2KR4A

U-box domain of the e3 ubiquitin ligase e4b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
85
structure length
85
Chain Sequence
PGSAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVPELKEQIQAWMREKQSSDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin conjugation factor E4 B
publication title Structural and functional characterization of the monomeric U-box domain from E4B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 19
structure length 85
sequence length 85
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kr4A01
1LDKC 2MUMA 2CKLA 2L75A 2VPGA 4BHWA 3PURA 2HYED 5KH7A 3DPLR 1WEMA 2VJFB 2CSZA 3GL6A 1WEUA 4GNEA 4IC2A 2H0DB 2VPDA 4AP4A 4Q6FA 2E6SA 2EGPA 1WEOA 3ZTGA 2KGIA 3T6RA 3L1ZB 2K1JA 2JMIA 4YAXA 2MT5A 5B79A 4QF3A 2YUCA 3PHDA 2LQ6A 2RI7A 2KYUA 1WEQA 2G43A 3O34A 2BAYA 2ZETC 3M99A 2C2VS 4A0CD 5D1LB 2QICA 3DQVR 3ASLA 1K2FA 2UZGA 1X4IA 2G45A 5TDWA 4B7YC 1BORA 1V87A 5H9MA 4GNGA 2AN6A 2M3HA 2LGLA 4UP0A 2M1RA 3O35A 4S3OC 1IYMA 4GB0A 2YREA 4B86C 3C5KA 1FP0A 1F62A 5B8DA 4R7EA 2YSJA 4FJCA 3O33A 3GV4A 4FIPA 3HCUA 2OXQC 4LADB 2Y1NA 3M62A 4AUQB 2ECWA 4WZ0A 2LGGA 2VJEA 1LDJB 4O64A 3ZVYA 3I2DA 2L0BA 2QIZA 2YSMA 1VFYA 1VYXA 3PUQA 5FB1A 3SOXA 2QJ0A 3ZNIA 3V43A 3IHPA 5KH3A 4WA6A 4AYCA 3ZPVE 4L7XA 4C9ZA 4IC3A 1WEVA 1ZBDB 3N9PA 5DKAA 4CCGX 2YQLA 1XWHA 1Z6UA 4UP5A 2PUYA 3L1XA 3LQJA 4YBSA 1RMDA 1JM7B 4CA1A 3LQIA 4GNFA 5LKTA 2CT2A 2KU3A 3FL2A 1WEEA 4WZ2A 3KQIA 1HYJA 2PNXA 2YW8A 3N9QA 3N9LA 2YHNA 3U5NA 2K17A 2FUIA 3O36A 5TBNA 3RTRB 2LRIC 2MD7B 3VK6A 4ZDTA 2K4DA 4V3LC 1Z2QA 4NN2A 1WENA 1WEPA 4YC9A 4GNDA 4YABA 2YU4A 2H0DA 5H1UA 1DVPA 4YADA 3ZVZB 5D1MB 5B75A 4A49A 4ZQLA 2LN0A 3ZPV1 2FSAA 4F52B 1WFKA 4PPEA 2L43A 2JMJA 4LK9A 2G6QA 1WIMA 2KGGA 2JRJA 3N9NA 4N4FA 1HYIA 4X3GA 2KR4A 4L58A 4I7BA 1WE9A 3O70A 3EB5A 4LKAA 2Y1MA 5AIUA 3RPGB 2IDAA 4AYCB 4LLBA 4P5OB 2EODA 2I50A 5LKUA 2KE1A 3U5OA 2CKLB 2CSYA 2MA5A 5LKXA 2YYRA 4MSXA 2KWOA 4XI1A 4YATA 5LKZA 4YBTA 2YURA 2HDPA 2KWNA 5G0FA 4FO9A 3LRQA 4A4BA 5DINA 3M63A 2NAAA 4QF2A 1WILA 2MNYA 2VP7A 3ZYQA 3HCTA 1JOCA 2D8SA 3HCSA 5J3XA 2L80A 2VNFA 4I7CA 3QZVA 5D1KB 3EB6A 2L5UA 2C2LA 1WEWA 5JG6A 1WGMA 4V3KC 1Z60A 2F6NA 4UI9B 4A4CA 1MM2A 5G05B 2KWJA 5B76A 5H1TA 1MM3A 5TDRA 1T1HA 2E6RA 4R8PK 2VPBA 5EYAF 2XB1A 2YHOA 4AVXA 1G25A 3N9MA 3SHBA 5AITA 2LGVA 2ECVA 5H1VA 1X4UA 2EA6A 2VJFA 4BBQA 5C11A 5B77A 1VD4A 1FBVA 1N87A 3U5PA 3HTKC 1JM7A 3MHHA 1CHCA 2YQMA 