2L43A 2F6JA 3ZPVE 1JM7B 2MA5A 5B77A 2KWNA 4AP4A 2KWOA 4FK5A 5H1UA 4AYCB 2KWKA 4LLBA 5I3LA 1K2FA 2KGIA 3RPGC 1MM3A 2PNXA 3VK6A 2YSJA 2VP7A 2CSZA 2VJFB 3HTKC 3I2DA 3PURA 1WEMA 2EA6A 4F52B 4QF3A 4PTBA 2KGGA 3U5MA 4R7EA 4GB0A 4L58A 3RPGB 4V3LC 2YURA 2KWJA 2F42A 3SOWA 2LDRA 1E4UA 2F6NA 3C5KA 2VPBA 2PUYA 4WA6A 3LQHA 4WZ2A 4W4UA 2KU3A 2K17A 1LDKC 5B75A 2M6MA 1WEPA 2JMJA 3QZVA 4B86C 2EGPA 2ECVA 5TABA 4YBTA 1T1HA 1WE9A 1LDJB 4S3OC 5B78A 2K4DA 2QIZA 2MT5A 1N87A 2M3HA 4YBSA 3NG2A 3L11A 3HCSA 2KR4A 2VPDA 4YABA 2ECNA 1HYJA 2XB1A 4BBQA 4S3OB 1Z60A 2RI7A 3KV5A 2OXQC 4FO9A 4UP5A 5TDRA 2LGKA 4QF2A 2VPEA 2LXHC 4Q6FA 3V43A 5LKTA 2D8SA 4ZQLA 3LQIA 4GNFA 4GNDA 5J3XA 2LQ6A 3MHHA 4N4FA 1HYIA 2M85A 3M99A 3M62A 3SHBA 3ZVYA 5LKXA 4NN2A 4CA1A 3O7AA 5D1KB 4MSXA 2LGVA 5G05B 3N9NA 3IHPA 2CSYA 3HCUA 1CHCA 2LXPC 5KH7A 5AIUA 3N9MA 5FERA 1F62A 2ECGA 2Y1NA 4GNGA 1X4UA 2JMDA 2VPGA 2LN0A 4ZDTA 2YU4A 3O35A 4UI9B 2I50A 5D1LB 2ECIA 1FBVA 3ASLA 2FUUA 1WEOA 2C2VS 1Z6UA 2YHOA 2LV9A 2YT5A 1WESA 4BHWA 3LQJA 4A4BA 3EB5A 4GNEA 2VJEA 2VNFA 4C9ZA 1G25A 1WIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMI A;  2M1R A;  4AYC A;  1BOR A;  3PUQ A;  1XWH A;  2L75 A;  1X4I A;  1ZBD B;  2Y43 A;  2IDA A;  3M63 A;  1VFY A;  1WEE A;  2L80 A;  5LKZ A;  3T6R A;  5B79 A;  4A49 A;  4ZUX U;  1U6G B;  1FP0 A;  2E6S A;  2MD7 B;  5FB1 A;  2DX8 A;  2EOD A;  4LAD B;  3N9O A;  2YW8 A;  5DKA A;  3T7L A;  4IC3 A;  3O37 A;  2G6Q A;  5KH3 A;  2C2L A;  2L0B A;  2FUI A;  4YBM A;  4LJN A;  2MUM A;  4P5O B;  4IC2 A;  2Y1M A;  2MNY A;  4LKA A;  1X4J A;  2MA6 A;  3MHS A;  5DIN A;  3KQI A;  2BAY A;  2KE1 A;  2CKL A;  3GV4 A;  2JRJ A;  3U5P A;  5B76 A;  1WEQ A;  3HCT A;  2KRE A;  3ZVZ B;  2YUC A;  4V3K C;  5C13 A;  2ECJ A;  5TDW A;  2H0D A;  5LKU A;  2VJE B;  3LRQ A;  3EB6 A;  2LGL A;  1Z2Q A;  1VD4 A;  4A0C D;  5H9M A;  2YRE A;  2MD8 C;  5TRB A;  4I7B A;  3SOU A;  2HDP A;  5TBN A;  2ZET C;  2G43 A;  4WZ3 B;  5FB0 A;  4I7C A;  4YAX A;  4WZ0 A;  4AUQ B;  1WEN A;  4XI1 A;  2YQL A;  4UP0 A;  2QJ0 A;  2MIQ A;  5H1V A;  