2KR4A

U-box domain of the e3 ubiquitin ligase e4b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
85
structure length
85
Chain Sequence
PGSAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVPELKEQIQAWMREKQSSDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the monomeric U-box domain from E4B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords Ubiquitin conjugation factor E4 B
total genus 19
structure length 85
sequence length 85
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kr4A01
4GNEA 2KWOA 2YSJA 2Y1NA 1X4UA 2M3HA 3T7LA 3L1XA 3ZTGA 2VPBA 1WEWA 1FP0A 3PUQA 2G6QA 1IYMA 3HCUA 2LDRA 2H0DA 1BORA 2M6MA 4R8PK 2VJEA 3SOXA 3ZPVE 4BHWA 2JMDA 2YURA 3DPLR 5H1TA 3GV4A 5FB1A 4AVXA 3RPGB 1JM7A 5FERA 4UI9B 5KH7A 2MT5A 4V3KC 2FUUA 2YHNA 2QJ0A 2LXPC 2VJFA 4LKAA 1VFYA 2YHOA 1T1HA 3V43A 2MIQA 3ASLA 1ZBDB 5LKXA 1E4UA 1K2FA 2MA6A 2LN0A 5B79A 1WESA 3QZVA 3U5MA 4N4FA 2G43A 2L75A 2K4DA 3ZNIA 2LXHC 1WENA 3SHBA 3C6WA 4FK5A 3ZVZB 4L58A 3C5KA 3MHSA 1Z60A 2ECGA 4WZ0A 1HYJA 5AITA 3O36A 4YABA 4AYCA 1JOCA 2KGGA 2E6RA 1WGMA 5LKTA 3O35A 4YAXA 5I3LA 3L1ZB 3HCTA 3ZPV1 2PUYA 2OXQC 1HYIA 5H1UA 2FSAA 3RTRB 1LDKC 2L80A 4FIPA 1Z6UA 2F6JA 2MUMA 2QIZA 2QICA 4B86C 4W4UA 3NG2A 3SOUA 2Y1MA 2KIZA 3T6RA 4L7XA 2EA6A 3I2DA 2VP7A 3LQHA 3O37A 4R7EA 4YATA 5FB0A 2KWNA 2ECWA 1MM3A 2H0DB 3N9NA 2I50A 2XEUA 5J3XA 3LQJA 1WEVA 1MM2A 4WZ2A 2ZETC 2KWJA 1F62A 1X4JA 4V3LC 4O64A 4FO9A 1RMDA 2CSYA 2C2VS 4CA1A 2VPEA 4I7CA 2RI7A 5B78A 4UP0A 4QF2A 5LCWB 2FUIA 5D1LB 5B76A 4N3WA 1CHCA 1WEPA 3U5PA 2HYED 1WEQA 4I7DA 3U5OA 5G04B 2L5UA 3KV6A 5B77A 4LADB 4QF3A 3PHDA 2CKLB 2LGKA 3O70A 2YQMA 2M1RA 3HCSA 1XWHA 2LGGA 3LQIA 3SOWA 2RSDA 3LRQA 4GB0A 4IC3A 2LQ6A 2PNXA 4PPEA 3N9QA 5G0FA 2CKLA 3KQIA 4XI1A 2VPDA 4LJNA 2KFTA 1VD4A 3EB6A 2YYRA 3O7AA 4GNDA 5LKZA 4BBQA 3VK6A 5B75A 1U6GB 3O34A 2KWKA 2G45A 4C9ZA 1WILA 2YSMA 2E6SA 5FEYA 2UZGA 2EGPA 3M62A 2M85A 2JMIA 2NAAA 1X4IA 3M99A 1G25A 3ZVYA 3GL6A 5DINA 3N9LA 5JG6A 2KGIA 3PURA 2IDAA 5EYAF 2XB1A 2C2LA 2KE1A 4GNGA 2ECIA 3FL2A 4PTBA 2CT2A 3MHHA 1LDJB 2KU3A 4YC9A 1WEMA 4TKPB 4UP5A 4FJCA 2LGVA 3U5NA 2K17A 2YU4A 4AUQB 3KNVA 3EB5A 5TDWA 1WEEA 2VPGA 5TBNA 1WE9A 3N9OA 4MSXA 4A4BA 5D1MB 2BAYA 2HDPA 3N9PA 4YADA 1VYXA 2LGLA 2JMJA 3L11A 1DVPA 4MVTA 2VJFB 4AYCB 2Y43A 1WFKA 2DX8A 5LKUA 4WZ3B 2MD8C 4LK9A 5TRBA 2L43A 3DQVR 2MA5A 5TABA 4F52B 2CSZA 4I7BA 4WA6A 2VNFA 5B8DA 1WIMA 3O33A 4Q6FA 1FBVA 4YBMA 1V87A 