3KV6A 2ECTA 4MVTA 3C6WA 2ECJA 3U5MA 2LDRA 4ZUXU 4FK5A 1WESA 2MIQA 2VJEB 2YT5A 3O7AA 2MA6A 1X4JA 1E4UA 2ECGA 3T7LA 2ECIA 2ECNA 2KREA 4PTBA 4S3OB 2F42A 2KIZA 2RSDA 3MHSA 5B78A 3L11A 3SOWA 2F6JA 4N3WA 3RPGC 2XEUA 5FERA 5LCWB 4YBMA 2M85A 5I3LA 2LV9A 4LJNA 2KFTA 3SOUA 2MD8C 2LGKA 4I7DA 3NG2A 3N9OA 3LQHA 5FEYA 2FUUA 2JMDA 2KWKA 5TRBA 2LXPC 2DX8A 1U6GB 4R2YA 3O37A 4TKPB 2LXHC 5KH9A 3KV5A 5TABA 2MNZA 2Y43A 4W4UA 5C13A 2K16A 3KNVA 5FB0A 5G04B 4WZ3B 2VPEA 2M6MA
chains in the Genus database with same CATH superfamily
1LDKC 2MUMA 2CKLA 2L75A 2VPGA 4BHWA 3PURA 2HYED 5KH7A 3DPLR 1WEMA 2VJFB 2CSZA 3GL6A 1WEUA 2IQJA 4GNEA 4IC2A 2H0DB 2VPDA 3LVQE 4AP4A 2KKYA 4Q6FA 2E6SA 2EGPA 1WEOA 5SVYA 3ZTGA 2KGIA 3T6RA 3L1ZB 2K1JA 2JMIA 2EGMA 4YAXA 2MT5A 3FM8C 5B79A 4QF3A 2YUCA 3PHDA 2LQ6A 2RI7A 2KYUA 1WEQA 2G43A 3O34A 2BAYA 2ZETC 3M99A 2C2VS 4A0CD 5D1LB 2JM3A 3T9KA 2QICA 3DQVR 3ASLA 1K2FA 2UZGA 1X4IA 2G45A 5TDWA 4B7YC 1BORA 1V87A 3O47A 5H9MA 2CSVA 2DSMA 4GNGA 2AN6A 2M3HA 2LGLA 4UP0A 2M1RA 3O35A 4S3OC 1IYMA 4GB0A 2YREA 4B86C 3C5KA 1FP0A 3LVRE 1F62A 5B8DA 4R7EA 2YSJA 3FEHA 4FJCA 3O33A 3GV4A 3LDYA 4F1PA 2CRRA 2XOZA 4FIPA 3HCUA 2OXQC 5SVIA 4LADB 2Y1NA 3M62A 4AUQB 2ECWA 4WZ0A 2LGGA 3MDBC 2VJEA 1LDJB 4O64A 1MBMA 3I2DA 3ZVYA 2L0BA 2QIZA 2YSMA 1VFYA 1VYXA 3PLWA 3PUQA 5FB1A 3SOXA 2QJ0A 3ZNIA 2KKXA 3V43A 3IHPA 5KH3A 4WA6A 4AYCA 3ZPVE 4L7XA 2CRWA 4C9ZA 2DJAA 4IC3A 1WEVA 1ZBDB 3N9PA 3FJUB 5DKAA 4CCGX 2YQLA 1XWHA 3FANA 1Z6UA 4UP5A 2PUYA 3L1XA 3LQJA 4YBSA 1RMDA 1JM7B 4CA1A 3LQIA 4GNFA 5LKTA 2YVRA 2CT2A 2KU3A 3FL2A 1WEEA 4WZ2A 4O62A 3KQIA 1HYJA 2PNXA 2YW8A 2B0OE 3N9LA 2YHNA 3N9QA 2K17A 3U5NA 2FUIA 3O36A 2EXUA 5TBNA 3RTRB 2LRIC 2MD7B 3VK6A 4ZDTA 2K4DA 2RR4A 4V3LC 1Z2QA 4NN2A 1WENA 3DWDA 1WEPA 4YC9A 4GNDA 4YABA 2YU4A 2H0DA 2FD4A 5H1UA 1DVPA 4YADA 3ZVZB 5D1MB 5B75A 4A49A 2MKEA 4ZQLA 2LN0A 3JUEA 3ZPV1 2FSAA 4F52B 4QQ4A 1WFKA 4PPEA 2L43A 4OGCA 2JMJA 4LK9A 2G6QA 1WIMA 3Q1DA 2KGGA 2JRJA 4Z0OA 3N9NA 4N4FA 1HYIA 4X3GA 2KR4A 4L58A 2L7PA 4I7BA 1WE9A 3O70A 3EB5A 4LKAA 2Y1MA 5AIUA 3RPGB 2IDAA 4AYCB 3M7KA 4LLBA 4P5OB 5SVXA 2EODA 2I50A 5LKUA 2KE1A 3U5OA 2CKLB 2CSYA 2MA5A 5LKXA 2YYRA 4MSXA 2KWOA 3E2DA 4XI1A 4YATA 5LKZA 4YBTA 2YURA 2HDPA 2KWNA 5G0FA 4FO9A 3LRQA 4A4BA 5DINA 3M63A 2NAAA 2XOYA 4QF2A 1WILA 2MNYA 4Z0RA 2VP7A 3ZYQA 3HCTA 1JOCA 2D8SA 3HCSA 5J3XA 2L80A 2P57A 2VNFA 4I7CA 3QZVA 2XP0A 3EB6A 2L5UA 2C2LA 5D1KB 2E61A 1WEWA 5JG6A 1WGMA 