3ZNI A;  2RSD A;  3U5N A;  3L1Z B;  2YQM A;  3KNV A;  4MVT A;  5LCW B;  4N3W A;  4LK9 A;  3RTR B;  4FIP A;  4R8P K;  5G04 B;  2YYR A;  2KFT A;  1JM7 A;  5EYA F;  2CT2 A;  4O64 A;  2LRI C;  4YAD A;  1WFK A;  3L1X A;  2AN6 A;  3O36 A;  5AIT A;  1MM2 A;  3KV6 A;  4X3G A;  1WEW A;  2MNZ A;  4PPE A;  4TKP B;  2CKL B;  2VJF A;  2FSA A;  3DQV R;  1DVP A;  4I7D A;  3N9Q A;  2YSM A;  3ZTG A;  4CCG X;  2G45 A;  3ZPV 1;  1WEV A;  4YC9 A;  2H0D B;  4AVX A;  5B8D A;  4L7X A;  1WGM A;  1JOC A;  2E6R A;  5H1T A;  2K16 A;  2NAA A;  1WIL A;  5KH9 A;  3U5O A;  2L5U A;  3SOX A;  2ECT A;  3ZYQ A;  1WEU A;  3O33 A;  3N9P A;  2ECW A;  2KIZ A;  2UZG A;  3GL6 A;  4B7Y C;  1V87 A;  1VYX A;  2YHN A;  3N9L A;  2K1J A;  2KYU A;  5C11 A;  4FJC A;  4YAT A;  2HYE D;  4A4C A;  5JG6 A;  1RMD A;  3O34 A;  2XEU A;  3O70 A;  3PHD A;  5D1M B;  2QIC A;  3DPL R;  5FEY A;  1IYM A;  5G0F A;  3C6W A;  2LGG A;  3FL2 A;  4R2Y A;  2L43 A;  2F6J A;  3ZPV E;  1JM7 B;  2MA5 A;  5B77 A;  2KWN A;  4AP4 A;  2KWO A;  4FK5 A;  5H1U A;  4AYC B;  2KWK A;  4LLB A;  5I3L A;  1K2F A;  2KGI A;  3RPG C;  1MM3 A;  2PNX A;  3VK6 A;  2YSJ A;  2VP7 A;  2CSZ A;  2VJF B;  3HTK C;  3I2D A;  3PUR A;  1WEM A;  2EA6 A;  4F52 B;  4QF3 A;  4PTB A;  2KGG A;  3U5M A;  4R7E A;  4GB0 A;  4L58 A;  3RPG B;  4V3L C;  2YUR A;  2KWJ A;  2F42 A;  3SOW A;  2LDR A;  1E4U A;  2F6N A;  3C5K A;  2VPB A;  2PUY A;  4WA6 A;  3LQH A;  4WZ2 A;  4W4U A;  2KU3 A;  2K17 A;  1LDK C;  5B75 A;  2M6M A;  1WEP A;  2JMJ A;  3QZV A;  4B86 C;  2EGP A;  2ECV A;  5TAB A;  4YBT A;  1T1H A;  1WE9 A;  1LDJ B;  4S3O C;  5B78 A;  2K4D A;  2QIZ A;  2MT5 A;  1N87 A;  2M3H A;  4YBS A;  3NG2 A;  3L11 A;  3HCS A;  2KR4 A;  2VPD A;  4YAB A;  2ECN A;  1HYJ A;  2XB1 A;  4BBQ A;  4S3O B;  1Z60 A;  2RI7 A;  3KV5 A;  2OXQ C;  4FO9 A;  4UP5 A;  5TDR A;  2LGK A;  4QF2 A;  2VPE A;  2LXH C;  4Q6F A;  3V43 A;  5LKT A;  2D8S A;  4ZQL A;  3LQI A;  4GNF A;  4GND A;  5J3X A;  2LQ6 A;  3MHH A;  4N4F A;  1HYI A;  2M85 A;  3M99 A;  3M62 A;  3SHB A;  3ZVY A;  5LKX A;  4NN2 