2MNYA 2YREA 4S3OC 5C13A 5H1VA 5H9MA 5G05B 4ZQLA 1WEOA 4NN2A 3ZYQA 1Z2QA 5KH9A 2MNZA 4S3OB 4YBSA 5AIUA 2F42A 5KH3A 4A4CA 2F6NA 2EODA 1WEUA 2YQLA 4A49A 4B7YC 2K1JA 5D1KB 2K16A 5DKAA 4A0CD 3RPGC 4IC2A 2YUCA 1N87A 4LLBA 5C11A 2YW8A 4X3GA 1JM7B 2AN6A 2LV9A 4GNFA 2KREA 2ECNA 4AP4A 2L0BA 2MD7B 4YBTA 3HTKC 4P5OB 4ZDTA 2KR4A 2ECJA 2D8SA 4R2YA 2LRIC 2ECTA 2ECVA 5TDRA 2JRJA 4ZUXU 4CCGX 2VJEB 3N9MA 3IHPA 2YT5A 3KV5A 2KYUA 3M63A
chains in the Genus database with same CATH superfamily
4GNEA 2KWOA 2YSJA 2Y1NA 1X4UA 2M3HA 3T7LA 3L1XA 3ZTGA 2VPBA 1WEWA 1FP0A 3PUQA 2G6QA 1IYMA 2L7PA 3HCUA 2LDRA 2H0DA 1BORA 2M6MA 4R8PK 2VJEA 3SOXA 3ZPVE 4BHWA 2JMDA 2YURA 3DPLR 5H1TA 3GV4A 5FB1A 4AVXA 3RPGB 1JM7A 2DSMA 5FERA 4UI9B 5KH7A 2MT5A 4V3KC 2FUUA 2YHNA 2QJ0A 2LXPC 2CRWA 2VJFA 4LKAA 1VFYA 2YHOA 1T1HA 3V43A 2MIQA 3ASLA 1ZBDB 5LKXA 1E4UA 1K2FA 2MA6A 4QQ4A 2LN0A 3Q1DA 5B79A 1WESA 3QZVA 3U5MA 4H9DA 4N4FA 2G43A 2L75A 3LVRE 2K4DA 3ZNIA 3FAOA 3FJUB 2LXHC 1WENA 3MDBC 5SVIB 3SHBA 3C6WA 4FK5A 3ZVZB 4L58A 2CSVA 3C5KA 3MHSA 1Z60A 2ECGA 2XOZA 4WZ0A 3M7KA 1HYJA 5AITA 3O36A 2IQJA 4YABA 4AYCA 1JOCA 2KGGA 2E6RA 2XOYA 1WGMA 5LKTA 3O35A 4YAXA 5I3LA 3L1ZB 3HCTA 3ZPV1 2PUYA 2OXQC 1HYIA 5H1UA 2FSAA 3PLWA 3RTRB 2JM3A 1LDKC 2L80A 4FIPA 1Z6UA 2F6JA 3LDYA 2MUMA 2QIZA 2QICA 5SVYA 4B86C 4W4UA 3NG2A 3SOUA 2Y1MA 2KIZA 3T6RA 4L7XA 2EA6A 3I2DA 1DCQA 2VP7A 3LQHA 3O37A 4R7EA 4YATA 5FB0A 2KWNA 2EGMA 2ECWA 1MM3A 2CRRA 2H0DB 3N9NA 2I50A 2XEUA 4O62A 3LQJA 5J3XA 1WEVA 1MM2A 4WZ2A 3KDEC 2ZETC 4OGEA 2KWJA 3LJUX 2OWAA 1F62A 1X4JA 4V3LC 4O64A 4FO9A 1RMDA 2CSYA 2C2VS 4CA1A 2VPEA 4I7CA 2RI7A 5B78A 4UP0A 4QF2A 3FANA 5LCWB 2YVRA 2FUIA 5D1LB 5B76A 4N3WA 1CHCA 1WEPA 3U5PA 2HYED 1WEQA 4I7DA 3U5OA 5G04B 2L5UA 3KV6A 5B77A 4LADB 4QF3A 2XOCA 3T9KA 3PHDA 2CKLB 2LGKA 3O70A 2YQMA 2FFWA 2M1RA 3HCSA 1XWHA 2LGGA 3LQIA 3SOWA 2RSDA 3LRQA 4GB0A 4IC3A 2LQ6A 2PNXA 4PPEA 3N9QA 2CONA 5G0FA 2CKLA 3KQIA 4XI1A 2VPDA 4LJNA 2KFTA 1VD4A 3EB6A 2YYRA 3O7AA 4GNDA 5LKZA 2EXUA 4BBQA 3VK6A 5B75A 1U6GB 3H7HA 3O34A 2KWKA 2G45A 4C9ZA 1WILA 2YSMA 2E6SA 5FEYA 2DJAA 2UZGA 2E61A 2EGPA 3M62A 2M85A 2JMIA 2NAAA 1X4IA 3M99A 1G25A 3ZVYA 2FD4A 3GL6A 5DINA 3N9LA 5JG6A 2KGIA 3PURA 2IDAA 5EYAF 2XB1A 2C2LA 2KE1A 4GNGA 2ECIA 2MKEA 3FL2A 4PTBA 2JUNA 2CT2A 3MHHA 3E2DA 1LDJB 2KU3A 4YC9A 4Z0RA 1WEMA 3DWDA 4TKPB 4UP5A 4FJCA 2LGVA 5K3QA 3U5NA 2D8UA 2RR4A 2K17A 2YU4A 4AUQB 3KNVA 3EB5A 5TDWA 1WEEA 3FEHA 