4XI1A

Crystal structure of u-box 2 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris, wild-type
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
b'YTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQQIKVYNFYRKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase LubX
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Ligase
total genus 18
structure length 76
sequence length 76
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4xi1A00
3N9PA 2NAAA 2KGIA 1N87A 2KWNA 3U5OA 4ZDTA 2ECTA 2LGVA 2YSJA 1X4JA 2M85A 5EYAF 3I2DA 2HDPA 2KREA 3LQJA 4AUQB 4L7XA 2LXPC 4W4UA 4R7EA 4S3OC 1DVPA 3KV5A 2ECWA 1G25A 2QICA 3VK6A 2YREA 3SOWA 1Z6UA 1XWHA 1WESA 3SOXA 1WEMA 1BORA 4Q6FA 2JMDA 2F42A 2L80A 3RPGB 1WIMA 2YHNA 2EODA 2G6QA 1V87A 3U5MA 4PTBA 1WEEA 4YC9A 2LV9A 4L58A 5JG6A 2KGGA 2H0DA 4MVTA 2CSYA 4IC2A 4AYCA 1ZBDB 4YABA 2LRIC 3C5KA 2K4DA 1WEVA 5FB1A 5KH7A 4A0CD 2EA6A 5DINA 5FERA 4C9ZA 2JMJA 1WGMA 5TBNA 4A4CA 1WE9A 3M62A 2VPGA 3FL2A 3N9OA 1WEPA 1JOCA 1K2FA 5G05B 1FP0A 2VP7A 4R2YA 1RMDA 2FSAA 3DQVR 3ZPVE 5DKAA 4YBMA 2FUIA 5G0FA 2HYED 1Z60A 3U5NA 4WA6A 5J3XA 3KNVA 2VJEB 3M99A 3L1XA 2MD7B 2K17A 2BAYA 1WEWA 2C2LA 2JMIA 4WZ0A 3LRQA 4R8PK 4YBTA 2YW8A 4V3KC 2KR4A 4YADA 1MM3A 2L5UA 2VJFA 2FUUA 5TABA 2LGLA 5TRBA 2YURA 4FK5A 3LQIA 5D1LB 2PNXA 2VPEA 1MM2A 2LGGA 2KWOA 3L11A 5C11A 4WZ3B 2PUYA 2MT5A 1X4IA 3MHSA 3O70A 1FBVA 4MSXA 1CHCA 4BHWA 2MA6A 2KIZA 3LQHA 4O64A 5TDWA 4A49A 2Y1MA 3O35A 2IDAA 5H1VA 4AP4A 4V3LC 2CKLB 2KWJA 3GL6A 2M6MA 2KU3A 4QF2A 3T7LA 2YYRA 3N9NA 2OXQC 1Z2QA 3HTKC 5FB0A 2QJ0A 3HCSA 2YT5A 5H1UA 2KYUA 2CT2A 2F6JA 4B86C 2KFTA 2QIZA 2CSZA 3O34A 4I7CA 2I50A 2E6SA 4A4BA 2G45A 4NN2A 4GNFA 2YQLA 3M63A 3ZTGA 3EB5A 4LLBA 5H9MA 2L75A 2RSDA 2K1JA 4LJNA 4S3OB 3ZPV1 2YHOA 5B79A 1WEUA 3O36A 2Y43A 1X4UA 4AVXA 5B8DA 5B75A 3ZVZB 4BBQA 1VD4A 4CA1A 1VYXA 2F6NA 5LKXA 3SOUA 1JM7A 2H0DB 2YU4A 5D1MB 4AYCB 5LKUA 4FO9A 2M3HA 3O7AA 5D1KB 2VPBA 5H1TA 3KV6A 4GB0A 1WFKA 2KE1A 2LGKA 5AIUA 5FEYA 2MIQA 3RPGC 4N4FA 5KH3A 2Y1NA 5G04B 1WILA 3O33A 4UP5A 2MD8C 2L43A 2YQMA 2KWKA 3DPLR 1LDJB 3ZYQA 4IC3A 5LCWB 2YUCA 4X3GA 3RTRB 2RI7A 5C13A 2YSMA 4FIPA 3V43A 4B7YC 3O37A 4GNGA 2C2VS 2ECVA 1T1HA 4YATA 5AITA 4FJCA 4UP0A 2DX8A 4UI9B 1F62A 2ECGA 2VJFB 1WEOA 4GNDA 2JRJA 2UZGA 5I3LA 2ECIA 2MNYA 5TDRA 1LDKC 4LKAA 3U5PA 5B77A 5LKZA 2ECJA 4CCGX 2VNFA 3T6RA 2XB1A 2ECNA 2L0BA 1WENA 4P5OB 4YAXA 2LQ6A 3PUQA 3N9LA 3ZNIA 