A;  4CA1 A;  3O7A A;  5D1K B;  4MSX A;  2LGV A;  5G05 B;  3N9N A;  3IHP A;  2CSY A;  3HCU A;  1CHC A;  2LXP C;  5KH7 A;  5AIU A;  3N9M A;  5FER A;  1F62 A;  2ECG A;  2Y1N A;  4GNG A;  1X4U A;  2JMD A;  2VPG A;  2LN0 A;  4ZDT A;  2YU4 A;  3O35 A;  4UI9 B;  2I50 A;  5D1L B;  2ECI A;  1FBV A;  3ASL A;  2FUU A;  1WEO A;  2C2V S;  1Z6U A;  2YHO A;  2LV9 A;  2YT5 A;  1WES A;  4BHW A;  3LQJ A;  4A4B A;  3EB5 A;  4GNE A;  2VJE A;  2VNF A;  4C9Z A;  1G25 A;  1WIM A; 
#chains in the Genus database with same CATH topology
 2JMI A;  2M1R A;  4AYC A;  1BOR A;  3MDB C;  3PUQ A;  1XWH A;  2L75 A;  1X4I A;  1ZBD B;  2Y43 A;  2IDA A;  3M63 A;  1VFY A;  1WEE A;  2L80 A;  5LKZ A;  3T6R A;  5B79 A;  4A49 A;  4ZUX U;  1U6G B;  1FP0 A;  2E6S A;  2MD7 B;  5FB1 A;  5SVI B;  2DX8 A;  2EOD A;  4LAD B;  3N9O A;  2YW8 A;  5DKA A;  3T7L A;  4IC3 A;  3O37 A;  2G6Q A;  5KH3 A;  2C2L A;  2L0B A;  3PLW A;  4H9D A;  2FUI A;  4YBM A;  4LJN A;  2MUM A;  4P5O B;  3T9K A;  4IC2 A;  2Y1M A;  2MNY A;  2CON A;  4LKA A;  1X4J A;  2MA6 A;  3MHS A;  5DIN A;  3KQI A;  2BAY A;  2KE1 A;  3LDY A;  2CKL A;  3GV4 A;  2JRJ A;  3U5P A;  5B76 A;  1WEQ A;  3HCT A;  2KRE A;  3ZVZ B;  2YUC A;  4V3K C;  5C13 A;  2ECJ A;  5TDW A;  2H0D A;  4O62 A;  5LKU A;  2VJE B;  2IQJ A;  3LRQ A;  3EB6 A;  2LGL A;  1Z2Q A;  2RR4 A;  1VD4 A;  4A0C D;  5H9M A;  2YRE A;  2MD8 C;  2DJA A;  5TRB A;  4I7B A;  3SOU A;  2HDP A;  5TBN A;  2ZET C;  2G43 A;  4WZ3 B;  5FB0 A;  4I7C A;  3LJU X;  4YAX A;  4F1P A;  2M13 A;  4WZ0 A;  4AUQ B;  1WEN A;  4XI1 A;  2YQL A;  2XOC A;  4UP0 A;  2QJ0 A;  2MIQ A;  5H1V A;  3ZNI A;  2RSD A;  3U5N A;  3L1Z B;  2YQM A;  3KNV A;  4MVT A;  5SVY A;  5LCW B;  4N3W A;  4LK9 A;  3RTR B;  4FIP A;  4R8P K;  5G04 B;  2OWA A;  2YYR A;  2KFT A;  1JM7 A;  5EYA F;  2CT2 A;  4O64 A;  2LRI C;  4YAD A;  1DCQ A;  1WFK A;  3L1X A;  2AN6 A;  2XOY A;  3O36 A;  2LAU A;  5AIT A;  1MM2 A;  3KV6 A;  4X3G A;  1WEW A;  2MNZ A;  4PPE A;  4TKP B;  2CKL B;  2VJF A;  2FSA A;  3DQV R;  1DVP A;  4I7D A;  3N9Q A;  2YSM A;  