2VPGA 5TBNA 1WE9A 3N9OA 4MSXA 4Z0OA 4A4BA 3DDTA 5D1MB 2BAYA 2HDPA 3N9PA 4YADA 1VYXA 2LGLA 3FM8C 2JMJA 2P57A 3L11A 1DVPA 4MVTA 2VJFB 3SUBA 2Y43A 4AYCB 5SVIA 1WFKA 2DX8A 5LKUA 4WZ3B 2M13A 3JUEA 2MD8C 4LK9A 5TRBA 2L43A 2B0OE 3O47A 3DQVR 2MA5A 3LVQE 5TABA 4F52B 2CSZA 4I7BA 4WA6A 2XP0A 2VNFA 5B8DA 1WIMA 3O33A 4Q6FA 1FBVA 4YBMA 5SVXA 1V87A 4OGCA 2MNYA 2YREA 4S3OC 5C13A 5H1VA 5H9MA 5G05B 4ZQLA 1WEOA 4NN2A 3ZYQA 1Z2QA 5KH9A 2MNZA 2KKXA 4S3OB 4YBSA 5AIUA 2F42A 5KH3A 4A4CA 2F6NA 2EODA 1WEUA 2YQLA 4A49A 4B7YC 2K1JA 5D1KB 2K16A 5DKAA 4A0CD 3RPGC 4IC2A 2YUCA 1N87A 4LLBA 5C11A 2YW8A 4X3GA 4F1PA 1MBMA 1JM7B 2AN6A 2LV9A 4GNFA 2KREA 2ECNA 4AP4A 2L0BA 2MD7B 4YBTA 3HTKC 4P5OB 4ZDTA 2KR4A 2ECJA 2D8SA 2KKYA 4R2YA 2LRIC 2LAUA 2ECTA 2ECVA 5TDRA 2JRJA 4ZUXU 4CCGX 2VJEB 3N9MA 3IHPA 2YT5A 3KV5A 2KYUA 3M63A
chains in the Genus database with same CATH topology
4GNEA 2KWOA 2YSJA 2Y1NA 1X4UA 2M3HA 3T7LA 3L1XA 3ZTGA 2VPBA 1WEWA 1FP0A 3PUQA 2G6QA 1IYMA 3HCUA 2LDRA 2H0DA 1BORA 2M6MA 4R8PK 2VJEA 3SOXA 3ZPVE 4BHWA 2JMDA 2YURA 3DPLR 5H1TA 3GV4A 5FB1A 4AVXA 3RPGB 1JM7A 5FERA 4UI9B 5KH7A 2MT5A 4V3KC 2FUUA 2YHNA 2QJ0A 2LXPC 2VJFA 4LKAA 1VFYA 2YHOA 1T1HA 3V43A 2MIQA 3ASLA 1ZBDB 5LKXA 1E4UA 1K2FA 2MA6A 2LN0A 5B79A 1WESA 3QZVA 3U5MA 4N4FA 2G43A 2L75A 2K4DA 3ZNIA 2LXHC 1WENA 3SHBA 3C6WA 4FK5A 3ZVZB 4L58A 3C5KA 3MHSA 1Z60A 2ECGA 4WZ0A 1HYJA 5AITA 3O36A 4YABA 4AYCA 1JOCA 2KGGA 2E6RA 1WGMA 5LKTA 3O35A 4YAXA 5I3LA 3L1ZB 3HCTA 3ZPV1 2PUYA 2OXQC 1HYIA 5H1UA 2FSAA 3RTRB 1LDKC 2L80A 4FIPA 1Z6UA 2F6JA 2MUMA 2QIZA 2QICA 4B86C 4W4UA 3NG2A 3SOUA 2Y1MA 2KIZA 3T6RA 4L7XA 2EA6A 3I2DA 2VP7A 3LQHA 3O37A 4R7EA 4YATA 5FB0A 2KWNA 2ECWA 1MM3A 2H0DB 3N9NA 2I50A 2XEUA 5J3XA 3LQJA 1WEVA 1MM2A 4WZ2A 2ZETC 2KWJA 1F62A 1X4JA 4V3LC 4O64A 4FO9A 1RMDA 2CSYA 2C2VS 4CA1A 2VPEA 4I7CA 2RI7A 5B78A 4UP0A 4QF2A 5LCWB 2FUIA 5D1LB 5B76A 4N3WA 1CHCA 1WEPA 3U5PA 2HYED 1WEQA 4I7DA 3U5OA 5G04B 2L5UA 3KV6A 5B77A 4LADB 4QF3A 3PHDA 2CKLB 2LGKA 3O70A 2YQMA 2M1RA 3HCSA 1XWHA 2LGGA 3LQIA 3SOWA 2RSDA 3LRQA 4GB0A 4IC3A 2LQ6A 2PNXA 4PPEA 3N9QA 5G0FA 2CKLA 3KQIA 4XI1A 2VPDA 4LJNA 2KFTA 1VD4A 3EB6A 2YYRA 3O7AA 4GNDA 5LKZA 4BBQA 3VK6A 5B75A 1U6GB 3O34A 2KWKA 2G45A 4C9ZA 1WILA 2YSMA 2E6SA 5FEYA 2UZGA 2EGPA 3M62A 2M85A 2JMIA 2NAAA 1X4IA 3M99A 1G25A 3ZVYA 3GL6A 5DINA 3N9LA 5JG6A 2KGIA 3PURA 2IDAA 5EYAF 2XB1A 2C2LA 2KE1A 4GNGA 2ECIA 3FL2A 4PTBA 2CT2A 3MHHA 1LDJB 2KU3A 4YC9A 1WEMA 