4V3KC 1Z60A 2F6NA 4H9DA 4UI9B 4A4CA 1MM2A 5G05B 2KWJA 5B76A 5H1TA 1DCQA 3H7HA 2FFWA 1MM3A 5TDRA 1T1HA 2E6RA 4R8PK 2VPBA 5EYAF 2XB1A 2YHOA 4AVXA 1G25A 3N9MA 3SHBA 5AITA 2LGVA 2ECVA 5H1VA 1X4UA 2XOCA 2EA6A 2VJFA 4BBQA 5C11A 5B77A 1VD4A 3LJUX 1FBVA 1N87A 3U5PA 3HTKC 1JM7A 3MHHA 1CHCA 2YQMA 3KV6A 2ECTA 4MVTA 3C6WA 2ECJA 3U5MA 2LDRA 4ZUXU 5SVIB 4FK5A 1WESA 2CONA 2MIQA 2VJEB 2YT5A 3O7AA 2MA6A 1X4JA 1E4UA 2ECGA 3T7LA 2ECIA 2ECNA 2KREA 4PTBA 2LAUA 4S3OB 2F42A 2D8UA 2M13A 2KIZA 2RSDA 3MHSA 5B78A 3L11A 3SOWA 3DDTA 2F6JA 4N3WA 3RPGC 2XEUA 5FERA 5LCWB 4OGEA 4YBMA 2M85A 5I3LA 3KDEC 2LV9A 4LJNA 2KFTA 3SOUA 2MD8C 2LGKA 2OWAA 4I7DA 3NG2A 2JUNA 3N9OA 3LQHA 5FEYA 2FUUA 2JMDA 2KWKA 5TRBA 2LXPC 2DX8A 1U6GB 4R2YA 3SUBA 3O37A 4TKPB 2LXHC 5KH9A 3KV5A 5TABA 2MNZA 2Y43A 5K3QA 4W4UA 5C13A 2K16A 3KNVA 5FB0A 5G04B 3FAOA 4WZ3B 2VPEA 2M6MA
chains in the Genus database with same CATH topology
1LDKC 2MUMA 2CKLA 2L75A 2VPGA 4BHWA 3PURA 2HYED 5KH7A 3DPLR 1WEMA 2VJFB 2CSZA 3GL6A 1WEUA 4GNEA 4IC2A 2H0DB 2VPDA 4AP4A 4Q6FA 2E6SA 2EGPA 1WEOA 3ZTGA 2KGIA 3T6RA 3L1ZB 2K1JA 2JMIA 4YAXA 2MT5A 5B79A 4QF3A 2YUCA 3PHDA 2LQ6A 2RI7A 2KYUA 1WEQA 2G43A 3O34A 2BAYA 2ZETC 3M99A 2C2VS 4A0CD 5D1LB 2QICA 3DQVR 3ASLA 1K2FA 2UZGA 1X4IA 2G45A 5TDWA 4B7YC 1BORA 1V87A 5H9MA 4GNGA 2AN6A 2M3HA 2LGLA 4UP0A 2M1RA 3O35A 4S3OC 1IYMA 4GB0A 2YREA 4B86C 3C5KA 1FP0A 1F62A 5B8DA 4R7EA 2YSJA 4FJCA 3O33A 3GV4A 4FIPA 3HCUA 2OXQC 4LADB 2Y1NA 3M62A 4AUQB 2ECWA 4WZ0A 2LGGA 2VJEA 1LDJB 4O64A 3ZVYA 3I2DA 2L0BA 2QIZA 2YSMA 1VFYA 1VYXA 3PUQA 5FB1A 3SOXA 2QJ0A 3ZNIA 3V43A 3IHPA 5KH3A 4WA6A 4AYCA 3ZPVE 4L7XA 4C9ZA 4IC3A 1WEVA 1ZBDB 3N9PA 5DKAA 4CCGX 2YQLA 1XWHA 1Z6UA 4UP5A 2PUYA 3L1XA 3LQJA 4YBSA 1RMDA 1JM7B 4CA1A 3LQIA 4GNFA 5LKTA 2CT2A 2KU3A 3FL2A 1WEEA 4WZ2A 3KQIA 1HYJA 2PNXA 2YW8A 3N9QA 3N9LA 2YHNA 3U5NA 2K17A 2FUIA 3O36A 5TBNA 3RTRB 2LRIC 2MD7B 3VK6A 4ZDTA 2K4DA 4V3LC 1Z2QA 4NN2A 1WENA 1WEPA 4YC9A 4GNDA 4YABA 2YU4A 2H0DA 5H1UA 1DVPA 4YADA 3ZVZB 5D1MB 5B75A 4A49A 4ZQLA 2LN0A 3ZPV1 2FSAA 4F52B 1WFKA 4PPEA 2L43A 2JMJA 4LK9A 2G6QA 1WIMA 2KGGA 2JRJA 3N9NA 4N4FA 1HYIA 4X3GA 2KR4A 4L58A 4I7BA 1WE9A 3O70A 3EB5A 4LKAA 2Y1MA 5AIUA 3RPGB 2IDAA 4AYCB 4LLBA 4P5OB 2EODA 2I50A 5LKUA 2KE1A 3U5OA 2CKLB 2CSYA 2MA5A 5LKXA 2YYRA 4MSXA 2KWOA 4XI1A 4YATA 5LKZA 4YBTA 2YURA 2HDPA 2KWNA 5G0FA 4FO9A 3LRQA 4A4BA 5DINA 3M63A 2NAAA 4QF2A 1WILA 2MNYA 2VP7A 3ZYQA 3HCTA 1JOCA 2D8SA 3HCSA 