3FEH A;  3ZTG A;  4CCG X;  4Z0R A;  2G45 A;  3ZPV 1;  1WEV A;  4YC9 A;  2H0D B;  4AVX A;  5B8D A;  4L7X A;  1WGM A;  1JOC A;  2E6R A;  5H1T A;  2K16 A;  5K3Q A;  2NAA A;  1WIL A;  5KH9 A;  3LVR E;  2L5U A;  3U5O A;  3SOX A;  2ECT A;  3ZYQ A;  1WEU A;  3O33 A;  3N9P A;  2ECW A;  2KIZ A;  2UZG A;  3GL6 A;  2L7P A;  4B7Y C;  1V87 A;  1VYX A;  2YHN A;  3N9L A;  2K1J A;  2KYU A;  5C11 A;  4FJC A;  4YAT A;  2HYE D;  4A4C A;  5JG6 A;  2JM3 A;  1RMD A;  3O34 A;  2XEU A;  3O70 A;  3PHD A;  5D1M B;  2QIC A;  3M7K A;  3DPL R;  5FEY A;  1IYM A;  3C6W A;  5G0F A;  2LGG A;  3FL2 A;  4R2Y A;  2L43 A;  2F6J A;  3ZPV E;  1JM7 B;  2MA5 A;  5B77 A;  2KWN A;  4AP4 A;  2KWO A;  4FK5 A;  5H1U A;  2E61 A;  2KKY A;  3JUE A;  4AYC B;  2KWK A;  4LLB A;  5I3L A;  1K2F A;  2CSV A;  2KGI A;  3RPG C;  1MM3 A;  2PNX A;  3VK6 A;  5SVX A;  2YSJ A;  2VP7 A;  2CSZ A;  2B0O E;  2VJF B;  3HTK C;  3I2D A;  3PUR A;  1WEM A;  3E2D A;  2EA6 A;  3FAO A;  4F52 B;  4QF3 A;  4PTB A;  3KDE C;  2KGG A;  3U5M A;  4R7E A;  4GB0 A;  4L58 A;  3RPG B;  3LVQ E;  3FM8 C;  4V3L C;  2YUR A;  2KWJ A;  2F42 A;  2CRW A;  3SOW A;  2LDR A;  1E4U A;  2F6N A;  3C5K A;  2VPB A;  2PUY A;  4WA6 A;  3LQH A;  4OGE A;  4WZ2 A;  4W4U A;  2KU3 A;  2K17 A;  1LDK C;  3FAN A;  5B75 A;  2D8U A;  2M6M A;  1WEP A;  2JMJ A;  3QZV A;  4B86 C;  2EGP A;  2ECV A;  5TAB A;  2CRR A;  4YBT A;  1T1H A;  1WE9 A;  1LDJ B;  4S3O C;  5B78 A;  2K4D A;  2QIZ A;  2MT5 A;  1MBM A;  1N87 A;  2MKE A;  2M3H A;  3DWD A;  4YBS A;  3NG2 A;  2DSM A;  3L11 A;  3HCS A;  2KR4 A;  2VPD A;  4YAB A;  2ECN A;  1HYJ A;  2XB1 A;  3SUB A;  4S3O B;  4BBQ A;  1Z60 A;  3H7H A;  2RI7 A;  3KV5 A;  2OXQ C;  3DDT A;  4FO9 A;  2JUN A;  4UP5 A;  5TDR A;  2LGK A;  2FD4 A;  4QF2 A;  2VPE A;  2LXH C;  4Q6F A;  3V43 A;  5LKT A;  2D8S A;  4ZQL A;  3LQI A;  4GNF A;  4GND A;  5J3X A;  2LQ6 A;  3MHH A;  4N4F A;  1HYI A;  2M85 A;  3M99 A;  2XOZ A;  3M62 A;  3SHB A;  3ZVY A;  5LKX A;  2XP0 A;  4NN2 A;  4CA1 A;  3O7A A;  2FFW A;  5D1K B;  4MSX A;  2YVR A;  2LGV A;  4QQ4 