4XI1A

Crystal structure of u-box 2 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris, wild-type
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
YTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQQIKVYNFYRKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase LubX
total genus 18
structure length 76
sequence length 76
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4xi1A00
4CCGX 1FP0A 2KGIA 5AIUA 2LV9A 5H1TA 2ECNA 2KWOA 5FERA 4MSXA 3T6RA 5LKUA 3I2DA 2MNYA 4WA6A 3L11A 1U6GB 4GNFA 5D1MB 5TDRA 2KWKA 2JMIA 2YQMA 3PHDA 1N87A 1X4IA 5D1LB 2LN0A 3O34A 4X3GA 3ZYQA 3V43A 4TKPB 2YURA 3GL6A 5EYAF 1G25A 2LGLA 2VJEB 1WIMA 2LRIC 2EODA 4GNDA 5FEYA 2MD8C 2JMJA 5H9MA 5B76A 3O37A 4O64A 4AP4A 4F52B 5TDWA 5FB1A 2G43A 2OXQC 2AN6A 3N9NA 1WILA 4R7EA 3T7LA 3GV4A 3N9OA 2IDAA 2F6JA 3RPGB 5B75A 2NAAA 2Y1NA 5DINA 4PTBA 2CT2A 3IHPA 3PURA 2KREA 4V3LC 2K4DA 5G04B 1WEQA 4FO9A 2ECJA 2EA6A 3NG2A 3LQIA 5TBNA 2UZGA 2VP7A 2CKLB 4A0CD 4R2YA 2KWNA 2ECWA 5D1KB 3DQVR 5AITA 2H0DA 3LRQA 2CSZA 3LQHA 2M1RA 1WEPA 2YSJA 3U5PA 2M3HA 2YHOA 1BORA 1F62A 3U5MA 2VJFA 5C11A 3O36A 4N3WA 3KQIA 1WEUA 3ZNIA 5G0FA 2ECVA 3O33A 2QJ0A 2F6NA 4FJCA 4GNGA 4UP0A 2MA5A 4ZQLA 5H1VA 5LCWB 2LGVA 4W4UA 1Z6UA 2M6MA 4XI1A 4AVXA 2YYRA 3KV5A 1T1HA 2MD7B 3EB6A 1WENA 2C2LA 2EGPA 2L43A 4A4BA 2ECIA 4Q6FA 3N9LA 4V3KC 2VPBA 3N9QA 2VNFA 2JMDA 2L75A 4YABA 5TABA 2MNZA 4I7BA 2ECGA 2YUCA 5J3XA 2H0DB 4FIPA 5B78A 3QZVA 1WEWA 4I7CA 2YSMA 2L5UA 3O7AA 2LGKA 1WE9A 4ZUXU 2M85A 4YC9A 3M62A 4B7YC 1JM7A 5LKTA 3U5NA 2D8SA 1RMDA 5KH9A 2E6RA 1LDJB 5I3LA 1WEMA 1X4JA 1Z2QA 2VPDA 1CHCA 1HYJA 4YBSA 4YAXA 4BBQA 4QF2A 3RPGC 2XEUA 3M63A 2QICA 2K1JA 4C9ZA 2KFTA 3KV6A 2KIZA 1VFYA 1WGMA 2KWJA 4UI9B 1VYXA 2LDRA 2LQ6A 3ASLA 1X4UA 3O35A 1JOCA 2Y1MA 1XWHA 2LXPC 2C2VS 4GB0A 3N9PA 2QIZA 3M99A 2KYUA 1V87A 2PNXA 4NN2A 4WZ3B 1VD4A 4P5OB 3SHBA 2L0BA 2HYED 3VK6A 2XB1A 3ZVYA 3LQJA 5C13A 3C6WA 4L7XA 3KNVA 3L1XA 1IYMA 5B79A 2LXHC 2F42A 2Y43A 1MM3A 4B86C 2YHNA 4S3OC 3PUQA 2HDPA 2L80A 3ZVZB 3L1ZB 4LLBA 4YADA 1DVPA 4LK9A 1HYIA 5FB0A 4ZDTA 4R8PK 2E6SA 1WFKA 2YT5A 2JRJA 2PUYA 2FUUA 4CA1A 3HCUA 4WZ0A 3SOWA 3MHHA 2K17A 4FK5A 3MHSA 2BAYA 4YATA 5JG6A 2MT5A 5LKXA 5H1UA 2CSYA 4UP5A 3N9MA 4YBMA 2RI7A 1WEVA 4PPEA 4AUQB 5LKZA 2VPGA 4YBTA 5KH3A 4GNEA 2I50A 2ZETC 2KU3A 5B8DA 2FSAA 3HCSA 4IC3A 4S3OB 3FL2A 3ZPVE 2MUMA 2VJFB 2DX8A 3U5OA 4LJNA 1WESA 4WZ2A 3ZTGA 3EB5A 2K16A 4I7DA 3SOXA 1MM2A 3SOUA 4IC2A 1WEOA 4LADB 1ZBDB 2FUIA 2G6QA 2RSDA 3RTRB 2MA6A 5TRBA 1Z60A 2YW8A 1LDKC 4AYCB 2MIQA 1K2FA 2KE1A 1WEEA 2LGGA 4A49A 1JM7B 2G45A 4AYCA 2VJEA 4L58A 2KR4A 1E4UA 4BHWA 2CKLA 5KH7A 3HTKC 2KGGA 4LKAA 3C5KA 2YQLA 3DPLR 4MVTA 3HCTA 4QF3A 4A4CA 2VPEA 3O70A 5B77A 2YU4A 2ECTA 1FBVA 5DKAA 4N4FA 5G05B 2YREA 3ZPV1