2MNZA 3N9QA 1HYJA 3PURA 5LKTA 2G43A 3ZVYA 4I7DA 2VPDA 3MHHA 2VJEA 5KH9A 2MA5A 4YBSA 3ASLA 4XI1A 3IHPA 2ZETC 2MUMA 2AN6A 5B76A 2K16A 2LN0A 1IYMA 4LK9A 3KQIA 3HCUA 3GV4A 3EB6A 2LDRA 2M1RA 2D8SA 3SHBA 4GNEA 2XEUA 5B78A 4ZQLA 2E6RA 4WZ2A 4N3WA 1WEQA 4ZUXU 4F52B 4TKPB 4I7BA 1U6GB 1VFYA 4LADB 3C6WA 3HCTA 4QF3A 1E4UA 3L1ZB 2CKLA 3N9MA 2LXHC 1JM7B 3QZVA 2EGPA 3PHDA 3NG2A 1HYIA 4PPEA
chains in the Genus database with same CATH superfamily
3N9PA 2NAAA 2KGIA 2MKEA 1N87A 2KWNA 3U5OA 4ZDTA 2ECTA 2LGVA 2YSJA 3LVQE 1X4JA 2M85A 5EYAF 3JUEA 3I2DA 2HDPA 2KREA 3LQJA 4AUQB 4L7XA 2LXPC 4W4UA 4R7EA 4S3OC 1DVPA 3KV5A 2ECWA 1G25A 2QICA 3VK6A 2YREA 3SOWA 1Z6UA 1XWHA 3M7KA 1WESA 3SOXA 1WEMA 1BORA 4Q6FA 2JMDA 2F42A 2L80A 3RPGB 1WIMA 2YHNA 2EODA 2G6QA 4O62A 1V87A 3LVRE 3U5MA 2DJAA 4PTBA 1WEEA 5K3QA 4YC9A 2LV9A 4L58A 5JG6A 2KGGA 2M13A 2H0DA 4MVTA 2CSYA 4IC2A 4AYCA 1ZBDB 4YABA 2LRIC 3C5KA 2XOYA 2K4DA 1WEVA 5FB1A 5KH7A 4A0CD 2EA6A 5DINA 5FERA 3Q1DA 4C9ZA 2JMJA 1WGMA 5TBNA 4A4CA 1WE9A 3M62A 2VPGA 3LDYA 3FL2A 5SVYA 3N9OA 1WEPA 2EGMA 1JOCA 1K2FA 5G05B 2D8UA 1FP0A 2VP7A 4R2YA 1RMDA 2FSAA 3DQVR 3ZPVE 5DKAA 4YBMA 2B0OE 2FUIA 5G0FA 2HYED 1Z60A 3U5NA 4WA6A 5J3XA 3KNVA 2VJEB 2CRWA 3M99A 3L1XA 2MD7B 2K17A 2E61A 2XOZA 2BAYA 1WEWA 2C2LA 2JMIA 4WZ0A 3LRQA 4R8PK 4YBTA 2YW8A 4V3KC 2KR4A 4YADA 1MM3A 2L5UA 2VJFA 2FUUA 5TABA 2LGLA 3FJUB 5TRBA 3DWDA 2YURA 4FK5A 3MDBC 3LQIA 5D1LB 2PNXA 2VPEA 2EXUA 1MM2A 2LGGA 2KWOA 3L11A 5C11A 4WZ3B 2PUYA 5SVIB 2MT5A 1X4IA 3LJUX 3MHSA 3O70A 1FBVA 4MSXA 1CHCA 4BHWA 2MA6A 2KIZA 3LQHA 4O64A 5TDWA 4A49A 4QQ4A 2Y1MA 3O35A 2IDAA 5H1VA 2LAUA 4AP4A 4V3LC 2CKLB 2KWJA 3GL6A 2M6MA 2KU3A 2RR4A 4QF2A 2DSMA 3T7LA 2YYRA 3N9NA 2OXQC 1Z2QA 3HTKC 2CONA 5FB0A 2QJ0A 3HCSA 2YT5A 5H1UA 2KYUA 2CT2A 2F6JA 4B86C 2KFTA 2QIZA 2CSZA 2YVRA 3O34A 4I7CA 2I50A 2E6SA 4A4BA 2G45A 4NN2A 4GNFA 2YQLA 3M63A 3ZTGA 1DCQA 3EB5A 4LLBA 5H9MA 2L75A 2RSDA 1MBMA 2K1JA 4LJNA 2CRRA 2JM3A 4S3OB 3ZPV1 2YHOA 5B79A 1WEUA 3O36A 2FFWA 2Y43A 1X4UA 4AVXA 5B8DA 5B75A 3ZVZB 4BBQA 1VD4A 3FM8C 4CA1A 1VYXA 2F6NA 5LKXA 3SOUA 1JM7A 2XP0A 2H0DB 2YU4A 5SVXA 5D1MB 4AYCB 5LKUA 4FO9A 2M3HA 2FD4A 3O7AA 5D1KB 2VPBA 5H1TA 2KKXA 3KV6A 3FANA 4F1PA 4GB0A 1WFKA 2KE1A 2LGKA 2L7PA 5AIUA 5FEYA 2MIQA 3RPGC 2KKYA 4N4FA 5KH3A 3FAOA 4Z0RA 2Y1NA 2OWAA 2P57A 5G04B 1WILA 3O33A 4UP5A 2MD8C 2L43A 2YQMA 2KWKA 3DPLR 1LDJB 3ZYQA 4IC3A 5LCWB 2YUCA 3E2DA 4X3GA 3RTRB 2RI7A 