5J3XA 2L80A 2VNFA 4I7CA 3QZVA 5D1KB 3EB6A 2L5UA 2C2LA 1WEWA 5JG6A 1WGMA 4V3KC 1Z60A 2F6NA 4UI9B 4A4CA 1MM2A 5G05B 2KWJA 5B76A 5H1TA 1MM3A 5TDRA 1T1HA 2E6RA 4R8PK 2VPBA 5EYAF 2XB1A 2YHOA 4AVXA 1G25A 3N9MA 3SHBA 5AITA 2LGVA 2ECVA 5H1VA 1X4UA 2EA6A 2VJFA 4BBQA 5C11A 5B77A 1VD4A 1FBVA 1N87A 3U5PA 3HTKC 1JM7A 3MHHA 1CHCA 2YQMA 3KV6A 2ECTA 4MVTA 3C6WA 2ECJA 3U5MA 2LDRA 4ZUXU 4FK5A 1WESA 2MIQA 2VJEB 2YT5A 3O7AA 2MA6A 1X4JA 1E4UA 2ECGA 3T7LA 2ECIA 2ECNA 2KREA 4PTBA 4S3OB 2F42A 2KIZA 2RSDA 3MHSA 5B78A 3L11A 3SOWA 2F6JA 4N3WA 3RPGC 2XEUA 5FERA 5LCWB 4YBMA 2M85A 5I3LA 2LV9A 4LJNA 2KFTA 3SOUA 2MD8C 2LGKA 4I7DA 3NG2A 3N9OA 3LQHA 5FEYA 2FUUA 2JMDA 2KWKA 5TRBA 2LXPC 2DX8A 1U6GB 4R2YA 3O37A 4TKPB 2LXHC 5KH9A 3KV5A 5TABA 2MNZA 2Y43A 4W4UA 5C13A 2K16A 3KNVA 5FB0A 5G04B 4WZ3B 2VPEA 2M6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDK C;  2MUM A;  2CKL A;  2L75 A;  2VPG A;  4BHW A;  3PUR A;  2HYE D;  5KH7 A;  3DPL R;  1WEM A;  2VJF B;  2CSZ A;  3GL6 A;  1WEU A;  4GNE A;  4IC2 A;  2H0D B;  2VPD A;  4AP4 A;  4Q6F A;  2E6S A;  2EGP A;  1WEO A;  3ZTG A;  2KGI A;  3T6R A;  3L1Z B;  2K1J A;  2JMI A;  4YAX A;  2MT5 A;  5B79 A;  4QF3 A;  2YUC A;  3PHD A;  2LQ6 A;  2RI7 A;  2KYU A;  1WEQ A;  2G43 A;  3O34 A;  2BAY A;  2ZET C;  3M99 A;  2C2V S;  4A0C D;  5D1L B;  2QIC A;  3DQV R;  3ASL A;  1K2F A;  2UZG A;  1X4I A;  2G45 A;  5TDW A;  4B7Y C;  1BOR A;  1V87 A;  5H9M A;  4GNG A;  2AN6 A;  2M3H A;  2LGL A;  4UP0 A;  2M1R A;  3O35 A;  4S3O C;  1IYM A;  4GB0 A;  2YRE A;  4B86 C;  3C5K A;  1FP0 A;  1F62 A;  5B8D A;  4R7E A;  2YSJ A;  4FJC A;  3O33 A;  3GV4 A;  4FIP A;  3HCU A;  2OXQ C;  4LAD B;  2Y1N A;  3M62 A;  4AUQ B;  2ECW A;  4WZ0 A;  2LGG A;  2VJE A;  1LDJ B;  4O64 A;  3ZVY A;  3I2D A;  2L0B A;  2QIZ A;  2YSM A;  1VFY A;  1VYX A;  3PUQ A;  5FB1 A;  3SOX A;  2QJ0 A;  3ZNI A;  3V43 A;  3IHP A;  5KH3 A;  4WA6 A;  4AYC A;  3ZPV E;  4L7X A;  4C9Z A;  4IC3 A;  1WEV A;  1ZBD B;  3N9P A;  5DKA A;  4CCG X;  2YQL A;  1XWH A;  1Z6U A;  4UP5 A;  2PUY A;  3L1X A;  3LQJ A;  4YBS A;  1RMD A;  1JM7 B;  4CA1 A;  3LQI A;  4GNF A;  5LKT A;  2CT2 A;  2KU3 A;  3FL2 A;  1WEE A;  4WZ2 A;  3KQI A;  1HYJ A;  2PNX A;  2YW8 A;  3N9Q A;  3N9L A;  2YHN A;  3U5N A;  2K17 A;  2FUI A;  3O36 A;  5TBN A;  3RTR B;  2LRI C;  2MD7 B;  3VK6 A;  4ZDT A;  2K4D A;  4V3L C;  1Z2Q A;  4NN2 A;  1WEN A;  1WEP A;  4YC9 A;  4GND A;  4YAB A;  2YU4 A;  