chains in the Genus database with same CATH superfamily
2L7PA 4CCGX 2CRRA 1FP0A 2KGIA 5AIUA 2LV9A 5H1TA 2ECNA 2KWOA 5FERA 4MSXA 3T6RA 2OWAA 5LKUA 3I2DA 2MNYA 4WA6A 3FM8C 3L11A 1U6GB 4GNFA 5D1MB 5TDRA 2KWKA 2JMIA 2YQMA 3PHDA 3LJUX 2MKEA 1N87A 1X4IA 5D1LB 2LN0A 3O34A 4X3GA 3ZYQA 3V43A 4TKPB 2YURA 3GL6A 5EYAF 1G25A 2LGLA 2VJEB 1WIMA 2LRIC 2EODA 4GNDA 5FEYA 5SVXA 2MD8C 2JMJA 5H9MA 5B76A 3O37A 2JM3A 4O64A 4AP4A 4F52B 5TDWA 5FB1A 2G43A 2CSVA 2OXQC 3PLWA 4OGEA 2AN6A 3N9NA 1WILA 4R7EA 3T7LA 3GV4A 3N9OA 2IDAA 2F6JA 4OGCA 3RPGB 5B75A 2D8UA 2NAAA 5DINA 4PTBA 2Y1NA 2CT2A 3IHPA 4V3LC 2KREA 3PURA 2K4DA 5G04B 4H9DA 1WEQA 4FO9A 2ECJA 3H7HA 2EA6A 3NG2A 3LQIA 3KDEC 3T9KA 5TBNA 2UZGA 2CONA 2VP7A 2CKLB 4A0CD 4R2YA 2KWNA 2LAUA 2ECWA 5D1KB 3DQVR 5AITA 2H0DA 3LRQA 2CSZA 3LQHA 2M1RA 1WEPA 2YSJA 3U5PA 2M3HA 2YHOA 3FEHA 4Z0OA 1BORA 1F62A 3U5MA 2VJFA 5C11A 3O36A 3LDYA 4N3WA 3KQIA 2DJAA 1WEUA 2EGMA 3ZNIA 5G0FA 2ECVA 3O33A 2QJ0A 2F6NA 3LVRE 4FJCA 4GNGA 4UP0A 2MA5A 4ZQLA 5H1VA 5LCWB 2LGVA 4W4UA 1Z6UA 2M6MA 4XI1A 4AVXA 2YYRA 3KV5A 3E2DA 1T1HA 3Q1DA 2MD7B 3EB6A 2JUNA 1WENA 2C2LA 2EGPA 2L43A 4A4BA 2ECIA 4Q6FA 3N9LA 4V3KC 2VPBA 3N9QA 2VNFA 2JMDA 2L75A 4YABA 5TABA 2MNZA 4I7BA 2ECGA 2YUCA 5J3XA 2H0DB 4FIPA 2FFWA 5B78A 5SVIA 3QZVA 1WEWA 4I7CA 2YSMA 2L5UA 3O7AA 2LGKA 1WE9A 4ZUXU 2M85A 4YC9A 3M62A 2CRWA 3JUEA 4B7YC 1JM7A 5LKTA 3U5NA 5SVIB 2D8SA 1RMDA 5KH9A 2E6RA 2DSMA 1LDJB 4O62A 5I3LA 1WEMA 1X4JA 1Z2QA 2VPDA 1CHCA 2FD4A 2RR4A 1HYJA 4YBSA 4YAXA 4BBQA 4QF2A 3RPGC 3O47A 2XEUA 3M63A 2QICA 2K1JA 4C9ZA 3FJUB 2KFTA 3KV6A 2IQJA 5K3QA 2KIZA 3LVQE 1VFYA 1WGMA 2KWJA 4UI9B 1VYXA 2LDRA 2LQ6A 3ASLA 2EXUA 1X4UA 3O35A 1JOCA 2Y1MA 1XWHA 2LXPC 2C2VS 4GB0A 3N9PA 2QIZA 3M99A 2KYUA 1V87A 2PNXA 4NN2A 4WZ3B 1VD4A 3DWDA 5SVYA 4P5OB 4Z0RA 3SHBA 2L0BA 2HYED 3VK6A 2XB1A 4QQ4A 3ZVYA 3LQJA 5C13A 3C6WA 4L7XA 3KNVA 3L1XA 1IYMA 5B79A 2LXHC 2F42A 2Y43A 1MM3A 2YHNA 4B86C 1DCQA 4S3OC 3PUQA 2HDPA 2L80A 3ZVZB 3L1ZB 4LLBA 4YADA 1DVPA 4LK9A 1HYIA 5FB0A 4ZDTA 4R8PK 2E6SA 1WFKA 2YT5A 2JRJA 2PUYA 2E61A 2FUUA 2M13A 4CA1A 