5C13A 2YSMA 4FIPA 3V43A 4B7YC 3O37A 4GNGA 2C2VS 2ECVA 1T1HA 4YATA 5AITA 4FJCA 2CSVA 4UP0A 2DX8A 3FEHA 4UI9B 1F62A 2ECGA 2VJFB 1WEOA 4GNDA 4H9DA 2JRJA 4OGEA 2UZGA 5I3LA 2ECIA 2MNYA 1LDKC 5TDRA 4LKAA 3U5PA 5B77A 5LKZA 2ECJA 4CCGX 2VNFA 3T6RA 2XB1A 2ECNA 2L0BA 4OGCA 1WENA 4P5OB 4YAXA 2LQ6A 3PUQA 3KDEC 3N9LA 3ZNIA 3PLWA 2MNZA 3T9KA 3N9QA 1HYJA 3PURA 5LKTA 2G43A 2JUNA 3ZVYA 4I7DA 3DDTA 2VPDA 3MHHA 2VJEA 5KH9A 2MA5A 4YBSA 3ASLA 4XI1A 3IHPA 2ZETC 2MUMA 3O47A 2AN6A 5B76A 2K16A 2LN0A 1IYMA 4LK9A 2IQJA 3KQIA 3HCUA 3H7HA 3GV4A 3EB6A 2LDRA 2M1RA 2D8SA 3SHBA 3SUBA 4GNEA 2XEUA 5B78A 4ZQLA 2E6RA 4WZ2A 4Z0OA 4N3WA 1WEQA 4ZUXU 5SVIA 4F52B 4TKPB 4I7BA 1U6GB 1VFYA 4LADB 3C6WA 3HCTA 4QF3A 1E4UA 2XOCA 3L1ZB 2CKLA 3N9MA 2LXHC 1JM7B 3QZVA 2EGPA 3PHDA 3NG2A 1HYIA 4PPEA
chains in the Genus database with same CATH topology
3N9PA 2NAAA 2KGIA 1N87A 2KWNA 3U5OA 4ZDTA 2ECTA 2LGVA 2YSJA 1X4JA 2M85A 5EYAF 3I2DA 2HDPA 2KREA 3LQJA 4AUQB 4L7XA 2LXPC 4W4UA 4R7EA 4S3OC 1DVPA 3KV5A 2ECWA 1G25A 2QICA 3VK6A 2YREA 3SOWA 1Z6UA 1XWHA 1WESA 3SOXA 1WEMA 1BORA 4Q6FA 2JMDA 2F42A 2L80A 3RPGB 1WIMA 2YHNA 2EODA 2G6QA 1V87A 3U5MA 4PTBA 1WEEA 4YC9A 2LV9A 4L58A 5JG6A 2KGGA 2H0DA 4MVTA 2CSYA 4IC2A 4AYCA 1ZBDB 4YABA 2LRIC 3C5KA 2K4DA 1WEVA 5FB1A 5KH7A 4A0CD 2EA6A 5DINA 5FERA 4C9ZA 2JMJA 1WGMA 5TBNA 4A4CA 1WE9A 3M62A 2VPGA 3FL2A 3N9OA 1WEPA 1JOCA 1K2FA 5G05B 1FP0A 2VP7A 4R2YA 1RMDA 2FSAA 3DQVR 3ZPVE 5DKAA 4YBMA 2FUIA 5G0FA 2HYED 1Z60A 3U5NA 4WA6A 5J3XA 3KNVA 2VJEB 3M99A 3L1XA 2MD7B 2K17A 2BAYA 1WEWA 2C2LA 2JMIA 4WZ0A 3LRQA 4R8PK 4YBTA 2YW8A 4V3KC 2KR4A 4YADA 1MM3A 2L5UA 2VJFA 2FUUA 5TABA 2LGLA 5TRBA 2YURA 4FK5A 3LQIA 5D1LB 2PNXA 2VPEA 1MM2A 2LGGA 2KWOA 3L11A 5C11A 4WZ3B 2PUYA 2MT5A 1X4IA 3MHSA 3O70A 1FBVA 4MSXA 1CHCA 4BHWA 2MA6A 2KIZA 3LQHA 4O64A 5TDWA 4A49A 2Y1MA 3O35A 2IDAA 5H1VA 4AP4A 4V3LC 2CKLB 2KWJA 3GL6A 2M6MA 2KU3A 4QF2A 3T7LA 2YYRA 3N9NA 2OXQC 1Z2QA 3HTKC 5FB0A 2QJ0A 3HCSA 2YT5A 5H1UA 2KYUA 2CT2A 2F6JA 4B86C 2KFTA 2QIZA 2CSZA 3O34A 4I7CA 2I50A 2E6SA 4A4BA 2G45A 4NN2A 4GNFA 2YQLA 3M63A 3ZTGA 3EB5A 4LLBA 5H9MA 2L75A 2RSDA 2K1JA 4LJNA 4S3OB 3ZPV1 2YHOA 5B79A 1WEUA 3O36A 2Y43A 1X4UA 4AVXA 5B8DA 5B75A 3ZVZB 4BBQA 1VD4A 4CA1A 1VYXA 2F6NA 5LKXA 3SOUA 1JM7A 2H0DB 2YU4A 5D1MB 4AYCB 5LKUA 4FO9A 2M3HA 3O7AA 5D1KB 2VPBA 5H1TA 3KV6A 4GB0A 1WFKA 2KE1A 2LGKA 5AIUA 5FEYA 2MIQA 3RPGC 4N4FA 5KH3A 2Y1NA 5G04B 1WILA 3O33A 4UP5A 2MD8C 2L43A 