A;  5SVI A;  5G05 B;  3N9N A;  3IHP A;  2CSY A;  3HCU A;  1CHC A;  2LXP C;  5KH7 A;  4OGC A;  5AIU A;  3N9M A;  5FER A;  1F62 A;  2ECG A;  2Y1N A;  4GNG A;  1X4U A;  2JMD A;  2VPG A;  3FJU B;  2KKX A;  2LN0 A;  2YU4 A;  4UI9 B;  3O35 A;  4ZDT A;  2I50 A;  5D1L B;  2ECI A;  1FBV A;  3Q1D A;  3ASL A;  2FUU A;  1WEO A;  2C2V S;  1Z6U A;  2YHO A;  2LV9 A;  2YT5 A;  3O47 A;  1WES A;  4BHW A;  3LQJ A;  4A4B A;  3EB5 A;  4GNE A;  2VJE A;  2P57 A;  4Z0O A;  2VNF A;  4C9Z A;  2EGM A;  1G25 A;  2EXU A;  1WIM A; 
#chains in the Genus database with same CATH homology
 2JMI A;  2M1R A;  4AYC A;  1BOR A;  3PUQ A;  1XWH A;  2L75 A;  1X4I A;  1ZBD B;  2Y43 A;  2IDA A;  3M63 A;  1VFY A;  1WEE A;  2L80 A;  5LKZ A;  3T6R A;  5B79 A;  4A49 A;  4ZUX U;  1U6G B;  1FP0 A;  2E6S A;  2MD7 B;  5FB1 A;  2DX8 A;  2EOD A;  4LAD B;  3N9O A;  2YW8 A;  5DKA A;  3T7L A;  4IC3 A;  3O37 A;  2G6Q A;  5KH3 A;  2C2L A;  2L0B A;  2FUI A;  4YBM A;  4LJN A;  2MUM A;  4P5O B;  4IC2 A;  2Y1M A;  2MNY A;  4LKA A;  1X4J A;  2MA6 A;  3MHS A;  5DIN A;  3KQI A;  2BAY A;  2KE1 A;  2CKL A;  3GV4 A;  2JRJ A;  3U5P A;  5B76 A;  1WEQ A;  3HCT A;  2KRE A;  3ZVZ B;  2YUC A;  4V3K C;  5C13 A;  2ECJ A;  5TDW A;  2H0D A;  5LKU A;  2VJE B;  3LRQ A;  3EB6 A;  2LGL A;  1Z2Q A;  1VD4 A;  4A0C D;  5H9M A;  2YRE A;  2MD8 C;  5TRB A;  4I7B A;  3SOU A;  2HDP A;  5TBN A;  2ZET C;  2G43 A;  4WZ3 B;  5FB0 A;  4I7C A;  4YAX A;  4WZ0 A;  4AUQ B;  1WEN A;  4XI1 A;  2YQL A;  4UP0 A;  2QJ0 A;  2MIQ A;  5H1V A;  3ZNI A;  2RSD A;  3U5N A;  3L1Z B;  2YQM A;  3KNV A;  4MVT A;  5LCW B;  4N3W A;  4LK9 A;  3RTR B;  4FIP A;  4R8P K;  5G04 B;  2YYR A;  2KFT A;  1JM7 A;  5EYA F;  2CT2 A;  4O64 A;  2LRI C;  4YAD A;  1WFK A;  3L1X A;  2AN6 A;  3O36 A;  5AIT A;  1MM2 A;  3KV6 A;  4X3G A;  1WEW A;  2MNZ A;  4PPE A;  4TKP B;  2CKL B;  2VJF A;  2FSA A;  3DQV R;  1DVP A;  4I7D A;  3N9Q A;  2YSM A;  3ZTG A;  4CCG X;  2G45 A;  3ZPV 1;  1WEV A;  4YC9 A;  2H0D B;  4AVX A;  5B8D A;  4L7X A;  1WGM A;  1JOC A;  2E6R A;  5H1T A;  2K16 A;  