2KKYA 3HCUA 4WZ0A 3SOWA 3MHHA 2K17A 4FK5A 3MHSA 2BAYA 4YATA 5JG6A 2XOCA 2MT5A 5LKXA 5H1UA 2CSYA 4UP5A 3N9MA 4YBMA 2RI7A 1WEVA 4PPEA 4AUQB 5LKZA 2XOZA 2VPGA 4YBTA 5KH3A 4GNEA 2I50A 2ZETC 2KU3A 5B8DA 2FSAA 3SUBA 3HCSA 4IC3A 2P57A 4S3OB 3FL2A 3ZPVE 2MUMA 2VJFB 2DX8A 3U5OA 4LJNA 1WESA 3DDTA 4WZ2A 3ZTGA 3EB5A 2K16A 4I7DA 1MBMA 3SOXA 1MM2A 3SOUA 4IC2A 1WEOA 4LADB 1ZBDB 2FUIA 2G6QA 2RSDA 3RTRB 2MA6A 3FAOA 5TRBA 1Z60A 2YW8A 1LDKC 4F1PA 4AYCB 2MIQA 2YVRA 1K2FA 2KE1A 2XOYA 1WEEA 2LGGA 4A49A 1JM7B 2G45A 4AYCA 3M7KA 2KKXA 2VJEA 4L58A 2KR4A 1E4UA 4BHWA 2CKLA 3FANA 5KH7A 3HTKC 2KGGA 4LKAA 3C5KA 4MVTA 2YQLA 3DPLR 3HCTA 4QF3A 4A4CA 2B0OE 2VPEA 3O70A 5B77A 3MDBC 2YU4A 2ECTA 1FBVA 2XP0A 5DKAA 4N4FA 5G05B 2YREA 3ZPV1
chains in the Genus database with same CATH topology
4CCGX 1FP0A 2KGIA 5AIUA 2LV9A 5H1TA 2ECNA 2KWOA 5FERA 4MSXA 3T6RA 5LKUA 3I2DA 2MNYA 4WA6A 3L11A 1U6GB 4GNFA 5D1MB 5TDRA 2KWKA 2JMIA 2YQMA 3PHDA 1N87A 1X4IA 5D1LB 2LN0A 3O34A 4X3GA 3ZYQA 3V43A 4TKPB 2YURA 3GL6A 5EYAF 1G25A 2LGLA 2VJEB 1WIMA 2LRIC 2EODA 4GNDA 5FEYA 2MD8C 2JMJA 5H9MA 5B76A 3O37A 4O64A 4AP4A 4F52B 5TDWA 5FB1A 2G43A 2OXQC 2AN6A 3N9NA 1WILA 4R7EA 3T7LA 3GV4A 3N9OA 2IDAA 2F6JA 3RPGB 5B75A 2NAAA 2Y1NA 5DINA 4PTBA 2CT2A 3IHPA 3PURA 2KREA 4V3LC 2K4DA 5G04B 1WEQA 4FO9A 2ECJA 2EA6A 3NG2A 3LQIA 5TBNA 2UZGA 2VP7A 2CKLB 4A0CD 4R2YA 2KWNA 2ECWA 5D1KB 3DQVR 5AITA 2H0DA 3LRQA 2CSZA 3LQHA 2M1RA 1WEPA 2YSJA 3U5PA 2M3HA 2YHOA 1BORA 1F62A 3U5MA 2VJFA 5C11A 3O36A 4N3WA 3KQIA 1WEUA 3ZNIA 5G0FA 2ECVA 3O33A 2QJ0A 2F6NA 4FJCA 4GNGA 4UP0A 2MA5A 4ZQLA 5H1VA 5LCWB 2LGVA 4W4UA 1Z6UA 2M6MA 4XI1A 4AVXA 2YYRA 3KV5A 1T1HA 2MD7B 3EB6A 1WENA 2C2LA 2EGPA 2L43A 4A4BA 2ECIA 4Q6FA 3N9LA 4V3KC 2VPBA 3N9QA 2VNFA 2JMDA 2L75A 4YABA 5TABA 2MNZA 4I7BA 2ECGA 2YUCA 5J3XA 2H0DB 4FIPA 5B78A 3QZVA 1WEWA 4I7CA 2YSMA 2L5UA 3O7AA 2LGKA 1WE9A 4ZUXU 2M85A 4YC9A 3M62A 4B7YC 1JM7A 5LKTA 3U5NA 2D8SA 1RMDA 5KH9A 2E6RA 1LDJB 5I3LA 1WEMA 1X4JA 1Z2QA 2VPDA 1CHCA 1HYJA 4YBSA 4YAXA 4BBQA 4QF2A 3RPGC 2XEUA 3M63A 2QICA 2K1JA 4C9ZA 2KFTA 3KV6A 2KIZA 1VFYA 1WGMA 2KWJA 4UI9B 1VYXA 2LDRA 2LQ6A 3ASLA 1X4UA 3O35A 1JOCA 2Y1MA 1XWHA 2LXPC 2C2VS 4GB0A 3N9PA 2QIZA 3M99A 2KYUA 1V87A 2PNXA 4NN2A 4WZ3B 1VD4A 4P5OB 3SHBA 2L0BA 2HYED 3VK6A 2XB1A 3ZVYA 3LQJA 5C13A 3C6WA 4L7XA 3KNVA 3L1XA 1IYMA 5B79A 2LXHC 2F42A 2Y43A 1MM3A 4B86C 2YHNA 4S3OC 3PUQA 2HDPA 2L80A 3ZVZB 3L1ZB 4LLBA 4YADA 