2YQMA 2KWKA 3DPLR 1LDJB 3ZYQA 4IC3A 5LCWB 2YUCA 4X3GA 3RTRB 2RI7A 5C13A 2YSMA 4FIPA 3V43A 4B7YC 3O37A 4GNGA 2C2VS 2ECVA 1T1HA 4YATA 5AITA 4FJCA 4UP0A 2DX8A 4UI9B 1F62A 2ECGA 2VJFB 1WEOA 4GNDA 2JRJA 2UZGA 5I3LA 2ECIA 2MNYA 5TDRA 1LDKC 4LKAA 3U5PA 5B77A 5LKZA 2ECJA 4CCGX 2VNFA 3T6RA 2XB1A 2ECNA 2L0BA 1WENA 4P5OB 4YAXA 2LQ6A 3PUQA 3N9LA 3ZNIA 2MNZA 3N9QA 1HYJA 3PURA 5LKTA 2G43A 3ZVYA 4I7DA 2VPDA 3MHHA 2VJEA 5KH9A 2MA5A 4YBSA 3ASLA 4XI1A 3IHPA 2ZETC 2MUMA 2AN6A 5B76A 2K16A 2LN0A 1IYMA 4LK9A 3KQIA 3HCUA 3GV4A 3EB6A 2LDRA 2M1RA 2D8SA 3SHBA 4GNEA 2XEUA 5B78A 4ZQLA 2E6RA 4WZ2A 4N3WA 1WEQA 4ZUXU 4F52B 4TKPB 4I7BA 1U6GB 1VFYA 4LADB 3C6WA 3HCTA 4QF3A 1E4UA 3L1ZB 2CKLA 3N9MA 2LXHC 1JM7B 3QZVA 2EGPA 3PHDA 3NG2A 1HYIA 4PPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9P A;  2NAA A;  2KGI A;  1N87 A;  2KWN A;  3U5O A;  4ZDT A;  2ECT A;  2LGV A;  2YSJ A;  1X4J A;  2M85 A;  5EYA F;  3I2D A;  2HDP A;  2KRE A;  3LQJ A;  4AUQ B;  4L7X A;  2LXP C;  4W4U A;  4R7E A;  4S3O C;  1DVP A;  3KV5 A;  2ECW A;  1G25 A;  2QIC A;  3VK6 A;  2YRE A;  3SOW A;  1Z6U A;  1XWH A;  1WES A;  3SOX A;  1WEM A;  1BOR A;  4Q6F A;  2JMD A;  2F42 A;  2L80 A;  3RPG B;  1WIM A;  2YHN A;  2EOD A;  2G6Q A;  1V87 A;  3U5M A;  4PTB A;  1WEE A;  4YC9 A;  2LV9 A;  4L58 A;  5JG6 A;  2KGG A;  2H0D A;  4MVT A;  2CSY A;  4IC2 A;  4AYC A;  1ZBD B;  4YAB A;  2LRI C;  3C5K A;  2K4D A;  1WEV A;  5FB1 A;  5KH7 A;  4A0C D;  2EA6 A;  5DIN A;  5FER A;  4C9Z A;  2JMJ A;  1WGM A;  5TBN A;  4A4C A;  1WE9 A;  3M62 A;  2VPG A;  3FL2 A;  3N9O A;  1WEP A;  1JOC A;  1K2F A;  5G05 B;  1FP0 A;  2VP7 A;  4R2Y A;  1RMD A;  2FSA A;  3DQV R;  3ZPV E;  5DKA A;  4YBM A;  2FUI A;  5G0F A;  2HYE D;  1Z60 A;  3U5N A;  4WA6 A;  5J3X A;  3KNV A;  2VJE B;  3M99 A;  3L1X A;  2MD7 B;  2K17 A;  2BAY A;  1WEW A;  2C2L A;  2JMI A;  4WZ0 A;  3LRQ A;  4R8P K;  4YBT A;  2YW8 A;  4V3K C;  2KR4 A;  4YAD A;  1MM3 A;  2L5U A;  2VJF A;  2FUU A;  5TAB A;  2LGL A;  5TRB A;  2YUR A;  4FK5 A;  3LQI A;  5D1L B;  2PNX A;  2VPE A;  1MM2 A;  2LGG A;  2KWO A;  3L11 A;  5C11 A;  4WZ3 B;  2PUY A;  2MT5 A;  1X4I A;  3MHS A;  3O70 A;  1FBV A;  4MSX A;  1CHC A;  4BHW A;  2MA6 A;  2KIZ A;  3LQH A;  4O64 A;  5TDW A;  4A49 A;  2Y1M A;  3O35 A;  2IDA A;  5H1V A;  4AP4 A;  4V3L C;  2CKL B;  2KWJ A;  3GL6 A;  2M6M A;  2KU3 A;  4QF2 A;  3T7L A;  2YYR A;  3N9N A;  2OXQ C;  1Z2Q A;  