4XI1A

Crystal structure of u-box 2 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris, wild-type
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
YTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQQIKVYNFYRKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase LubX
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Ligase
total genus 18
structure length 76
sequence length 76
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4xi1A00
5D1MB 2YHNA 4GNGA 2ECWA 3O34A 4YBMA 2LXHC 2KFTA 1MM2A 4FIPA 2KR4A 2H0DA 5FB0A 4V3KC 4IC2A 4WZ0A 5H1VA 4FK5A 5KH9A 2CSZA 2LQ6A 4MSXA 5LKZA 4MVTA 2RSDA 3SOUA 2YT5A 3IHPA 1E4UA 2YQLA 5LKXA 5EYAF 3L11A 5D1KB 4QF2A 2L0BA 1WEUA 3GV4A 1X4IA 4LK9A 3L1XA 4UP5A 2G45A 4LKAA 2AN6A 2KWNA 4YBSA 2M1RA 5AIUA 2KE1A 3ZYQA 2E6RA 4GNEA 1IYMA 2JMDA 2KWKA 4A49A 4PTBA 3M63A 1BORA 3FL2A 5B78A 2LN0A 5D1LB 4Q6FA 3NG2A 2JMIA 2MNYA 4WZ2A 4TKPB 2LXPC 1JM7B 2D8SA 4YABA 4R8PK 2MA5A 1JOCA 2VJEB 2VJFA 4ZUXU 1FBVA 2F6JA 3EB6A 5H1TA 1WENA 3RTRB 1VD4A 2VPDA 5JG6A 5G04B 1WESA 2YYRA 4XI1A 3N9PA 4ZQLA 2YSJA 3ZVYA 3N9LA 2CKLB 3DPLR 2Y1NA 2RI7A 2QJ0A 3EB5A 2MD8C 3ZTGA 1WILA 3KNVA 2M85A 1VYXA 3LQJA 2H0DB 2HDPA 2PUYA 5C11A 2DX8A 2KWOA 1WEMA 1WEVA 3O70A 2PNXA 3RPGB 5TRBA 4S3OB 2L75A 4B86C 1XWHA 3L1ZB 2EA6A 5B79A 5TDWA 3DQVR 1CHCA 2F6NA 4W4UA 2Y1MA 2F42A 3U5MA 2IDAA 5G0FA 2E6SA 5B77A 5I3LA 4GNDA 4QF3A 2G6QA 3U5OA 2LDRA 5H9MA 5B76A 4PPEA 3M62A 3PHDA 1LDKC 3PURA 1WEOA 4B7YC 1X4UA 4I7BA 3LRQA 3O33A 2CT2A 3C6WA 4AP4A 2YU4A 1DVPA 4BBQA 2G43A 4L7XA 2QIZA 1Z2QA 4LLBA 1WFKA 3SOWA 2NAAA 2L80A 2LGVA 2VPEA 4WZ3B 1G25A 4CCGX 2VJFB 3N9NA 4FJCA 3N9OA 4F52B 4C9ZA 4NN2A 4R7EA 4AYCA 3ASLA 5KH7A 2VP7A 2K17A 2MT5A 4YC9A 4A0CD 2LV9A 4LADB 4X3GA 3U5NA 3V43A 2YUCA 2VNFA 2ECVA 2YREA 5H1UA 2L5UA 3PUQA 1WEWA 4YAXA 3O7AA 2C2VS 1WEEA 2EGPA 2I50A 3N9QA 4ZDTA 3LQIA 3O36A 2VPGA 5C13A 3ZNIA 5LKUA 3KV6A 1WE9A 4A4BA 2KREA 5LKTA 1T1HA 1F62A 3MHSA 2XB1A 1HYIA 3U5PA 5FEYA 4GB0A 3SHBA 5B75A 3N9MA 