1DVPA 4LK9A 1HYIA 5FB0A 4ZDTA 4R8PK 2E6SA 1WFKA 2YT5A 2JRJA 2PUYA 2FUUA 4CA1A 3HCUA 4WZ0A 3SOWA 3MHHA 2K17A 4FK5A 3MHSA 2BAYA 4YATA 5JG6A 2MT5A 5LKXA 5H1UA 2CSYA 4UP5A 3N9MA 4YBMA 2RI7A 1WEVA 4PPEA 4AUQB 5LKZA 2VPGA 4YBTA 5KH3A 4GNEA 2I50A 2ZETC 2KU3A 5B8DA 2FSAA 3HCSA 4IC3A 4S3OB 3FL2A 3ZPVE 2MUMA 2VJFB 2DX8A 3U5OA 4LJNA 1WESA 4WZ2A 3ZTGA 3EB5A 2K16A 4I7DA 3SOXA 1MM2A 3SOUA 4IC2A 1WEOA 4LADB 1ZBDB 2FUIA 2G6QA 2RSDA 3RTRB 2MA6A 5TRBA 1Z60A 2YW8A 1LDKC 4AYCB 2MIQA 1K2FA 2KE1A 1WEEA 2LGGA 4A49A 1JM7B 2G45A 4AYCA 2VJEA 4L58A 2KR4A 1E4UA 4BHWA 2CKLA 5KH7A 3HTKC 2KGGA 4LKAA 3C5KA 2YQLA 3DPLR 4MVTA 3HCTA 4QF3A 4A4CA 2VPEA 3O70A 5B77A 2YU4A 2ECTA 1FBVA 5DKAA 4N4FA 5G05B 2YREA 3ZPV1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCG X;  1FP0 A;  2KGI A;  5AIU A;  2LV9 A;  5H1T A;  2ECN A;  2KWO A;  5FER A;  4MSX A;  3T6R A;  5LKU A;  3I2D A;  2MNY A;  4WA6 A;  3L11 A;  1U6G B;  4GNF A;  5D1M B;  5TDR A;  2KWK A;  2JMI A;  2YQM A;  3PHD A;  1N87 A;  1X4I A;  5D1L B;  2LN0 A;  3O34 A;  4X3G A;  3ZYQ A;  3V43 A;  4TKP B;  2YUR A;  3GL6 A;  5EYA F;  1G25 A;  2LGL A;  2VJE B;  1WIM A;  2LRI C;  2EOD A;  4GND A;  5FEY A;  2MD8 C;  2JMJ A;  5H9M A;  5B76 A;  3O37 A;  4O64 A;  4AP4 A;  4F52 B;  5TDW A;  5FB1 A;  2G43 A;  2OXQ C;  2AN6 A;  3N9N A;  1WIL A;  4R7E A;  3T7L A;  3GV4 A;  3N9O A;  2IDA A;  2F6J A;  3RPG B;  5B75 A;  2NAA A;  2Y1N A;  5DIN A;  4PTB A;  2CT2 A;  3IHP A;  3PUR A;  2KRE A;  4V3L C;  2K4D A;  5G04 B;  1WEQ A;  4FO9 A;  2ECJ A;  2EA6 A;  3NG2 A;  3LQI A;  5TBN A;  2UZG A;  2VP7 A;  2CKL B;  4A0C D;  4R2Y A;  2KWN A;  2ECW A;  5D1K B;  3DQV R;  5AIT A;  2H0D A;  3LRQ A;  2CSZ A;  3LQH A;  2M1R A;  1WEP A;  2YSJ A;  3U5P A;  2M3H A;  2YHO A;  1BOR A;  1F62 A;  3U5M A;  2VJF A;  5C11 A;  3O36 A;  4N3W A;  3KQI A;  1WEU A;  3ZNI A;  5G0F A;  2ECV A;  3O33 A;  2QJ0 A;  2F6N A;  4FJC A;  4GNG A;  4UP0 A;  2MA5 A;  4ZQL A;  5H1V A;  5LCW B;  2LGV A;  4W4U A;  1Z6U A;  2M6M A;  4XI1 A;  4AVX A;  2YYR A;  3KV5 A;  1T1H A;  2MD7 B;  3EB6 A;  1WEN A;  2C2L A;  2EGP A;  2L43 A;  4A4B A;  2ECI A;  4Q6F A;  3N9L A;  4V3K C;  2VPB A;  3N9Q A;  2VNF A;  2JMD A;  2L75 A;  4YAB A;  5TAB A;  2MNZ A;  4I7B A;  2ECG A;  2YUC A;  5J3X A;  2H0D B;  4FIP A;  5B78 A;  3QZV A;  1WEW A;  4I7C A;  2YSM A;  2L5U A;  3O7A A;  2LGK A;  1WE9 A;  4ZUX U;  2M85 A;  4YC9 A;  3M62 A;  4B7Y