2NAA A;  1WIL A;  5KH9 A;  3U5O A;  2L5U A;  3SOX A;  2ECT A;  3ZYQ A;  1WEU A;  3O33 A;  3N9P A;  2ECW A;  2KIZ A;  2UZG A;  3GL6 A;  4B7Y C;  1V87 A;  1VYX A;  2YHN A;  3N9L A;  2K1J A;  2KYU A;  5C11 A;  4FJC A;  4YAT A;  2HYE D;  4A4C A;  5JG6 A;  1RMD A;  3O34 A;  2XEU A;  3O70 A;  3PHD A;  5D1M B;  2QIC A;  3DPL R;  5FEY A;  1IYM A;  5G0F A;  3C6W A;  2LGG A;  3FL2 A;  4R2Y A;  2L43 A;  2F6J A;  3ZPV E;  1JM7 B;  2MA5 A;  5B77 A;  2KWN A;  4AP4 A;  2KWO A;  4FK5 A;  5H1U A;  4AYC B;  2KWK A;  4LLB A;  5I3L A;  1K2F A;  2KGI A;  3RPG C;  1MM3 A;  2PNX A;  3VK6 A;  2YSJ A;  2VP7 A;  2CSZ A;  2VJF B;  3HTK C;  3I2D A;  3PUR A;  1WEM A;  2EA6 A;  4F52 B;  4QF3 A;  4PTB A;  2KGG A;  3U5M A;  4R7E A;  4GB0 A;  4L58 A;  3RPG B;  4V3L C;  2YUR A;  2KWJ A;  2F42 A;  3SOW A;  2LDR A;  1E4U A;  2F6N A;  3C5K A;  2VPB A;  2PUY A;  4WA6 A;  3LQH A;  4WZ2 A;  4W4U A;  2KU3 A;  2K17 A;  1LDK C;  5B75 A;  2M6M A;  1WEP A;  2JMJ A;  3QZV A;  4B86 C;  2EGP A;  2ECV A;  5TAB A;  4YBT A;  1T1H A;  1WE9 A;  1LDJ B;  4S3O C;  5B78 A;  2K4D A;  2QIZ A;  2MT5 A;  1N87 A;  2M3H A;  4YBS A;  3NG2 A;  3L11 A;  3HCS A;  2KR4 A;  2VPD A;  4YAB A;  2ECN A;  1HYJ A;  2XB1 A;  4BBQ A;  4S3O B;  1Z60 A;  2RI7 A;  3KV5 A;  2OXQ C;  4FO9 A;  4UP5 A;  5TDR A;  2LGK A;  4QF2 A;  2VPE A;  2LXH C;  4Q6F A;  3V43 A;  5LKT A;  2D8S A;  4ZQL A;  3LQI A;  4GNF A;  4GND A;  5J3X A;  2LQ6 A;  3MHH A;  4N4F A;  1HYI A;  2M85 A;  3M99 A;  3M62 A;  3SHB A;  3ZVY A;  5LKX A;  4NN2 A;  4CA1 A;  3O7A A;  5D1K B;  4MSX A;  2LGV A;  5G05 B;  3N9N A;  3IHP A;  2CSY A;  3HCU A;  1CHC A;  2LXP C;  5KH7 A;  5AIU A;  3N9M A;  5FER A;  1F62 A;  2ECG A;  2Y1N A;  4GNG A;  1X4U A;  2JMD A;  2VPG A;  2LN0 A;  4ZDT A;  2YU4 A;  3O35 A;  4UI9 B;  2I50 A;  5D1L B;  2ECI A;  1FBV A;  3ASL A;  2FUU A;  1WEO A;  2C2V S;  1Z6U A;  2YHO A;  2LV9 A;  2YT5 A;  1WES A;  4BHW A;  3LQJ A;  4A4B A;  3EB5 A;  4GNE A;  2VJE A;  2VNF A;  4C9Z A;  1G25 A;  1WIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...