2YSMA 4I7CA 2ECJA 3C5KA 2VPBA 2UZGA 5FB1A 4R2YA 2K4DA 1V87A 2FSAA 2XEUA 1X4JA 1K2FA 2FUIA 2JRJA 4CA1A 5TDRA 1N87A 4O64A 2BAYA 3ZVZB 2CSYA 2Y43A 2ECNA 4YATA 3GL6A 4N4FA 1Z6UA 2ECIA 4YADA 3HTKC 3QZVA 3VK6A 5KH3A 3T6RA 3HCSA 3HCUA 4L58A 4LJNA 1FP0A 4UP0A 2EODA 4UI9B 1WEPA 2M3HA 5DKAA 4N3WA 1WGMA 2LGKA 5B8DA 3SOXA 4WA6A 2FUUA 5TABA 3M99A 2KWJA 3RPGC 5LCWB 1Z60A 3ZPVE 4S3OC 4I7DA 2KIZA 4AYCB 5TBNA 2YW8A 2YHOA 4YBTA 4FO9A 2KGIA 2M6MA 2YQMA 3LQHA 2KYUA 4AUQB 4BHWA 2YURA 2K1JA 4A4CA 2ZETC 3O37A 1LDJB 4V3LC 3KQIA 2JMJA 2MD7B 3ZPV1 2HYED 2MA6A 2K16A 5J3XA 3KV5A 1VFYA 1WEQA 2C2LA 4IC3A 2QICA 5DINA 4GNFA 2LGLA 3MHHA 2KGGA 1HYJA 2MNZA 1JM7A 3O35A 2KU3A 1WIMA 2VJEA 2OXQC 4P5OB 5AITA 2LGGA 1U6GB 3T7LA 5FERA 1MM3A 1ZBDB 5G05B 2LRIC 2MUMA 2L43A 4AVXA 3HCTA 1RMDA 3I2DA 2CKLA 2MIQA 2ECTA 2ECGA
chains in the Genus database with same CATH superfamily
5D1MB 2YHNA 3FM8C 4GNGA 2ECWA 2RR4A 3O34A 4YBMA 2LXHC 2KFTA 1MM2A 2LAUA 4FIPA 2KR4A 2H0DA 5FB0A 4V3KC 4IC2A 4WZ0A 5H1VA 3LVRE 4FK5A 5KH9A 2CSZA 2P57A 2LQ6A 2FFWA 4MSXA 5LKZA 4MVTA 2RSDA 3SOUA 2YT5A 3IHPA 1E4UA 2YQLA 5LKXA 5EYAF 3L11A 5D1KB 4QF2A 2L0BA 1WEUA 3GV4A 1X4IA 4LK9A 3L1XA 4UP5A 2G45A 4LKAA 2AN6A 2KWNA 4YBSA 2M1RA 5AIUA 2KE1A 3ZYQA 2E6RA 4GNEA 3LVQE 1IYMA 2JMDA 2KWKA 4O62A 4A49A 4PTBA 3M63A 3DWDA 1BORA 3FL2A 5B78A 2LN0A 4F1PA 5D1LB 4Q6FA 3NG2A 2CRWA 2JMIA 2MNYA 4WZ2A 4TKPB 4Z0OA 2LXPC 1JM7B 2D8SA 4YABA 4R8PK 2MA5A 1JOCA 2VJEB 2VJFA 4ZUXU 3Q1DA 1FBVA 2F6JA 3EB6A 5H1TA 1WENA 3RTRB 1VD4A 2VPDA 5JG6A 5G04B 1WESA 2YYRA 4H9DA 4XI1A 3N9PA 4ZQLA 2YSJA 3ZVYA 3N9LA 2CKLB 3DPLR 2Y1NA 2RI7A 2QJ0A 3EB5A 2MD8C 3ZTGA 1WILA 3KNVA 2M85A 1VYXA 3LQJA 2H0DB 2HDPA 2PUYA 5C11A 2DX8A 2KWOA 1WEMA 1WEVA 3O70A 2PNXA 3RPGB 5TRBA 4S3OB 2L75A 4B86C 1XWHA 3L1ZB 2EA6A 2CSVA 5TDWA 5B79A 3DQVR 1CHCA 2F6NA 4W4UA 2Y1MA 2F42A 3U5MA 2IDAA 5G0FA 2E6SA 5SVYA 2KKYA 5SVIA 5B77A 5I3LA 4GNDA 4QF3A 2G6QA 3U5OA 2LDRA 5H9MA 5B76A 2MKEA 4PPEA 3M62A 3PHDA 1LDKC 3PURA 1WEOA 4B7YC 1X4UA 