3HTK C;  5FB0 A;  2QJ0 A;  3HCS A;  2YT5 A;  5H1U A;  2KYU A;  2CT2 A;  2F6J A;  4B86 C;  2KFT A;  2QIZ A;  2CSZ A;  3O34 A;  4I7C A;  2I50 A;  2E6S A;  4A4B A;  2G45 A;  4NN2 A;  4GNF A;  2YQL A;  3M63 A;  3ZTG A;  3EB5 A;  4LLB A;  5H9M A;  2L75 A;  2RSD A;  2K1J A;  4LJN A;  4S3O B;  3ZPV 1;  2YHO A;  5B79 A;  1WEU A;  3O36 A;  2Y43 A;  1X4U A;  4AVX A;  5B8D A;  5B75 A;  3ZVZ B;  4BBQ A;  1VD4 A;  4CA1 A;  1VYX A;  2F6N A;  5LKX A;  3SOU A;  1JM7 A;  2H0D B;  2YU4 A;  5D1M B;  4AYC B;  5LKU A;  4FO9 A;  2M3H A;  3O7A A;  5D1K B;  2VPB A;  5H1T A;  3KV6 A;  4GB0 A;  1WFK A;  2KE1 A;  2LGK A;  5AIU A;  5FEY A;  2MIQ A;  3RPG C;  4N4F A;  5KH3 A;  2Y1N A;  5G04 B;  1WIL A;  3O33 A;  4UP5 A;  2MD8 C;  2L43 A;  2YQM A;  2KWK A;  3DPL R;  1LDJ B;  3ZYQ A;  4IC3 A;  5LCW B;  2YUC A;  4X3G A;  3RTR B;  2RI7 A;  5C13 A;  2YSM A;  4FIP A;  3V43 A;  4B7Y C;  3O37 A;  4GNG A;  2C2V S;  2ECV A;  1T1H A;  4YAT A;  5AIT A;  4FJC A;  4UP0 A;  2DX8 A;  4UI9 B;  1F62 A;  2ECG A;  2VJF B;  1WEO A;  4GND A;  2JRJ A;  2UZG A;  5I3L A;  2ECI A;  2MNY A;  5TDR A;  1LDK C;  4LKA A;  3U5P A;  5B77 A;  5LKZ A;  2ECJ A;  4CCG X;  2VNF A;  3T6R A;  2XB1 A;  2ECN A;  2L0B A;  1WEN A;  4P5O B;  4YAX A;  2LQ6 A;  3PUQ A;  3N9L A;  3ZNI A;  2MNZ A;  3N9Q A;  1HYJ A;  3PUR A;  5LKT A;  2G43 A;  3ZVY A;  4I7D A;  2VPD A;  3MHH A;  2VJE A;  5KH9 A;  2MA5 A;  4YBS A;  3ASL A;  4XI1 A;  3IHP A;  2ZET C;  2MUM A;  2AN6 A;  5B76 A;  2K16 A;  2LN0 A;  1IYM A;  4LK9 A;  3KQI A;  3HCU A;  3GV4 A;  3EB6 A;  2LDR A;  2M1R A;  2D8S A;  3SHB A;  4GNE A;  2XEU A;  5B78 A;  4ZQL A;  2E6R A;  4WZ2 A;  4N3W A;  1WEQ A;  4ZUX U;  4F52 B;  4TKP B;  4I7B A;  1U6G B;  1VFY A;  4LAD B;  3C6W A;  3HCT A;  4QF3 A;  1E4U A;  3L1Z B;  2CKL A;  3N9M A;  2LXH C;  1JM7 B;  3QZV A;  2EGP A;  3PHD A;  3NG2 A;  1HYI A;  4PPE A; 
#chains in the Genus database with same CATH topology
 3N9P A;  2NAA A;  2KGI A;  2MKE A;  1N87 A;  2KWN A;  3U5O A;  4ZDT A;  2ECT A;  2LGV A;  2YSJ A;  3LVQ E;  1X4J A;  2M85 A;  5EYA F;  3JUE A;  3I2D A;  2HDP A;  2KRE A;  3LQJ A;  4AUQ B;  4L7X A;  2LXP C;  4W4U A;  4R7E A;  4S3O C;  1DVP A;  3KV5 A;  2ECW A;  1G25 A;  2QIC A;  3VK6 A;  2YRE A;  3SOW A;  1Z6U A;  1XWH A;  3M7K A;  1WES A;  3SOX A;  1WEM A;  1BOR A;  4Q6F A;  2JMD A;  2F42 A;  2L80 A;  3RPG B;  1WIM A;  2YHN A;  2EOD A;  2G6Q A;  4O62 