C;  1JM7 A;  5LKT A;  3U5N A;  2D8S A;  1RMD A;  5KH9 A;  2E6R A;  1LDJ B;  5I3L A;  1WEM A;  1X4J A;  1Z2Q A;  2VPD A;  1CHC A;  1HYJ A;  4YBS A;  4YAX A;  4BBQ A;  4QF2 A;  3RPG C;  2XEU A;  3M63 A;  2QIC A;  2K1J A;  4C9Z A;  2KFT A;  3KV6 A;  2KIZ A;  1VFY A;  1WGM A;  2KWJ A;  4UI9 B;  1VYX A;  2LDR A;  2LQ6 A;  3ASL A;  1X4U A;  3O35 A;  1JOC A;  2Y1M A;  1XWH A;  2LXP C;  2C2V S;  4GB0 A;  3N9P A;  2QIZ A;  3M99 A;  2KYU A;  1V87 A;  2PNX A;  4NN2 A;  4WZ3 B;  1VD4 A;  4P5O B;  3SHB A;  2L0B A;  2HYE D;  3VK6 A;  2XB1 A;  3ZVY A;  3LQJ A;  5C13 A;  3C6W A;  4L7X A;  3KNV A;  3L1X A;  1IYM A;  5B79 A;  2LXH C;  2F42 A;  2Y43 A;  1MM3 A;  4B86 C;  2YHN A;  4S3O C;  3PUQ A;  2HDP A;  2L80 A;  3ZVZ B;  3L1Z B;  4LLB A;  4YAD A;  1DVP A;  4LK9 A;  1HYI A;  5FB0 A;  4ZDT A;  4R8P K;  2E6S A;  1WFK A;  2YT5 A;  2JRJ A;  2PUY A;  2FUU A;  4CA1 A;  3HCU A;  4WZ0 A;  3SOW A;  3MHH A;  2K17 A;  4FK5 A;  3MHS A;  2BAY A;  4YAT A;  5JG6 A;  2MT5 A;  5LKX A;  5H1U A;  2CSY A;  4UP5 A;  3N9M A;  4YBM A;  2RI7 A;  1WEV A;  4PPE A;  4AUQ B;  5LKZ A;  2VPG A;  4YBT A;  5KH3 A;  4GNE A;  2I50 A;  2ZET C;  2KU3 A;  5B8D A;  2FSA A;  3HCS A;  4IC3 A;  4S3O B;  3FL2 A;  3ZPV E;  2MUM A;  2VJF B;  2DX8 A;  3U5O A;  4LJN A;  1WES A;  4WZ2 A;  3ZTG A;  3EB5 A;  2K16 A;  4I7D A;  3SOX A;  1MM2 A;  3SOU A;  4IC2 A;  1WEO A;  4LAD B;  1ZBD B;  2FUI A;  2G6Q A;  2RSD A;  3RTR B;  2MA6 A;  5TRB A;  1Z60 A;  2YW8 A;  1LDK C;  4AYC B;  2MIQ A;  1K2F A;  2KE1 A;  1WEE A;  2LGG A;  4A49 A;  1JM7 B;  2G45 A;  4AYC A;  2VJE A;  4L58 A;  2KR4 A;  1E4U A;  4BHW A;  2CKL A;  5KH7 A;  3HTK C;  2KGG A;  4LKA A;  3C5K A;  2YQL A;  3DPL R;  4MVT A;  3HCT A;  4QF3 A;  4A4C A;  2VPE A;  3O70 A;  5B77 A;  2YU4 A;  2ECT A;  1FBV A;  5DKA A;  4N4F A;  5G05 B;  2YRE A;  3ZPV 1; 
#chains in the Genus database with same CATH topology
 2L7P A;  4CCG X;  2CRR A;  1FP0 A;  2KGI A;  5AIU A;  2LV9 A;  5H1T A;  2ECN A;  2KWO A;  5FER A;  4MSX A;  3T6R A;  2OWA A;  5LKU A;  3I2D A;  2MNY A;  4WA6 A;  3FM8 C;  3L11 A;  1U6G B;  4GNF A;  5D1M B;  5TDR A;  2KWK A;  2JMI A;  2YQM A;  3PHD A;  3LJU X;  2MKE A;  1N87 A;  1X4I A;  5D1L B;  2LN0 A;  3O34 A;  4X3G A;  3ZYQ A;  3V43 A;  4TKP B;  2YUR A;  3GL6 A;  5EYA F;  1G25 A;  2LGL A;  2VJE B;  1WIM A;  2LRI C;  2EOD A;  4GND A;  5FEY A;  5SVX A;  2MD8 C;  2JMJ A;  5H9M