4TKPB 4UP5A 4FJCA 2LGVA 3U5NA 2K17A 2YU4A 4AUQB 3KNVA 3EB5A 5TDWA 1WEEA 2VPGA 5TBNA 1WE9A 3N9OA 4MSXA 4A4BA 5D1MB 2BAYA 2HDPA 3N9PA 4YADA 1VYXA 2LGLA 2JMJA 3L11A 1DVPA 4MVTA 2VJFB 4AYCB 2Y43A 1WFKA 2DX8A 5LKUA 4WZ3B 2MD8C 4LK9A 5TRBA 2L43A 3DQVR 2MA5A 5TABA 4F52B 2CSZA 4I7BA 4WA6A 2VNFA 5B8DA 1WIMA 3O33A 4Q6FA 1FBVA 4YBMA 1V87A 2MNYA 2YREA 4S3OC 5C13A 5H1VA 5H9MA 5G05B 4ZQLA 1WEOA 4NN2A 3ZYQA 1Z2QA 5KH9A 2MNZA 4S3OB 4YBSA 5AIUA 2F42A 5KH3A 4A4CA 2F6NA 2EODA 1WEUA 2YQLA 4A49A 4B7YC 2K1JA 5D1KB 2K16A 5DKAA 4A0CD 3RPGC 4IC2A 2YUCA 1N87A 4LLBA 5C11A 2YW8A 4X3GA 1JM7B 2AN6A 2LV9A 4GNFA 2KREA 2ECNA 4AP4A 2L0BA 2MD7B 4YBTA 3HTKC 4P5OB 4ZDTA 2KR4A 2ECJA 2D8SA 4R2YA 2LRIC 2ECTA 2ECVA 5TDRA 2JRJA 4ZUXU 4CCGX 2VJEB 3N9MA 3IHPA 2YT5A 3KV5A 2KYUA 3M63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNE A;  2KWO A;  2YSJ A;  2Y1N A;  1X4U A;  2M3H A;  3T7L A;  3L1X A;  3ZTG A;  2VPB A;  1WEW A;  1FP0 A;  3PUQ A;  2G6Q A;  1IYM A;  3HCU A;  2LDR A;  2H0D A;  1BOR A;  2M6M A;  4R8P K;  2VJE A;  3SOX A;  3ZPV E;  4BHW A;  2JMD A;  2YUR A;  3DPL R;  5H1T A;  3GV4 A;  5FB1 A;  4AVX A;  3RPG B;  1JM7 A;  5FER A;  4UI9 B;  5KH7 A;  2MT5 A;  4V3K C;  2FUU A;  2YHN A;  2QJ0 A;  2LXP C;  2VJF A;  4LKA A;  1VFY A;  2YHO A;  1T1H A;  3V43 A;  2MIQ A;  3ASL A;  1ZBD B;  5LKX A;  1E4U A;  1K2F A;  2MA6 A;  2LN0 A;  5B79 A;  1WES A;  3QZV A;  3U5M A;  4N4F A;  2G43 A;  2L75 A;  2K4D A;  3ZNI A;  2LXH C;  1WEN A;  3SHB A;  3C6W A;  4FK5 A;  3ZVZ B;  4L58 A;  3C5K A;  3MHS A;  1Z60 A;  2ECG A;  4WZ0 A;  1HYJ A;  5AIT A;  3O36 A;  4YAB A;  4AYC A;  1JOC A;  2KGG A;  2E6R A;  1WGM A;  5LKT A;  3O35 A;  4YAX A;  5I3L A;  3L1Z B;  3HCT A;  3ZPV 1;  2PUY A;  2OXQ C;  1HYI A;  5H1U A;  2FSA A;  3RTR B;  1LDK C;  2L80 A;  4FIP A;  1Z6U A;  2F6J A;  2MUM A;  2QIZ A;  2QIC A;  4B86 C;  4W4U A;  3NG2 A;  3SOU A;  2Y1M A;  2KIZ A;  3T6R A;  4L7X A;  2EA6 A;  3I2D A;  2VP7 A;  3LQH A;  3O37 A;  4R7E A;  4YAT A;  5FB0 A;  2KWN A;  2ECW A;  1MM3 A;  2H0D B;  3N9N A;  2I50 A;  2XEU A;  5J3X A;  3LQJ A;  1WEV A;  1MM2 A;  4WZ2 A;  2ZET C;  2KWJ A;  1F62 A;  1X4J A;  4V3L C;  4O64 A;  4FO9 A;  1RMD A;  2CSY A;  2C2V S;  4CA1 A;  2VPE A;  4I7C A;  2RI7 A;  5B78 A;  4UP0 A;  4QF2 A;  5LCW B;  2FUI A;  5D1L B;  5B76 A;  4N3W A;  1CHC A;  1WEP A;  3U5P A;  2HYE D;  1WEQ A;  4I7D A;  3U5O A;  5G04 B;  2L5U A;  3KV6 A;  5B77 