4I7BA 3LRQA 3O33A 2CT2A 3C6WA 4AP4A 2YU4A 1DVPA 3DDTA 3M7KA 4BBQA 2G43A 4L7XA 2QIZA 1Z2QA 4LLBA 1WFKA 3O47A 3SOWA 2NAAA 3LDYA 2L80A 2LGVA 2VPEA 4WZ3B 1MBMA 1G25A 3FEHA 4CCGX 3FAOA 2VJFB 3N9NA 4FJCA 3N9OA 2JUNA 3T9KA 2CRRA 5SVXA 4F52B 4C9ZA 4NN2A 4R7EA 4AYCA 3ASLA 3FANA 2VP7A 5KH7A 2K17A 2MT5A 4YC9A 4A0CD 2LV9A 4LADB 4X3GA 3U5NA 3V43A 2D8UA 2YUCA 2VNFA 2YVRA 2CONA 2ECVA 2YREA 5H1UA 2L5UA 3PUQA 1WEWA 4YAXA 3O7AA 2C2VS 1WEEA 2EGPA 2I50A 3N9QA 4ZDTA 3LQIA 3O36A 2VPGA 5C13A 3ZNIA 5LKUA 3KV6A 1WE9A 2IQJA 4A4BA 2KREA 5LKTA 1T1HA 1F62A 4OGEA 3MHSA 2XB1A 3LJUX 1HYIA 4Z0RA 3U5PA 3E2DA 5FEYA 4GB0A 3SHBA 5B75A 3N9MA 2YSMA 4I7CA 3KDEC 3MDBC 2ECJA 3C5KA 2VPBA 2UZGA 2JM3A 5FB1A 4R2YA 5SVIB 2K4DA 1V87A 2FSAA 2EGMA 2XEUA 1X4JA 1K2FA 2FUIA 2JRJA 4CA1A 5TDRA 1N87A 4O64A 2BAYA 3ZVZB 2CSYA 2Y43A 2ECNA 4YATA 3GL6A 4N4FA 1Z6UA 2ECIA 4YADA 3HTKC 3H7HA 3QZVA 4OGCA 3VK6A 5KH3A 3T6RA 3HCSA 3HCUA 4L58A 4LJNA 1FP0A 5K3QA 4UP0A 2EODA 4UI9B 1WEPA 2M3HA 5DKAA 4N3WA 1WGMA 2KKXA 2LGKA 5B8DA 3PLWA 3SOXA 4WA6A 2FUUA 5TABA 3M99A 2KWJA 3RPGC 2L7PA 5LCWB 1Z60A 3ZPVE 4S3OC 4I7DA 2KIZA 4AYCB 5TBNA 2M13A 2YW8A 2YHOA 4YBTA 4FO9A 2KGIA 2M6MA 2YQMA 3LQHA 2KYUA 4AUQB 4BHWA 2YURA 2K1JA 4A4CA 2FD4A 2ZETC 1DCQA 3O37A 4QQ4A 1LDJB 4V3LC 3KQIA 2JMJA 2B0OE 2E61A 3FJUB 2MD7B 3ZPV1 2HYED 2MA6A 2K16A 5J3XA 3KV5A 1VFYA 2XOCA 1WEQA 2XP0A 2C2LA 4IC3A 2QICA 5DINA 4GNFA 2LGLA 3MHHA 2KGGA 1HYJA 2XOZA 2DSMA 2MNZA 1JM7A 3O35A 3SUBA 2KU3A 1WIMA 2VJEA 2OXQC 4P5OB 5AITA 2OWAA 2LGGA 1U6GB 3T7LA 2XOYA 2EXUA 5FERA 1MM3A 3JUEA 1ZBDB 5G05B 2LRIC 2MUMA 2L43A 4AVXA 3HCTA 1RMDA 3I2DA 2CKLA 2DJAA 2MIQA 2ECTA 2ECGA
chains in the Genus database with same CATH topology
5D1MB 2YHNA 4GNGA 2ECWA 3O34A 4YBMA 2LXHC 2KFTA 1MM2A 4FIPA 2KR4A 2H0DA 5FB0A 4V3KC 4IC2A 4WZ0A 5H1VA 4FK5A 5KH9A 2CSZA 2LQ6A 4MSXA 5LKZA 4MVTA 2RSDA 3SOUA 2YT5A 3IHPA 1E4UA 2YQLA 5LKXA 5EYAF 3L11A 5D1KB 4QF2A 2L0BA 1WEUA 3GV4A 1X4IA 4LK9A 3L1XA 4UP5A 2G45A 4LKAA 2AN6A 2KWNA 4YBSA 2M1RA 