A;  5B76 A;  3O37 A;  2JM3 A;  4O64 A;  4AP4 A;  4F52 B;  5TDW A;  5FB1 A;  2G43 A;  2CSV A;  2OXQ C;  3PLW A;  4OGE A;  2AN6 A;  3N9N A;  1WIL A;  4R7E A;  3T7L A;  3GV4 A;  3N9O A;  2IDA A;  2F6J A;  4OGC A;  3RPG B;  5B75 A;  2D8U A;  2NAA A;  5DIN A;  4PTB A;  2Y1N A;  2CT2 A;  3IHP A;  4V3L C;  2KRE A;  3PUR A;  2K4D A;  5G04 B;  4H9D A;  1WEQ A;  4FO9 A;  2ECJ A;  3H7H A;  2EA6 A;  3NG2 A;  3LQI A;  3KDE C;  3T9K A;  5TBN A;  2UZG A;  2CON A;  2VP7 A;  2CKL B;  4A0C D;  4R2Y A;  2KWN A;  2LAU A;  2ECW A;  5D1K B;  3DQV R;  5AIT A;  2H0D A;  3LRQ A;  2CSZ A;  3LQH A;  2M1R A;  1WEP A;  2YSJ A;  3U5P A;  2M3H A;  2YHO A;  3FEH A;  4Z0O A;  1BOR A;  1F62 A;  3U5M A;  2VJF A;  5C11 A;  3O36 A;  3LDY A;  4N3W A;  3KQI A;  2DJA A;  1WEU A;  2EGM A;  3ZNI A;  5G0F A;  2ECV A;  3O33 A;  2QJ0 A;  2F6N A;  3LVR E;  4FJC A;  4GNG A;  4UP0 A;  2MA5 A;  4ZQL A;  5H1V A;  5LCW B;  2LGV A;  4W4U A;  1Z6U A;  2M6M A;  4XI1 A;  4AVX A;  2YYR A;  3KV5 A;  3E2D A;  1T1H A;  3Q1D A;  2MD7 B;  3EB6 A;  2JUN A;  1WEN A;  2C2L A;  2EGP A;  2L43 A;  4A4B A;  2ECI A;  4Q6F A;  3N9L A;  4V3K C;  2VPB A;  3N9Q A;  2VNF A;  2JMD A;  2L75 A;  4YAB A;  5TAB A;  2MNZ A;  4I7B A;  2ECG A;  2YUC A;  5J3X A;  2H0D B;  4FIP A;  2FFW A;  5B78 A;  5SVI A;  3QZV A;  1WEW A;  4I7C A;  2YSM A;  2L5U A;  3O7A A;  2LGK A;  1WE9 A;  4ZUX U;  2M85 A;  4YC9 A;  3M62 A;  2CRW A;  3JUE A;  4B7Y C;  1JM7 A;  5LKT A;  3U5N A;  5SVI B;  2D8S A;  1RMD A;  5KH9 A;  2E6R A;  2DSM A;  1LDJ B;  4O62 A;  5I3L A;  1WEM A;  1X4J A;  1Z2Q A;  2VPD A;  1CHC A;  2FD4 A;  2RR4 A;  1HYJ A;  4YBS A;  4YAX A;  4BBQ A;  4QF2 A;  3RPG C;  3O47 A;  2XEU A;  3M63 A;  2QIC A;  2K1J A;  4C9Z A;  3FJU B;  2KFT A;  3KV6 A;  2IQJ A;  5K3Q A;  2KIZ A;  3LVQ E;  1VFY A;  1WGM A;  2KWJ A;  4UI9 B;  1VYX A;  2LDR A;  2LQ6 A;  3ASL A;  2EXU A;  1X4U A;  3O35 A;  1JOC A;  2Y1M A;  1XWH A;  2LXP C;  2C2V S;  4GB0 A;  3N9P A;  2QIZ A;  3M99 A;  2KYU A;  1V87 A;  2PNX A;  4NN2 A;  4WZ3 B;  1VD4 A;  3DWD A;  5SVY A;  4P5O B;  4Z0R A;  3SHB A;  2L0B A;  2HYE D;  3VK6 A;  2XB1 A;  4QQ4 A;  3ZVY A;  3LQJ A;  5C13 A;  3C6W A;  4L7X A;  3KNV A;  3L1X A;  1IYM A;  5B79 A;  2LXH C;  2F42 A;  2Y43 A;  1MM3 A;  2YHN A;  4B86 C;  1DCQ A;  4S3O C;  3PUQ A;  2HDP A;  2L80 A;  3ZVZ B;  3L1Z B;  4LLB A;  4YAD A;  1DVP A;  4LK9 A;  1HYI A;  5FB0 A;  