A;  4LAD B;  4QF3 A;  3PHD A;  2CKL B;  2LGK A;  3O70 A;  2YQM A;  2M1R A;  3HCS A;  1XWH A;  2LGG A;  3LQI A;  3SOW A;  2RSD A;  3LRQ A;  4GB0 A;  4IC3 A;  2LQ6 A;  2PNX A;  4PPE A;  3N9Q A;  5G0F A;  2CKL A;  3KQI A;  4XI1 A;  2VPD A;  4LJN A;  2KFT A;  1VD4 A;  3EB6 A;  2YYR A;  3O7A A;  4GND A;  5LKZ A;  4BBQ A;  3VK6 A;  5B75 A;  1U6G B;  3O34 A;  2KWK A;  2G45 A;  4C9Z A;  1WIL A;  2YSM A;  2E6S A;  5FEY A;  2UZG A;  2EGP A;  3M62 A;  2M85 A;  2JMI A;  2NAA A;  1X4I A;  3M99 A;  1G25 A;  3ZVY A;  3GL6 A;  5DIN A;  3N9L A;  5JG6 A;  2KGI A;  3PUR A;  2IDA A;  5EYA F;  2XB1 A;  2C2L A;  2KE1 A;  4GNG A;  2ECI A;  3FL2 A;  4PTB A;  2CT2 A;  3MHH A;  1LDJ B;  2KU3 A;  4YC9 A;  1WEM A;  4TKP B;  4UP5 A;  4FJC A;  2LGV A;  3U5N A;  2K17 A;  2YU4 A;  4AUQ B;  3KNV A;  3EB5 A;  5TDW A;  1WEE A;  2VPG A;  5TBN A;  1WE9 A;  3N9O A;  4MSX A;  4A4B A;  5D1M B;  2BAY A;  2HDP A;  3N9P A;  4YAD A;  1VYX A;  2LGL A;  2JMJ A;  3L11 A;  1DVP A;  4MVT A;  2VJF B;  4AYC B;  2Y43 A;  1WFK A;  2DX8 A;  5LKU A;  4WZ3 B;  2MD8 C;  4LK9 A;  5TRB A;  2L43 A;  3DQV R;  2MA5 A;  5TAB A;  4F52 B;  2CSZ A;  4I7B A;  4WA6 A;  2VNF A;  5B8D A;  1WIM A;  3O33 A;  4Q6F A;  1FBV A;  4YBM A;  1V87 A;  2MNY A;  2YRE A;  4S3O C;  5C13 A;  5H1V A;  5H9M A;  5G05 B;  4ZQL A;  1WEO A;  4NN2 A;  3ZYQ A;  1Z2Q A;  5KH9 A;  2MNZ A;  4S3O B;  4YBS A;  5AIU A;  2F42 A;  5KH3 A;  4A4C A;  2F6N A;  2EOD A;  1WEU A;  2YQL A;  4A49 A;  4B7Y C;  2K1J A;  5D1K B;  2K16 A;  5DKA A;  4A0C D;  3RPG C;  4IC2 A;  2YUC A;  1N87 A;  4LLB A;  5C11 A;  2YW8 A;  4X3G A;  1JM7 B;  2AN6 A;  2LV9 A;  4GNF A;  2KRE A;  2ECN A;  4AP4 A;  2L0B A;  2MD7 B;  4YBT A;  3HTK C;  4P5O B;  4ZDT A;  2KR4 A;  2ECJ A;  2D8S A;  4R2Y A;  2LRI C;  2ECT A;  2ECV A;  5TDR A;  2JRJ A;  4ZUX U;  4CCG X;  2VJE B;  3N9M A;  3IHP A;  2YT5 A;  3KV5 A;  2KYU A;  3M63 A; 
#chains in the Genus database with same CATH topology
 4GNE A;  2KWO A;  2YSJ A;  2Y1N A;  1X4U A;  2M3H A;  3T7L A;  3L1X A;  3ZTG A;  2VPB A;  1WEW A;  1FP0 A;  3PUQ A;  2G6Q A;  1IYM A;  2L7P A;  3HCU A;  2LDR A;  2H0D A;  1BOR A;  2M6M A;  4R8P K;  2VJE A;  3SOX A;  3ZPV E;  4BHW A;  2JMD A;  2YUR A;  3DPL R;  5H1T A;  3GV4 A;  5FB1 A;  4AVX A;  3RPG B;  1JM7 A;  2DSM A;  5FER A;  4UI9 B;  5KH7 A;  2MT5 A;  4V3K C;  2FUU A;  2YHN A;  2QJ0 A;  2LXP C;  2CRW A;  2VJF A;  4LKA A;  1VFY