5AIUA 2KE1A 3ZYQA 2E6RA 4GNEA 1IYMA 2JMDA 2KWKA 4A49A 4PTBA 3M63A 1BORA 3FL2A 5B78A 2LN0A 5D1LB 4Q6FA 3NG2A 2JMIA 2MNYA 4WZ2A 4TKPB 2LXPC 1JM7B 2D8SA 4YABA 4R8PK 2MA5A 1JOCA 2VJEB 2VJFA 4ZUXU 1FBVA 2F6JA 3EB6A 5H1TA 1WENA 3RTRB 1VD4A 2VPDA 5JG6A 5G04B 1WESA 2YYRA 4XI1A 3N9PA 4ZQLA 2YSJA 3ZVYA 3N9LA 2CKLB 3DPLR 2Y1NA 2RI7A 2QJ0A 3EB5A 2MD8C 3ZTGA 1WILA 3KNVA 2M85A 1VYXA 3LQJA 2H0DB 2HDPA 2PUYA 5C11A 2DX8A 2KWOA 1WEMA 1WEVA 3O70A 2PNXA 3RPGB 5TRBA 4S3OB 2L75A 4B86C 1XWHA 3L1ZB 2EA6A 5B79A 5TDWA 3DQVR 1CHCA 2F6NA 4W4UA 2Y1MA 2F42A 3U5MA 2IDAA 5G0FA 2E6SA 5B77A 5I3LA 4GNDA 4QF3A 2G6QA 3U5OA 2LDRA 5H9MA 5B76A 4PPEA 3M62A 3PHDA 1LDKC 3PURA 1WEOA 4B7YC 1X4UA 4I7BA 3LRQA 3O33A 2CT2A 3C6WA 4AP4A 2YU4A 1DVPA 4BBQA 2G43A 4L7XA 2QIZA 1Z2QA 4LLBA 1WFKA 3SOWA 2NAAA 2L80A 2LGVA 2VPEA 4WZ3B 1G25A 4CCGX 2VJFB 3N9NA 4FJCA 3N9OA 4F52B 4C9ZA 4NN2A 4R7EA 4AYCA 3ASLA 5KH7A 2VP7A 2K17A 2MT5A 4YC9A 4A0CD 2LV9A 4LADB 4X3GA 3U5NA 3V43A 2YUCA 2VNFA 2ECVA 2YREA 5H1UA 2L5UA 3PUQA 1WEWA 4YAXA 3O7AA 2C2VS 1WEEA 2EGPA 2I50A 3N9QA 4ZDTA 3LQIA 3O36A 2VPGA 5C13A 3ZNIA 5LKUA 3KV6A 1WE9A 4A4BA 2KREA 5LKTA 1T1HA 1F62A 3MHSA 2XB1A 1HYIA 3U5PA 5FEYA 4GB0A 3SHBA 5B75A 3N9MA 2YSMA 4I7CA 2ECJA 3C5KA 2VPBA 2UZGA 5FB1A 4R2YA 2K4DA 1V87A 2FSAA 2XEUA 1X4JA 1K2FA 2FUIA 2JRJA 4CA1A 5TDRA 1N87A 4O64A 2BAYA 3ZVZB 2CSYA 2Y43A 2ECNA 4YATA 3GL6A 4N4FA 1Z6UA 2ECIA 4YADA 3HTKC 3QZVA 3VK6A 5KH3A 3T6RA 3HCSA 3HCUA 4L58A 4LJNA 1FP0A 4UP0A 2EODA 4UI9B 1WEPA 2M3HA 5DKAA 4N3WA 1WGMA 2LGKA 5B8DA 3SOXA 4WA6A 2FUUA 5TABA 3M99A 2KWJA 3RPGC 5LCWB 1Z60A 3ZPVE 4S3OC 4I7DA 2KIZA 4AYCB 5TBNA 2YW8A 2YHOA 4YBTA 4FO9A 2KGIA 2M6MA 2YQMA 3LQHA 2KYUA 4AUQB 4BHWA 2YURA 2K1JA 4A4CA 2ZETC 3O37A 1LDJB 4V3LC 3KQIA 2JMJA 2MD7B 3ZPV1 2HYED 2MA6A 2K16A 5J3XA 3KV5A 1VFYA 1WEQA 2C2LA 4IC3A 2QICA 5DINA 4GNFA 2LGLA 3MHHA 2KGGA 1HYJA 2MNZA 1JM7A 3O35A 2KU3A 1WIMA 2VJEA 2OXQC 4P5OB 5AITA 2LGGA 1U6GB 3T7LA 5FERA 1MM3A 1ZBDB 5G05B 2LRIC 2MUMA 2L43A 4AVXA 3HCTA 