4ZDT A;  4R8P K;  2E6S A;  1WFK A;  2YT5 A;  2JRJ A;  2PUY A;  2E61 A;  2FUU A;  2M13 A;  4CA1 A;  2KKY A;  3HCU A;  4WZ0 A;  3SOW A;  3MHH A;  2K17 A;  4FK5 A;  3MHS A;  2BAY A;  4YAT A;  5JG6 A;  2XOC A;  2MT5 A;  5LKX A;  5H1U A;  2CSY A;  4UP5 A;  3N9M A;  4YBM A;  2RI7 A;  1WEV A;  4PPE A;  4AUQ B;  5LKZ A;  2XOZ A;  2VPG A;  4YBT A;  5KH3 A;  4GNE A;  2I50 A;  2ZET C;  2KU3 A;  5B8D A;  2FSA A;  3SUB A;  3HCS A;  4IC3 A;  2P57 A;  4S3O B;  3FL2 A;  3ZPV E;  2MUM A;  2VJF B;  2DX8 A;  3U5O A;  4LJN A;  1WES A;  3DDT A;  4WZ2 A;  3ZTG A;  3EB5 A;  2K16 A;  4I7D A;  1MBM A;  3SOX A;  1MM2 A;  3SOU A;  4IC2 A;  1WEO A;  4LAD B;  1ZBD B;  2FUI A;  2G6Q A;  2RSD A;  3RTR B;  2MA6 A;  3FAO A;  5TRB A;  1Z60 A;  2YW8 A;  1LDK C;  4F1P A;  4AYC B;  2MIQ A;  2YVR A;  1K2F A;  2KE1 A;  2XOY A;  1WEE A;  2LGG A;  4A49 A;  1JM7 B;  2G45 A;  4AYC A;  3M7K A;  2KKX A;  2VJE A;  4L58 A;  2KR4 A;  1E4U A;  4BHW A;  2CKL A;  3FAN A;  5KH7 A;  3HTK C;  2KGG A;  4LKA A;  3C5K A;  4MVT A;  2YQL A;  3DPL R;  3HCT A;  4QF3 A;  4A4C A;  2B0O E;  2VPE A;  3O70 A;  5B77 A;  3MDB C;  2YU4 A;  2ECT A;  1FBV A;  2XP0 A;  5DKA A;  4N4F A;  5G05 B;  2YRE A;  3ZPV 1; 
#chains in the Genus database with same CATH homology
 4CCG X;  1FP0 A;  2KGI A;  5AIU A;  2LV9 A;  5H1T A;  2ECN A;  2KWO A;  5FER A;  4MSX A;  3T6R A;  5LKU A;  3I2D A;  2MNY A;  4WA6 A;  3L11 A;  1U6G B;  4GNF A;  5D1M B;  5TDR A;  2KWK A;  2JMI A;  2YQM A;  3PHD A;  1N87 A;  1X4I A;  5D1L B;  2LN0 A;  3O34 A;  4X3G A;  3ZYQ A;  3V43 A;  4TKP B;  2YUR A;  3GL6 A;  5EYA F;  1G25 A;  2LGL A;  2VJE B;  1WIM A;  2LRI C;  2EOD A;  4GND A;  5FEY A;  2MD8 C;  2JMJ A;  5H9M A;  5B76 A;  3O37 A;  4O64 A;  4AP4 A;  4F52 B;  5TDW A;  5FB1 A;  2G43 A;  2OXQ C;  2AN6 A;  3N9N A;  1WIL A;  4R7E A;  3T7L A;  3GV4 A;  3N9O A;  2IDA A;  2F6J A;  3RPG B;  5B75 A;  2NAA A;  2Y1N A;  5DIN A;  4PTB A;  2CT2 A;  3IHP A;  3PUR A;  2KRE A;  4V3L C;  2K4D A;  5G04 B;  1WEQ A;  4FO9 A;  2ECJ A;  2EA6 A;  3NG2 A;  3LQI A;  5TBN A;  2UZG A;  2VP7 A;  2CKL B;  4A0C D;  4R2Y A;  2KWN A;  2ECW A;  5D1K B;  3DQV R;  5AIT A;  2H0D A;  3LRQ A;  2CSZ A;  3LQH A;  2M1R A;  1WEP A;  2YSJ A;  3U5P A;  2M3H A;  2YHO A;  1BOR A;  1F62 A;  3U5M A;  2VJF A;  5C11 A;  3O36 A;  4N3W A;  3KQI A;  1WEU A;  3ZNI A;  5G0F A;  2ECV A;  3O33 A;  2QJ0 A;  2F6N A;  4FJC A;  