2H0D A;  5H1U A;  1DVP A;  4YAD A;  3ZVZ B;  5D1M B;  5B75 A;  4A49 A;  4ZQL A;  2LN0 A;  3ZPV 1;  2FSA A;  4F52 B;  1WFK A;  4PPE A;  2L43 A;  2JMJ A;  4LK9 A;  2G6Q A;  1WIM A;  2KGG A;  2JRJ A;  3N9N A;  4N4F A;  1HYI A;  4X3G A;  2KR4 A;  4L58 A;  4I7B A;  1WE9 A;  3O70 A;  3EB5 A;  4LKA A;  2Y1M A;  5AIU A;  3RPG B;  2IDA A;  4AYC B;  4LLB A;  4P5O B;  2EOD A;  2I50 A;  5LKU A;  2KE1 A;  3U5O A;  2CKL B;  2CSY A;  2MA5 A;  5LKX A;  2YYR A;  4MSX A;  2KWO A;  4XI1 A;  4YAT A;  5LKZ A;  4YBT A;  2YUR A;  2HDP A;  2KWN A;  5G0F A;  4FO9 A;  3LRQ A;  4A4B A;  5DIN A;  3M63 A;  2NAA A;  4QF2 A;  1WIL A;  2MNY A;  2VP7 A;  3ZYQ A;  3HCT A;  1JOC A;  2D8S A;  3HCS A;  5J3X A;  2L80 A;  2VNF A;  4I7C A;  3QZV A;  5D1K B;  3EB6 A;  2L5U A;  2C2L A;  1WEW A;  5JG6 A;  1WGM A;  4V3K C;  1Z60 A;  2F6N A;  4UI9 B;  4A4C A;  1MM2 A;  5G05 B;  2KWJ A;  5B76 A;  5H1T A;  1MM3 A;  5TDR A;  1T1H A;  2E6R A;  4R8P K;  2VPB A;  5EYA F;  2XB1 A;  2YHO A;  4AVX A;  1G25 A;  3N9M A;  3SHB A;  5AIT A;  2LGV A;  2ECV A;  5H1V A;  1X4U A;  2EA6 A;  2VJF A;  4BBQ A;  5C11 A;  5B77 A;  1VD4 A;  1FBV A;  1N87 A;  3U5P A;  3HTK C;  1JM7 A;  3MHH A;  1CHC A;  2YQM A;  3KV6 A;  2ECT A;  4MVT A;  3C6W A;  2ECJ A;  3U5M A;  2LDR A;  4ZUX U;  4FK5 A;  1WES A;  2MIQ A;  2VJE B;  2YT5 A;  3O7A A;  2MA6 A;  1X4J A;  1E4U A;  2ECG A;  3T7L A;  2ECI A;  2ECN A;  2KRE A;  4PTB A;  4S3O B;  2F42 A;  2KIZ A;  2RSD A;  3MHS A;  5B78 A;  3L11 A;  3SOW A;  2F6J A;  4N3W A;  3RPG C;  2XEU A;  5FER A;  5LCW B;  4YBM A;  2M85 A;  5I3L A;  2LV9 A;  4LJN A;  2KFT A;  3SOU A;  2MD8 C;  2LGK A;  4I7D A;  3NG2 A;  3N9O A;  3LQH A;  5FEY A;  2FUU A;  2JMD A;  2KWK A;  5TRB A;  2LXP C;  2DX8 A;  1U6G B;  4R2Y A;  3O37 A;  4TKP B;  2LXH C;  5KH9 A;  3KV5 A;  5TAB A;  2MNZ A;  2Y43 A;  4W4U A;  5C13 A;  2K16 A;  3KNV A;  5FB0 A;  5G04 B;  4WZ3 B;  2VPE A;  2M6M A; 
#chains in the Genus database with same CATH topology
 1LDK C;  2MUM A;  2CKL A;  2L75 A;  2VPG A;  4BHW A;  3PUR A;  2HYE D;  5KH7 A;  3DPL R;  1WEM A;  2VJF B;  2CSZ A;  3GL6 A;  1WEU A;  2IQJ A;  4GNE A;  4IC2 A;  2H0D B;  2VPD A;  3LVQ E;  4AP4 A;  2KKY A;  4Q6F A;  2E6S A;  2EGP A;  1WEO A;  5SVY A;  3ZTG A;  2KGI A;  3T6R A;  3L1Z B;  2K1J A;  2JMI A;  2EGM A;  4YAX A;  2MT5 A;  3FM8 C;  5B79 A;  4QF3 A;  2YUC A;  3PHD A;  2LQ6 A;  2RI7 A;  2KYU A;  1WEQ A;  2G43 A;  