A;  1V87 A;  3LVR E;  3U5M A;  2DJA A;  4PTB A;  1WEE A;  5K3Q A;  4YC9 A;  2LV9 A;  4L58 A;  5JG6 A;  2KGG A;  2M13 A;  2H0D A;  4MVT A;  2CSY A;  4IC2 A;  4AYC A;  1ZBD B;  4YAB A;  2LRI C;  3C5K A;  2XOY A;  2K4D A;  1WEV A;  5FB1 A;  5KH7 A;  4A0C D;  2EA6 A;  5DIN A;  5FER A;  3Q1D A;  4C9Z A;  2JMJ A;  1WGM A;  5TBN A;  4A4C A;  1WE9 A;  3M62 A;  2VPG A;  3LDY A;  3FL2 A;  5SVY A;  3N9O A;  1WEP A;  2EGM A;  1JOC A;  1K2F A;  5G05 B;  2D8U A;  1FP0 A;  2VP7 A;  4R2Y A;  1RMD A;  2FSA A;  3DQV R;  3ZPV E;  5DKA A;  4YBM A;  2B0O E;  2FUI A;  5G0F A;  2HYE D;  1Z60 A;  3U5N A;  4WA6 A;  5J3X A;  3KNV A;  2VJE B;  2CRW A;  3M99 A;  3L1X A;  2MD7 B;  2K17 A;  2E61 A;  2XOZ A;  2BAY A;  1WEW A;  2C2L A;  2JMI A;  4WZ0 A;  3LRQ A;  4R8P K;  4YBT A;  2YW8 A;  4V3K C;  2KR4 A;  4YAD A;  1MM3 A;  2L5U A;  2VJF A;  2FUU A;  5TAB A;  2LGL A;  3FJU B;  5TRB A;  3DWD A;  2YUR A;  4FK5 A;  3MDB C;  3LQI A;  5D1L B;  2PNX A;  2VPE A;  2EXU A;  1MM2 A;  2LGG A;  2KWO A;  3L11 A;  5C11 A;  4WZ3 B;  2PUY A;  5SVI B;  2MT5 A;  1X4I A;  3LJU X;  3MHS A;  3O70 A;  1FBV A;  4MSX A;  1CHC A;  4BHW A;  2MA6 A;  2KIZ A;  3LQH A;  4O64 A;  5TDW A;  4A49 A;  4QQ4 A;  2Y1M A;  3O35 A;  2IDA A;  5H1V A;  2LAU A;  4AP4 A;  4V3L C;  2CKL B;  2KWJ A;  3GL6 A;  2M6M A;  2KU3 A;  2RR4 A;  4QF2 A;  2DSM A;  3T7L A;  2YYR A;  3N9N A;  2OXQ C;  1Z2Q A;  3HTK C;  2CON A;  5FB0 A;  2QJ0 A;  3HCS A;  2YT5 A;  5H1U A;  2KYU A;  2CT2 A;  2F6J A;  4B86 C;  2KFT A;  2QIZ A;  2CSZ A;  2YVR A;  3O34 A;  4I7C A;  2I50 A;  2E6S A;  4A4B A;  2G45 A;  4NN2 A;  4GNF A;  2YQL A;  3M63 A;  3ZTG A;  1DCQ A;  3EB5 A;  4LLB A;  5H9M A;  2L75 A;  2RSD A;  1MBM A;  2K1J A;  4LJN A;  2CRR A;  2JM3 A;  4S3O B;  3ZPV 1;  2YHO A;  5B79 A;  1WEU A;  3O36 A;  2FFW A;  2Y43 A;  1X4U A;  4AVX A;  5B8D A;  5B75 A;  3ZVZ B;  4BBQ A;  1VD4 A;  3FM8 C;  4CA1 A;  1VYX A;  2F6N A;  5LKX A;  3SOU A;  1JM7 A;  2XP0 A;  2H0D B;  2YU4 A;  5SVX A;  5D1M B;  4AYC B;  5LKU A;  4FO9 A;  2M3H A;  2FD4 A;  3O7A A;  5D1K B;  2VPB A;  5H1T A;  2KKX A;  3KV6 A;  3FAN A;  4F1P A;  4GB0 A;  1WFK A;  2KE1 A;  2LGK A;  2L7P A;  5AIU A;  5FEY A;  2MIQ A;  3RPG C;  2KKY A;  4N4F A;  5KH3 A;  3FAO A;  4Z0R A;  2Y1N A;  2OWA A;  2P57 A;  5G04 B;  1WIL A;  3O33 A;  4UP5 A;  2MD8 C;  2L43 A;  2YQM A;  2KWK A;  3DPL R;  1LDJ B;  3ZYQ A;  4IC3 A;  5LCW B;  2YUC