4GNG A;  4UP0 A;  2MA5 A;  4ZQL A;  5H1V A;  5LCW B;  2LGV A;  4W4U A;  1Z6U A;  2M6M A;  4XI1 A;  4AVX A;  2YYR A;  3KV5 A;  1T1H A;  2MD7 B;  3EB6 A;  1WEN A;  2C2L A;  2EGP A;  2L43 A;  4A4B A;  2ECI A;  4Q6F A;  3N9L A;  4V3K C;  2VPB A;  3N9Q A;  2VNF A;  2JMD A;  2L75 A;  4YAB A;  5TAB A;  2MNZ A;  4I7B A;  2ECG A;  2YUC A;  5J3X A;  2H0D B;  4FIP A;  5B78 A;  3QZV A;  1WEW A;  4I7C A;  2YSM A;  2L5U A;  3O7A A;  2LGK A;  1WE9 A;  4ZUX U;  2M85 A;  4YC9 A;  3M62 A;  4B7Y C;  1JM7 A;  5LKT A;  3U5N A;  2D8S A;  1RMD A;  5KH9 A;  2E6R A;  1LDJ B;  5I3L A;  1WEM A;  1X4J A;  1Z2Q A;  2VPD A;  1CHC A;  1HYJ A;  4YBS A;  4YAX A;  4BBQ A;  4QF2 A;  3RPG C;  2XEU A;  3M63 A;  2QIC A;  2K1J A;  4C9Z A;  2KFT A;  3KV6 A;  2KIZ A;  1VFY A;  1WGM A;  2KWJ A;  4UI9 B;  1VYX A;  2LDR A;  2LQ6 A;  3ASL A;  1X4U A;  3O35 A;  1JOC A;  2Y1M A;  1XWH A;  2LXP C;  2C2V S;  4GB0 A;  3N9P A;  2QIZ A;  3M99 A;  2KYU A;  1V87 A;  2PNX A;  4NN2 A;  4WZ3 B;  1VD4 A;  4P5O B;  3SHB A;  2L0B A;  2HYE D;  3VK6 A;  2XB1 A;  3ZVY A;  3LQJ A;  5C13 A;  3C6W A;  4L7X A;  3KNV A;  3L1X A;  1IYM A;  5B79 A;  2LXH C;  2F42 A;  2Y43 A;  1MM3 A;  4B86 C;  2YHN A;  4S3O C;  3PUQ A;  2HDP A;  2L80 A;  3ZVZ B;  3L1Z B;  4LLB A;  4YAD A;  1DVP A;  4LK9 A;  1HYI A;  5FB0 A;  4ZDT A;  4R8P K;  2E6S A;  1WFK A;  2YT5 A;  2JRJ A;  2PUY A;  2FUU A;  4CA1 A;  3HCU A;  4WZ0 A;  3SOW A;  3MHH A;  2K17 A;  4FK5 A;  3MHS A;  2BAY A;  4YAT A;  5JG6 A;  2MT5 A;  5LKX A;  5H1U A;  2CSY A;  4UP5 A;  3N9M A;  4YBM A;  2RI7 A;  1WEV A;  4PPE A;  4AUQ B;  5LKZ A;  2VPG A;  4YBT A;  5KH3 A;  4GNE A;  2I50 A;  2ZET C;  2KU3 A;  5B8D A;  2FSA A;  3HCS A;  4IC3 A;  4S3O B;  3FL2 A;  3ZPV E;  2MUM A;  2VJF B;  2DX8 A;  3U5O A;  4LJN A;  1WES A;  4WZ2 A;  3ZTG A;  3EB5 A;  2K16 A;  4I7D A;  3SOX A;  1MM2 A;  3SOU A;  4IC2 A;  1WEO A;  4LAD B;  1ZBD B;  2FUI A;  2G6Q A;  2RSD A;  3RTR B;  2MA6 A;  5TRB A;  1Z60 A;  2YW8 A;  1LDK C;  4AYC B;  2MIQ A;  1K2F A;  2KE1 A;  1WEE A;  2LGG A;  4A49 A;  1JM7 B;  2G45 A;  4AYC A;  2VJE A;  4L58 A;  2KR4 A;  1E4U A;  4BHW A;  2CKL A;  5KH7 A;  3HTK C;  2KGG A;  4LKA A;  3C5K A;  2YQL A;  3DPL R;  4MVT A;  3HCT A;  4QF3 A;  4A4C A;  2VPE A;  3O70 A;  5B77 A;  2YU4 A;  2ECT A;  1FBV A;  5DKA A;  4N4F A;  5G05 B;  2YRE A;  3ZPV 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...