3O34 A;  2BAY A;  2ZET C;  3M99 A;  2C2V S;  4A0C D;  5D1L B;  2JM3 A;  3T9K A;  2QIC A;  3DQV R;  3ASL A;  1K2F A;  2UZG A;  1X4I A;  2G45 A;  5TDW A;  4B7Y C;  1BOR A;  1V87 A;  3O47 A;  5H9M A;  2CSV A;  2DSM A;  4GNG A;  2AN6 A;  2M3H A;  2LGL A;  4UP0 A;  2M1R A;  3O35 A;  4S3O C;  1IYM A;  4GB0 A;  2YRE A;  4B86 C;  3C5K A;  1FP0 A;  3LVR E;  1F62 A;  5B8D A;  4R7E A;  2YSJ A;  3FEH A;  4FJC A;  3O33 A;  3GV4 A;  3LDY A;  4F1P A;  2CRR A;  2XOZ A;  4FIP A;  3HCU A;  2OXQ C;  5SVI A;  4LAD B;  2Y1N A;  3M62 A;  4AUQ B;  2ECW A;  4WZ0 A;  2LGG A;  3MDB C;  2VJE A;  1LDJ B;  4O64 A;  1MBM A;  3I2D A;  3ZVY A;  2L0B A;  2QIZ A;  2YSM A;  1VFY A;  1VYX A;  3PLW A;  3PUQ A;  5FB1 A;  3SOX A;  2QJ0 A;  3ZNI A;  2KKX A;  3V43 A;  3IHP A;  5KH3 A;  4WA6 A;  4AYC A;  3ZPV E;  4L7X A;  2CRW A;  4C9Z A;  2DJA A;  4IC3 A;  1WEV A;  1ZBD B;  3N9P A;  3FJU B;  5DKA A;  4CCG X;  2YQL A;  1XWH A;  3FAN A;  1Z6U A;  4UP5 A;  2PUY A;  3L1X A;  3LQJ A;  4YBS A;  1RMD A;  1JM7 B;  4CA1 A;  3LQI A;  4GNF A;  5LKT A;  2YVR A;  2CT2 A;  2KU3 A;  3FL2 A;  1WEE A;  4WZ2 A;  4O62 A;  3KQI A;  1HYJ A;  2PNX A;  2YW8 A;  2B0O E;  3N9L A;  2YHN A;  3N9Q A;  2K17 A;  3U5N A;  2FUI A;  3O36 A;  2EXU A;  5TBN A;  3RTR B;  2LRI C;  2MD7 B;  3VK6 A;  4ZDT A;  2K4D A;  2RR4 A;  4V3L C;  1Z2Q A;  4NN2 A;  1WEN A;  3DWD A;  1WEP A;  4YC9 A;  4GND A;  4YAB A;  2YU4 A;  2H0D A;  2FD4 A;  5H1U A;  1DVP A;  4YAD A;  3ZVZ B;  5D1M B;  5B75 A;  4A49 A;  2MKE A;  4ZQL A;  2LN0 A;  3JUE A;  3ZPV 1;  2FSA A;  4F52 B;  4QQ4 A;  1WFK A;  4PPE A;  2L43 A;  4OGC A;  2JMJ A;  4LK9 A;  2G6Q A;  1WIM A;  3Q1D A;  2KGG A;  2JRJ A;  4Z0O A;  3N9N A;  4N4F A;  1HYI A;  4X3G A;  2KR4 A;  4L58 A;  2L7P A;  4I7B A;  1WE9 A;  3O70 A;  3EB5 A;  4LKA A;  2Y1M A;  5AIU A;  3RPG B;  2IDA A;  4AYC B;  3M7K A;  4LLB A;  4P5O B;  5SVX A;  2EOD A;  2I50 A;  5LKU A;  2KE1 A;  3U5O A;  2CKL B;  2CSY A;  2MA5 A;  5LKX A;  2YYR A;  4MSX A;  2KWO A;  3E2D A;  4XI1 A;  4YAT A;  5LKZ A;  4YBT A;  2YUR A;  2HDP A;  2KWN A;  5G0F A;  4FO9 A;  3LRQ A;  4A4B A;  5DIN A;  3M63 A;  2NAA A;  2XOY A;  4QF2 A;  1WIL A;  2MNY A;  4Z0R A;  2VP7 A;  3ZYQ A;  3HCT A;  1JOC A;  2D8S A;  3HCS A;  5J3X A;  2L80 A;  2P57 A;  2VNF A;  4I7C A;  3QZV A;  2XP0 A;  3EB6 A;  2L5U A;  2C2L A;  5D1K B;  2E61 A;  1WEW A;  5JG6 A;  1WGM A;  4V3K C;  1Z60 A;  2F6N A;  4H9D A;  