1RMDA 3I2DA 2CKLA 2MIQA 2ECTA 2ECGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1M B;  2YHN A;  4GNG A;  2ECW A;  3O34 A;  4YBM A;  2LXH C;  2KFT A;  1MM2 A;  4FIP A;  2KR4 A;  2H0D A;  5FB0 A;  4V3K C;  4IC2 A;  4WZ0 A;  5H1V A;  4FK5 A;  5KH9 A;  2CSZ A;  2LQ6 A;  4MSX A;  5LKZ A;  4MVT A;  2RSD A;  3SOU A;  2YT5 A;  3IHP A;  1E4U A;  2YQL A;  5LKX A;  5EYA F;  3L11 A;  5D1K B;  4QF2 A;  2L0B A;  1WEU A;  3GV4 A;  1X4I A;  4LK9 A;  3L1X A;  4UP5 A;  2G45 A;  4LKA A;  2AN6 A;  2KWN A;  4YBS A;  2M1R A;  5AIU A;  2KE1 A;  3ZYQ A;  2E6R A;  4GNE A;  1IYM A;  2JMD A;  2KWK A;  4A49 A;  4PTB A;  3M63 A;  1BOR A;  3FL2 A;  5B78 A;  2LN0 A;  5D1L B;  4Q6F A;  3NG2 A;  2JMI A;  2MNY A;  4WZ2 A;  4TKP B;  2LXP C;  1JM7 B;  2D8S A;  4YAB A;  4R8P K;  2MA5 A;  1JOC A;  2VJE B;  2VJF A;  4ZUX U;  1FBV A;  2F6J A;  3EB6 A;  5H1T A;  1WEN A;  3RTR B;  1VD4 A;  2VPD A;  5JG6 A;  5G04 B;  1WES A;  2YYR A;  4XI1 A;  3N9P A;  4ZQL A;  2YSJ A;  3ZVY A;  3N9L A;  2CKL B;  3DPL R;  2Y1N A;  2RI7 A;  2QJ0 A;  3EB5 A;  2MD8 C;  3ZTG A;  1WIL A;  3KNV A;  2M85 A;  1VYX A;  3LQJ A;  2H0D B;  2HDP A;  2PUY A;  5C11 A;  2DX8 A;  2KWO A;  1WEM A;  1WEV A;  3O70 A;  2PNX A;  3RPG B;  5TRB A;  4S3O B;  2L75 A;  4B86 C;  1XWH A;  3L1Z B;  2EA6 A;  5B79 A;  5TDW A;  3DQV R;  1CHC A;  2F6N A;  4W4U A;  2Y1M A;  2F42 A;  3U5M A;  2IDA A;  5G0F A;  2E6S A;  5B77 A;  5I3L A;  4GND A;  4QF3 A;  2G6Q A;  3U5O A;  2LDR A;  5H9M A;  5B76 A;  4PPE A;  3M62 A;  3PHD A;  1LDK C;  3PUR A;  1WEO A;  4B7Y C;  1X4U A;  4I7B A;  3LRQ A;  3O33 A;  2CT2 A;  3C6W A;  4AP4 A;  2YU4 A;  1DVP A;  4BBQ A;  2G43 A;  4L7X A;  2QIZ A;  1Z2Q A;  4LLB A;  1WFK A;  3SOW A;  2NAA A;  2L80 A;  2LGV A;  2VPE A;  4WZ3 B;  1G25 A;  4CCG X;  2VJF B;  3N9N A;  4FJC A;  3N9O A;  4F52 B;  4C9Z A;  4NN2 A;  4R7E A;  4AYC A;  3ASL A;  5KH7 A;  2VP7 A;  2K17 A;  2MT5 A;  4YC9 A;  4A0C D;  2LV9 A;  4LAD B;  4X3G A;  3U5N A;  3V43 A;  