A;  3E2D A;  4X3G A;  3RTR B;  2RI7 A;  5C13 A;  2YSM A;  4FIP A;  3V43 A;  4B7Y C;  3O37 A;  4GNG A;  2C2V S;  2ECV A;  1T1H A;  4YAT A;  5AIT A;  4FJC A;  2CSV A;  4UP0 A;  2DX8 A;  3FEH A;  4UI9 B;  1F62 A;  2ECG A;  2VJF B;  1WEO A;  4GND A;  4H9D A;  2JRJ A;  4OGE A;  2UZG A;  5I3L A;  2ECI A;  2MNY A;  1LDK C;  5TDR A;  4LKA A;  3U5P A;  5B77 A;  5LKZ A;  2ECJ A;  4CCG X;  2VNF A;  3T6R A;  2XB1 A;  2ECN A;  2L0B A;  4OGC A;  1WEN A;  4P5O B;  4YAX A;  2LQ6 A;  3PUQ A;  3KDE C;  3N9L A;  3ZNI A;  3PLW A;  2MNZ A;  3T9K A;  3N9Q A;  1HYJ A;  3PUR A;  5LKT A;  2G43 A;  2JUN A;  3ZVY A;  4I7D A;  3DDT A;  2VPD A;  3MHH A;  2VJE A;  5KH9 A;  2MA5 A;  4YBS A;  3ASL A;  4XI1 A;  3IHP A;  2ZET C;  2MUM A;  3O47 A;  2AN6 A;  5B76 A;  2K16 A;  2LN0 A;  1IYM A;  4LK9 A;  2IQJ A;  3KQI A;  3HCU A;  3H7H A;  3GV4 A;  3EB6 A;  2LDR A;  2M1R A;  2D8S A;  3SHB A;  3SUB A;  4GNE A;  2XEU A;  5B78 A;  4ZQL A;  2E6R A;  4WZ2 A;  4Z0O A;  4N3W A;  1WEQ A;  4ZUX U;  5SVI A;  4F52 B;  4TKP B;  4I7B A;  1U6G B;  1VFY A;  4LAD B;  3C6W A;  3HCT A;  4QF3 A;  1E4U A;  2XOC A;  3L1Z B;  2CKL A;  3N9M A;  2LXH C;  1JM7 B;  3QZV A;  2EGP A;  3PHD A;  3NG2 A;  1HYI A;  4PPE A; 
#chains in the Genus database with same CATH homology
 3N9P A;  2NAA A;  2KGI A;  1N87 A;  2KWN A;  3U5O A;  4ZDT A;  2ECT A;  2LGV A;  2YSJ A;  1X4J A;  2M85 A;  5EYA F;  3I2D A;  2HDP A;  2KRE A;  3LQJ A;  4AUQ B;  4L7X A;  2LXP C;  4W4U A;  4R7E A;  4S3O C;  1DVP A;  3KV5 A;  2ECW A;  1G25 A;  2QIC A;  3VK6 A;  2YRE A;  3SOW A;  1Z6U A;  1XWH A;  1WES A;  3SOX A;  1WEM A;  1BOR A;  4Q6F A;  2JMD A;  2F42 A;  2L80 A;  3RPG B;  1WIM A;  2YHN A;  2EOD A;  2G6Q A;  1V87 A;  3U5M A;  4PTB A;  1WEE A;  4YC9 A;  2LV9 A;  4L58 A;  5JG6 A;  2KGG A;  2H0D A;  4MVT A;  2CSY A;  4IC2 A;  4AYC A;  1ZBD B;  4YAB A;  2LRI C;  3C5K A;  2K4D A;  1WEV A;  5FB1 A;  5KH7 A;  4A0C D;  2EA6 A;  5DIN A;  5FER A;  4C9Z A;  2JMJ A;  1WGM A;  5TBN A;  4A4C A;  1WE9 A;  3M62 A;  2VPG A;  3FL2 A;  3N9O A;  1WEP A;  1JOC A;  1K2F A;  5G05 B;  1FP0 A;  2VP7 A;  4R2Y A;  1RMD A;  2FSA A;  3DQV R;  3ZPV E;  5DKA A;  4YBM A;  2FUI A;  5G0F A;  2HYE D;  1Z60 A;  3U5N A;  4WA6 A;  5J3X A;  3KNV A;  2VJE B;  3M99 A;  3L1X A;  2MD7 B;  2K17 A;  2BAY A;  1WEW A;  2C2L A;  2JMI A;  4WZ0 A;  3LRQ A;  4R8P K;  4YBT A;  2YW8 A;  4V3K C;  2KR4 A;  4YAD A;  