4UI9 B;  4A4C A;  1MM2 A;  5G05 B;  2KWJ A;  5B76 A;  5H1T A;  1DCQ A;  3H7H A;  2FFW A;  1MM3 A;  5TDR A;  1T1H A;  2E6R A;  4R8P K;  2VPB A;  5EYA F;  2XB1 A;  2YHO A;  4AVX A;  1G25 A;  3N9M A;  3SHB A;  5AIT A;  2LGV A;  2ECV A;  5H1V A;  1X4U A;  2XOC A;  2EA6 A;  2VJF A;  4BBQ A;  5C11 A;  5B77 A;  1VD4 A;  3LJU X;  1FBV A;  1N87 A;  3U5P A;  3HTK C;  1JM7 A;  3MHH A;  1CHC A;  2YQM A;  3KV6 A;  2ECT A;  4MVT A;  3C6W A;  2ECJ A;  3U5M A;  2LDR A;  4ZUX U;  5SVI B;  4FK5 A;  1WES A;  2CON A;  2MIQ A;  2VJE B;  2YT5 A;  3O7A A;  2MA6 A;  1X4J A;  1E4U A;  2ECG A;  3T7L A;  2ECI A;  2ECN A;  2KRE A;  4PTB A;  2LAU A;  4S3O B;  2F42 A;  2D8U A;  2M13 A;  2KIZ A;  2RSD A;  3MHS A;  5B78 A;  3L11 A;  3SOW A;  3DDT A;  2F6J A;  4N3W A;  3RPG C;  2XEU A;  5FER A;  5LCW B;  4OGE A;  4YBM A;  2M85 A;  5I3L A;  3KDE C;  2LV9 A;  4LJN A;  2KFT A;  3SOU A;  2MD8 C;  2LGK A;  2OWA A;  4I7D A;  3NG2 A;  2JUN A;  3N9O A;  3LQH A;  5FEY A;  2FUU A;  2JMD A;  2KWK A;  5TRB A;  2LXP C;  2DX8 A;  1U6G B;  4R2Y A;  3SUB A;  3O37 A;  4TKP B;  2LXH C;  5KH9 A;  3KV5 A;  5TAB A;  2MNZ A;  2Y43 A;  5K3Q A;  4W4U A;  5C13 A;  2K16 A;  3KNV A;  5FB0 A;  5G04 B;  3FAO A;  4WZ3 B;  2VPE A;  2M6M A; 
#chains in the Genus database with same CATH homology
 1LDK C;  2MUM A;  2CKL A;  2L75 A;  2VPG A;  4BHW A;  3PUR A;  2HYE D;  5KH7 A;  3DPL R;  1WEM A;  2VJF B;  2CSZ A;  3GL6 A;  1WEU A;  4GNE A;  4IC2 A;  2H0D B;  2VPD A;  4AP4 A;  4Q6F A;  2E6S A;  2EGP A;  1WEO A;  3ZTG A;  2KGI A;  3T6R A;  3L1Z B;  2K1J A;  2JMI A;  4YAX A;  2MT5 A;  5B79 A;  4QF3 A;  2YUC A;  3PHD A;  2LQ6 A;  2RI7 A;  2KYU A;  1WEQ A;  2G43 A;  3O34 A;  2BAY A;  2ZET C;  3M99 A;  2C2V S;  4A0C D;  5D1L B;  2QIC A;  3DQV R;  3ASL A;  1K2F A;  2UZG A;  1X4I A;  2G45 A;  5TDW A;  4B7Y C;  1BOR A;  1V87 A;  5H9M A;  4GNG A;  2AN6 A;  2M3H A;  2LGL A;  4UP0 A;  2M1R A;  3O35 A;  4S3O C;  1IYM A;  4GB0 A;  2YRE A;  4B86 C;  3C5K A;  1FP0 A;  1F62 A;  5B8D A;  4R7E A;  2YSJ A;  4FJC A;  3O33 A;  3GV4 A;  4FIP A;  3HCU A;  2OXQ C;  4LAD B;  2Y1N A;  3M62 A;  4AUQ B;  2ECW A;  4WZ0 A;  2LGG A;  2VJE A;  1LDJ B;  4O64 A;  3ZVY A;  3I2D A;  2L0B A;  2QIZ A;  2YSM A;  1VFY A;  1VYX A;  3PUQ A;  5FB1 A;  3SOX A;  2QJ0 A;  3ZNI A;  3V43 A;  3IHP A;  5KH3 A;  4WA6 A;  4AYC A;  3ZPV E;  4L7X A;  4C9Z A;  4IC3 A;  1WEV A;  1ZBD B;  3N9P A;  5DKA