A;  2YHO A;  1T1H A;  3V43 A;  2MIQ A;  3ASL A;  1ZBD B;  5LKX A;  1E4U A;  1K2F A;  2MA6 A;  4QQ4 A;  2LN0 A;  3Q1D A;  5B79 A;  1WES A;  3QZV A;  3U5M A;  4H9D A;  4N4F A;  2G43 A;  2L75 A;  3LVR E;  2K4D A;  3ZNI A;  3FAO A;  3FJU B;  2LXH C;  1WEN A;  3MDB C;  5SVI B;  3SHB A;  3C6W A;  4FK5 A;  3ZVZ B;  4L58 A;  2CSV A;  3C5K A;  3MHS A;  1Z60 A;  2ECG A;  2XOZ A;  4WZ0 A;  3M7K A;  1HYJ A;  5AIT A;  3O36 A;  2IQJ A;  4YAB A;  4AYC A;  1JOC A;  2KGG A;  2E6R A;  2XOY A;  1WGM A;  5LKT A;  3O35 A;  4YAX A;  5I3L A;  3L1Z B;  3HCT A;  3ZPV 1;  2PUY A;  2OXQ C;  1HYI A;  5H1U A;  2FSA A;  3PLW A;  3RTR B;  2JM3 A;  1LDK C;  2L80 A;  4FIP A;  1Z6U A;  2F6J A;  3LDY A;  2MUM A;  2QIZ A;  2QIC A;  5SVY A;  4B86 C;  4W4U A;  3NG2 A;  3SOU A;  2Y1M A;  2KIZ A;  3T6R A;  4L7X A;  2EA6 A;  3I2D A;  1DCQ A;  2VP7 A;  3LQH A;  3O37 A;  4R7E A;  4YAT A;  5FB0 A;  2KWN A;  2EGM A;  2ECW A;  1MM3 A;  2CRR A;  2H0D B;  3N9N A;  2I50 A;  2XEU A;  4O62 A;  3LQJ A;  5J3X A;  1WEV A;  1MM2 A;  4WZ2 A;  3KDE C;  2ZET C;  4OGE A;  2KWJ A;  3LJU X;  2OWA A;  1F62 A;  1X4J A;  4V3L C;  4O64 A;  4FO9 A;  1RMD A;  2CSY A;  2C2V S;  4CA1 A;  2VPE A;  4I7C A;  2RI7 A;  5B78 A;  4UP0 A;  4QF2 A;  3FAN A;  5LCW B;  2YVR A;  2FUI A;  5D1L B;  5B76 A;  4N3W A;  1CHC A;  1WEP A;  3U5P A;  2HYE D;  1WEQ A;  4I7D A;  3U5O A;  5G04 B;  2L5U A;  3KV6 A;  5B77 A;  4LAD B;  4QF3 A;  2XOC A;  3T9K A;  3PHD A;  2CKL B;  2LGK A;  3O70 A;  2YQM A;  2FFW A;  2M1R A;  3HCS A;  1XWH A;  2LGG A;  3LQI A;  3SOW A;  2RSD A;  3LRQ A;  4GB0 A;  4IC3 A;  2LQ6 A;  2PNX A;  4PPE A;  3N9Q A;  2CON A;  5G0F A;  2CKL A;  3KQI A;  4XI1 A;  2VPD A;  4LJN A;  2KFT A;  1VD4 A;  3EB6 A;  2YYR A;  3O7A A;  4GND A;  5LKZ A;  2EXU A;  4BBQ A;  3VK6 A;  5B75 A;  1U6G B;  3H7H A;  3O34 A;  2KWK A;  2G45 A;  4C9Z A;  1WIL A;  2YSM A;  2E6S A;  5FEY A;  2DJA A;  2UZG A;  2E61 A;  2EGP A;  3M62 A;  2M85 A;  2JMI A;  2NAA A;  1X4I A;  3M99 A;  1G25 A;  3ZVY A;  2FD4 A;  3GL6 A;  5DIN A;  3N9L A;  5JG6 A;  2KGI A;  3PUR A;  2IDA A;  5EYA F;  2XB1 A;  2C2L A;  2KE1 A;  4GNG A;  2ECI A;  2MKE A;  3FL2 A;  4PTB A;  2JUN A;  2CT2 A;  3MHH A;  3E2D A;  1LDJ B;  2KU3 A;  4YC9 A;  4Z0R A;  1WEM A;  3DWD A;  4TKP B;  4UP5 A;  4FJC A;  2LGV A;  5K3Q A;  3U5N A;  2D8U A;  2RR4 A;  2K17 A;  2YU4 A;  4AUQ B;  3KNV A;  3EB5 A;  5TDW A;  1WEE A;  3FEH A;  