1MM3 A;  2L5U A;  2VJF A;  2FUU A;  5TAB A;  2LGL A;  5TRB A;  2YUR A;  4FK5 A;  3LQI A;  5D1L B;  2PNX A;  2VPE A;  1MM2 A;  2LGG A;  2KWO A;  3L11 A;  5C11 A;  4WZ3 B;  2PUY A;  2MT5 A;  1X4I A;  3MHS A;  3O70 A;  1FBV A;  4MSX A;  1CHC A;  4BHW A;  2MA6 A;  2KIZ A;  3LQH A;  4O64 A;  5TDW A;  4A49 A;  2Y1M A;  3O35 A;  2IDA A;  5H1V A;  4AP4 A;  4V3L C;  2CKL B;  2KWJ A;  3GL6 A;  2M6M A;  2KU3 A;  4QF2 A;  3T7L A;  2YYR A;  3N9N A;  2OXQ C;  1Z2Q A;  3HTK C;  5FB0 A;  2QJ0 A;  3HCS A;  2YT5 A;  5H1U A;  2KYU A;  2CT2 A;  2F6J A;  4B86 C;  2KFT A;  2QIZ A;  2CSZ A;  3O34 A;  4I7C A;  2I50 A;  2E6S A;  4A4B A;  2G45 A;  4NN2 A;  4GNF A;  2YQL A;  3M63 A;  3ZTG A;  3EB5 A;  4LLB A;  5H9M A;  2L75 A;  2RSD A;  2K1J A;  4LJN A;  4S3O B;  3ZPV 1;  2YHO A;  5B79 A;  1WEU A;  3O36 A;  2Y43 A;  1X4U A;  4AVX A;  5B8D A;  5B75 A;  3ZVZ B;  4BBQ A;  1VD4 A;  4CA1 A;  1VYX A;  2F6N A;  5LKX A;  3SOU A;  1JM7 A;  2H0D B;  2YU4 A;  5D1M B;  4AYC B;  5LKU A;  4FO9 A;  2M3H A;  3O7A A;  5D1K B;  2VPB A;  5H1T A;  3KV6 A;  4GB0 A;  1WFK A;  2KE1 A;  2LGK A;  5AIU A;  5FEY A;  2MIQ A;  3RPG C;  4N4F A;  5KH3 A;  2Y1N A;  5G04 B;  1WIL A;  3O33 A;  4UP5 A;  2MD8 C;  2L43 A;  2YQM A;  2KWK A;  3DPL R;  1LDJ B;  3ZYQ A;  4IC3 A;  5LCW B;  2YUC A;  4X3G A;  3RTR B;  2RI7 A;  5C13 A;  2YSM A;  4FIP A;  3V43 A;  4B7Y C;  3O37 A;  4GNG A;  2C2V S;  2ECV A;  1T1H A;  4YAT A;  5AIT A;  4FJC A;  4UP0 A;  2DX8 A;  4UI9 B;  1F62 A;  2ECG A;  2VJF B;  1WEO A;  4GND A;  2JRJ A;  2UZG A;  5I3L A;  2ECI A;  2MNY A;  5TDR A;  1LDK C;  4LKA A;  3U5P A;  5B77 A;  5LKZ A;  2ECJ A;  4CCG X;  2VNF A;  3T6R A;  2XB1 A;  2ECN A;  2L0B A;  1WEN A;  4P5O B;  4YAX A;  2LQ6 A;  3PUQ A;  3N9L A;  3ZNI A;  2MNZ A;  3N9Q A;  1HYJ A;  3PUR A;  5LKT A;  2G43 A;  3ZVY A;  4I7D A;  2VPD A;  3MHH A;  2VJE A;  5KH9 A;  2MA5 A;  4YBS A;  3ASL A;  4XI1 A;  3IHP A;  2ZET C;  2MUM A;  2AN6 A;  5B76 A;  2K16 A;  2LN0 A;  1IYM A;  4LK9 A;  3KQI A;  3HCU A;  3GV4 A;  3EB6 A;  2LDR A;  2M1R A;  2D8S A;  3SHB A;  4GNE A;  2XEU A;  5B78 A;  4ZQL A;  2E6R A;  4WZ2 A;  4N3W A;  1WEQ A;  4ZUX U;  4F52 B;  4TKP B;  4I7B A;  1U6G B;  1VFY A;  4LAD B;  3C6W A;  3HCT A;  4QF3 A;  1E4U A;  3L1Z B;  2CKL A;  3N9M A;  2LXH C;  1JM7 B;  3QZV A;  2EGP A;  3PHD A;  3NG2 A;  1HYI A;  4PPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...