A;  4CCG X;  2YQL A;  1XWH A;  1Z6U A;  4UP5 A;  2PUY A;  3L1X A;  3LQJ A;  4YBS A;  1RMD A;  1JM7 B;  4CA1 A;  3LQI A;  4GNF A;  5LKT A;  2CT2 A;  2KU3 A;  3FL2 A;  1WEE A;  4WZ2 A;  3KQI A;  1HYJ A;  2PNX A;  2YW8 A;  3N9Q A;  3N9L A;  2YHN A;  3U5N A;  2K17 A;  2FUI A;  3O36 A;  5TBN A;  3RTR B;  2LRI C;  2MD7 B;  3VK6 A;  4ZDT A;  2K4D A;  4V3L C;  1Z2Q A;  4NN2 A;  1WEN A;  1WEP A;  4YC9 A;  4GND A;  4YAB A;  2YU4 A;  2H0D A;  5H1U A;  1DVP A;  4YAD A;  3ZVZ B;  5D1M B;  5B75 A;  4A49 A;  4ZQL A;  2LN0 A;  3ZPV 1;  2FSA A;  4F52 B;  1WFK A;  4PPE A;  2L43 A;  2JMJ A;  4LK9 A;  2G6Q A;  1WIM A;  2KGG A;  2JRJ A;  3N9N A;  4N4F A;  1HYI A;  4X3G A;  2KR4 A;  4L58 A;  4I7B A;  1WE9 A;  3O70 A;  3EB5 A;  4LKA A;  2Y1M A;  5AIU A;  3RPG B;  2IDA A;  4AYC B;  4LLB A;  4P5O B;  2EOD A;  2I50 A;  5LKU A;  2KE1 A;  3U5O A;  2CKL B;  2CSY A;  2MA5 A;  5LKX A;  2YYR A;  4MSX A;  2KWO A;  4XI1 A;  4YAT A;  5LKZ A;  4YBT A;  2YUR A;  2HDP A;  2KWN A;  5G0F A;  4FO9 A;  3LRQ A;  4A4B A;  5DIN A;  3M63 A;  2NAA A;  4QF2 A;  1WIL A;  2MNY A;  2VP7 A;  3ZYQ A;  3HCT A;  1JOC A;  2D8S A;  3HCS A;  5J3X A;  2L80 A;  2VNF A;  4I7C A;  3QZV A;  5D1K B;  3EB6 A;  2L5U A;  2C2L A;  1WEW A;  5JG6 A;  1WGM A;  4V3K C;  1Z60 A;  2F6N A;  4UI9 B;  4A4C A;  1MM2 A;  5G05 B;  2KWJ A;  5B76 A;  5H1T A;  1MM3 A;  5TDR A;  1T1H A;  2E6R A;  4R8P K;  2VPB A;  5EYA F;  2XB1 A;  2YHO A;  4AVX A;  1G25 A;  3N9M A;  3SHB A;  5AIT A;  2LGV A;  2ECV A;  5H1V A;  1X4U A;  2EA6 A;  2VJF A;  4BBQ A;  5C11 A;  5B77 A;  1VD4 A;  1FBV A;  1N87 A;  3U5P A;  3HTK C;  1JM7 A;  3MHH A;  1CHC A;  2YQM A;  3KV6 A;  2ECT A;  4MVT A;  3C6W A;  2ECJ A;  3U5M A;  2LDR A;  4ZUX U;  4FK5 A;  1WES A;  2MIQ A;  2VJE B;  2YT5 A;  3O7A A;  2MA6 A;  1X4J A;  1E4U A;  2ECG A;  3T7L A;  2ECI A;  2ECN A;  2KRE A;  4PTB A;  4S3O B;  2F42 A;  2KIZ A;  2RSD A;  3MHS A;  5B78 A;  3L11 A;  3SOW A;  2F6J A;  4N3W A;  3RPG C;  2XEU A;  5FER A;  5LCW B;  4YBM A;  2M85 A;  5I3L A;  2LV9 A;  4LJN A;  2KFT A;  3SOU A;  2MD8 C;  2LGK A;  4I7D A;  3NG2 A;  3N9O A;  3LQH A;  5FEY A;  2FUU A;  2JMD A;  2KWK A;  5TRB A;  2LXP C;  2DX8 A;  1U6G B;  4R2Y A;  3O37 A;  4TKP B;  2LXH C;  5KH9 A;  3KV5 A;  5TAB A;  2MNZ A;  2Y43 A;  4W4U A;  5C13 A;  2K16 A;  3KNV A;  5FB0 A;  5G04 B;  4WZ3 B;  2VPE A;  2M6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...