2YUC A;  2VNF A;  2ECV A;  2YRE A;  5H1U A;  2L5U A;  3PUQ A;  1WEW A;  4YAX A;  3O7A A;  2C2V S;  1WEE A;  2EGP A;  2I50 A;  3N9Q A;  4ZDT A;  3LQI A;  3O36 A;  2VPG A;  5C13 A;  3ZNI A;  5LKU A;  3KV6 A;  1WE9 A;  4A4B A;  2KRE A;  5LKT A;  1T1H A;  1F62 A;  3MHS A;  2XB1 A;  1HYI A;  3U5P A;  5FEY A;  4GB0 A;  3SHB A;  5B75 A;  3N9M A;  2YSM A;  4I7C A;  2ECJ A;  3C5K A;  2VPB A;  2UZG A;  5FB1 A;  4R2Y A;  2K4D A;  1V87 A;  2FSA A;  2XEU A;  1X4J A;  1K2F A;  2FUI A;  2JRJ A;  4CA1 A;  5TDR A;  1N87 A;  4O64 A;  2BAY A;  3ZVZ B;  2CSY A;  2Y43 A;  2ECN A;  4YAT A;  3GL6 A;  4N4F A;  1Z6U A;  2ECI A;  4YAD A;  3HTK C;  3QZV A;  3VK6 A;  5KH3 A;  3T6R A;  3HCS A;  3HCU A;  4L58 A;  4LJN A;  1FP0 A;  4UP0 A;  2EOD A;  4UI9 B;  1WEP A;  2M3H A;  5DKA A;  4N3W A;  1WGM A;  2LGK A;  5B8D A;  3SOX A;  4WA6 A;  2FUU A;  5TAB A;  3M99 A;  2KWJ A;  3RPG C;  5LCW B;  1Z60 A;  3ZPV E;  4S3O C;  4I7D A;  2KIZ A;  4AYC B;  5TBN A;  2YW8 A;  2YHO A;  4YBT A;  4FO9 A;  2KGI A;  2M6M A;  2YQM A;  3LQH A;  2KYU A;  4AUQ B;  4BHW A;  2YUR A;  2K1J A;  4A4C A;  2ZET C;  3O37 A;  1LDJ B;  4V3L C;  3KQI A;  2JMJ A;  2MD7 B;  3ZPV 1;  2HYE D;  2MA6 A;  2K16 A;  5J3X A;  3KV5 A;  1VFY A;  1WEQ A;  2C2L A;  4IC3 A;  2QIC A;  5DIN A;  4GNF A;  2LGL A;  3MHH A;  2KGG A;  1HYJ A;  2MNZ A;  1JM7 A;  3O35 A;  2KU3 A;  1WIM A;  2VJE A;  2OXQ C;  4P5O B;  5AIT A;  2LGG A;  1U6G B;  3T7L A;  5FER A;  1MM3 A;  1ZBD B;  5G05 B;  2LRI C;  2MUM A;  2L43 A;  4AVX A;  3HCT A;  1RMD A;  3I2D A;  2CKL A;  2MIQ A;  2ECT A;  2ECG A; 
#chains in the Genus database with same CATH topology
 5D1M B;  2YHN A;  3FM8 C;  4GNG A;  2ECW A;  2RR4 A;  3O34 A;  4YBM A;  2LXH C;  2KFT A;  1MM2 A;  2LAU A;  4FIP A;  2KR4 A;  2H0D A;  5FB0 A;  4V3K C;  4IC2 A;  4WZ0 A;  5H1V A;  3LVR E;  4FK5 A;  5KH9 A;  2CSZ A;  2P57 A;  2LQ6 A;  2FFW A;  4MSX A;  5LKZ A;  4MVT A;  2RSD A;  3SOU A;  2YT5 A;  3IHP A;  1E4U A;  2YQL A;  5LKX