2VPG A;  5TBN A;  1WE9 A;  3N9O A;  4MSX A;  4Z0O A;  4A4B A;  3DDT A;  5D1M B;  2BAY A;  2HDP A;  3N9P A;  4YAD A;  1VYX A;  2LGL A;  3FM8 C;  2JMJ A;  2P57 A;  3L11 A;  1DVP A;  4MVT A;  2VJF B;  3SUB A;  2Y43 A;  4AYC B;  5SVI A;  1WFK A;  2DX8 A;  5LKU A;  4WZ3 B;  2M13 A;  3JUE A;  2MD8 C;  4LK9 A;  5TRB A;  2L43 A;  2B0O E;  3O47 A;  3DQV R;  2MA5 A;  3LVQ E;  5TAB A;  4F52 B;  2CSZ A;  4I7B A;  4WA6 A;  2XP0 A;  2VNF A;  5B8D A;  1WIM A;  3O33 A;  4Q6F A;  1FBV A;  4YBM A;  5SVX A;  1V87 A;  4OGC A;  2MNY A;  2YRE A;  4S3O C;  5C13 A;  5H1V A;  5H9M A;  5G05 B;  4ZQL A;  1WEO A;  4NN2 A;  3ZYQ A;  1Z2Q A;  5KH9 A;  2MNZ A;  2KKX A;  4S3O B;  4YBS A;  5AIU A;  2F42 A;  5KH3 A;  4A4C A;  2F6N A;  2EOD A;  1WEU A;  2YQL A;  4A49 A;  4B7Y C;  2K1J A;  5D1K B;  2K16 A;  5DKA A;  4A0C D;  3RPG C;  4IC2 A;  2YUC A;  1N87 A;  4LLB A;  5C11 A;  2YW8 A;  4X3G A;  4F1P A;  1MBM A;  1JM7 B;  2AN6 A;  2LV9 A;  4GNF A;  2KRE A;  2ECN A;  4AP4 A;  2L0B A;  2MD7 B;  4YBT A;  3HTK C;  4P5O B;  4ZDT A;  2KR4 A;  2ECJ A;  2D8S A;  2KKY A;  4R2Y A;  2LRI C;  2LAU A;  2ECT A;  2ECV A;  5TDR A;  2JRJ A;  4ZUX U;  4CCG X;  2VJE B;  3N9M A;  3IHP A;  2YT5 A;  3KV5 A;  2KYU A;  3M63 A; 
#chains in the Genus database with same CATH homology
 4GNE A;  2KWO A;  2YSJ A;  2Y1N A;  1X4U A;  2M3H A;  3T7L A;  3L1X A;  3ZTG A;  2VPB A;  1WEW A;  1FP0 A;  3PUQ A;  2G6Q A;  1IYM A;  3HCU A;  2LDR A;  2H0D A;  1BOR A;  2M6M A;  4R8P K;  2VJE A;  3SOX A;  3ZPV E;  4BHW A;  2JMD A;  2YUR A;  3DPL R;  5H1T A;  3GV4 A;  5FB1 A;  4AVX A;  3RPG B;  1JM7 A;  5FER A;  4UI9 B;  5KH7 A;  2MT5 A;  4V3K C;  2FUU A;  2YHN A;  2QJ0 A;  2LXP C;  2VJF A;  4LKA A;  1VFY A;  2YHO A;  1T1H A;  3V43 A;  2MIQ A;  3ASL A;  1ZBD B;  5LKX A;  1E4U A;  1K2F A;  2MA6 A;  2LN0 A;  5B79 A;  1WES A;  3QZV A;  3U5M A;  4N4F A;  2G43 A;  2L75 A;  2K4D A;  3ZNI A;  2LXH C;  1WEN A;  3SHB A;  3C6W A;  4FK5 A;  3ZVZ B;  4L58 A;  3C5K A;  3MHS A;  1Z60 A;  2ECG A;  4WZ0 A;  1HYJ A;  5AIT A;  3O36 A;  4YAB A;  4AYC A;  1JOC A;  2KGG A;  2E6R A;  1WGM A;  5LKT A;  3O35 A;  4YAX A;  5I3L A;  3L1Z B;  3HCT A;  3ZPV 1;  2PUY A;  2OXQ C;  1HYI A;  5H1U A;  2FSA A;  3RTR B;  1LDK C;  2L80 A;  4FIP A;  1Z6U A;  2F6J A;  2MUM A;  2QIZ A;  2QIC A;  4B86 C;  4W4U A;  3NG2 A;  3SOU A;  2Y1M A;  2KIZ A;  3T6R A;  4L7X A;  2EA6 A;  3I2D A;  2VP7 A;  3LQH A;  3O37 A;  4R7E A;  4YAT A;  5FB0 A;  2KWN A;  2ECW A;  1MM3 A;  2H0D B;  3N9N A;  2I50 A;  2XEU A;  5J3X A;  3LQJ A;  1WEV A;  1MM2 A;  4WZ2 A;  2ZET C;  2KWJ A;  1F62 A;  1X4J A;  4V3L C;  4O64 A;  4FO9 A;  1RMD A;  2CSY A;  2C2V S;  4CA1 A;  2VPE A;  4I7C A;  2RI7 A;  5B78 A;  4UP0 A;  4QF2 A;  5LCW B;  2FUI A;  5D1L B;  5B76 A;  4N3W A;  1CHC A;  1WEP A;  3U5P A;  2HYE D;  1WEQ A;  4I7D A;  3U5O A;  5G04 B;  2L5U A;  3KV6 A;  5B77 A;  4LAD B;  4QF3 A;  3PHD A;  2CKL B;  2LGK A;  3O70 A;  2YQM A;  2M1R A;  3HCS A;  1XWH A;  2LGG A;  3LQI A;  3SOW A;  2RSD A;  3LRQ A;  4GB0 A;  4IC3 A;  2LQ6 A;  2PNX A;  4PPE A;  3N9Q A;  5G0F A;  2CKL A;  3KQI A;  4XI1 A;  2VPD A;  4LJN A;  2KFT A;  1VD4 A;  3EB6 A;  2YYR A;  3O7A A;  4GND A;  5LKZ A;  4BBQ A;  3VK6 A;  5B75 A;  1U6G B;  3O34 A;  2KWK A;  2G45 A;  4C9Z A;  1WIL A;  2YSM A;  2E6S A;  5FEY A;  2UZG A;  2EGP A;  3M62 A;  2M85 A;  2JMI A;  2NAA A;  1X4I A;  3M99 A;  1G25 A;  3ZVY A;  3GL6 A;  5DIN A;  3N9L A;  5JG6 A;  2KGI A;  3PUR A;  2IDA A;  5EYA F;  2XB1 A;  2C2L A;  2KE1 A;  4GNG A;  2ECI A;  3FL2 A;  4PTB A;  2CT2 A;  3MHH A;  1LDJ B;  2KU3 A;  4YC9 A;  1WEM A;  4TKP B;  4UP5 A;  4FJC A;  2LGV A;  3U5N A;  2K17 A;  2YU4 A;  4AUQ B;  3KNV A;  3EB5 A;  5TDW A;  1WEE A;  2VPG A;  5TBN A;  1WE9 A;  3N9O A;  4MSX A;  4A4B A;  5D1M B;  2BAY A;  2HDP A;  3N9P A;  4YAD A;  1VYX A;  2LGL A;  2JMJ A;  3L11 A;  1DVP A;  4MVT A;  2VJF B;  4AYC B;  2Y43 A;  1WFK A;  2DX8 A;  5LKU A;  4WZ3 B;  2MD8 C;  4LK9 A;  5TRB A;  2L43 A;  3DQV R;  2MA5 A;  5TAB A;  4F52 B;  2CSZ A;  4I7B A;  4WA6 A;  2VNF A;  5B8D A;  1WIM A;  3O33 A;  4Q6F A;  1FBV A;  4YBM A;  1V87 A;  2MNY A;  2YRE A;  4S3O C;  5C13 A;  5H1V A;  5H9M A;  5G05 B;  4ZQL A;  1WEO A;  4NN2 A;  3ZYQ A;  1Z2Q A;  5KH9 A;  2MNZ A;  4S3O B;  4YBS A;  5AIU A;  2F42 A;  5KH3 A;  4A4C A;  2F6N A;  2EOD A;  1WEU A;  2YQL A;  4A49 A;  4B7Y C;  2K1J A;  5D1K B;  2K16 A;  5DKA A;  4A0C D;  3RPG C;  4IC2 A;  2YUC A;  1N87 A;  4LLB A;  5C11 A;  2YW8 A;  4X3G A;  1JM7 B;  2AN6 A;  2LV9 A;  4GNF A;  2KRE A;  2ECN A;  4AP4 A;  2L0B A;  2MD7 B;  4YBT A;  3HTK C;  4P5O B;  4ZDT A;  2KR4 A;  2ECJ A;  2D8S A;  4R2Y A;  2LRI C;  2ECT A;  2ECV A;  5TDR A;  2JRJ A;  4ZUX U;  4CCG X;  2VJE B;  3N9M A;  3IHP A;  2YT5 A;  3KV5 A;  2KYU A;  3M63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...