A;  5EYA F;  3L11 A;  5D1K B;  4QF2 A;  2L0B A;  1WEU A;  3GV4 A;  1X4I A;  4LK9 A;  3L1X A;  4UP5 A;  2G45 A;  4LKA A;  2AN6 A;  2KWN A;  4YBS A;  2M1R A;  5AIU A;  2KE1 A;  3ZYQ A;  2E6R A;  4GNE A;  3LVQ E;  1IYM A;  2JMD A;  2KWK A;  4O62 A;  4A49 A;  4PTB A;  3M63 A;  3DWD A;  1BOR A;  3FL2 A;  5B78 A;  2LN0 A;  4F1P A;  5D1L B;  4Q6F A;  3NG2 A;  2CRW A;  2JMI A;  2MNY A;  4WZ2 A;  4TKP B;  4Z0O A;  2LXP C;  1JM7 B;  2D8S A;  4YAB A;  4R8P K;  2MA5 A;  1JOC A;  2VJE B;  2VJF A;  4ZUX U;  3Q1D A;  1FBV A;  2F6J A;  3EB6 A;  5H1T A;  1WEN A;  3RTR B;  1VD4 A;  2VPD A;  5JG6 A;  5G04 B;  1WES A;  2YYR A;  4H9D A;  4XI1 A;  3N9P A;  4ZQL A;  2YSJ A;  3ZVY A;  3N9L A;  2CKL B;  3DPL R;  2Y1N A;  2RI7 A;  2QJ0 A;  3EB5 A;  2MD8 C;  3ZTG A;  1WIL A;  3KNV A;  2M85 A;  1VYX A;  3LQJ A;  2H0D B;  2HDP A;  2PUY A;  5C11 A;  2DX8 A;  2KWO A;  1WEM A;  1WEV A;  3O70 A;  2PNX A;  3RPG B;  5TRB A;  4S3O B;  2L75 A;  4B86 C;  1XWH A;  3L1Z B;  2EA6 A;  2CSV A;  5TDW A;  5B79 A;  3DQV R;  1CHC A;  2F6N A;  4W4U A;  2Y1M A;  2F42 A;  3U5M A;  2IDA A;  5G0F A;  2E6S A;  5SVY A;  2KKY A;  5SVI A;  5B77 A;  5I3L A;  4GND A;  4QF3 A;  2G6Q A;  3U5O A;  2LDR A;  5H9M A;  5B76 A;  2MKE A;  4PPE A;  3M62 A;  3PHD A;  1LDK C;  3PUR A;  1WEO A;  4B7Y C;  1X4U A;  4I7B A;  3LRQ A;  3O33 A;  2CT2 A;  3C6W A;  4AP4 A;  2YU4 A;  1DVP A;  3DDT A;  3M7K A;  4BBQ A;  2G43 A;  4L7X A;  2QIZ A;  1Z2Q A;  4LLB A;  1WFK A;  3O47 A;  3SOW A;  2NAA A;  3LDY A;  2L80 A;  2LGV A;  2VPE A;  4WZ3 B;  1MBM A;  1G25 A;  3FEH A;  4CCG X;  3FAO A;  2VJF B;  3N9N A;  4FJC A;  3N9O A;  2JUN A;  3T9K A;  2CRR A;  5SVX A;  4F52 B;  4C9Z A;  4NN2 A;  4R7E A;  4AYC A;  3ASL A;  3FAN A;  2VP7 A;  5KH7 A;  2K17 A;  2MT5 A;  4YC9 A;  4A0C D;  2LV9 A;  4LAD B;  4X3G A;  3U5N A;  3V43 A;  2D8U A;  2YUC A;  2VNF A;  2YVR A;  2CON A;  2ECV A;  2YRE A;  5H1U A;  2L5U A;  3PUQ A;  1WEW A;  4YAX A;  3O7A A;  2C2V S;  1WEE A;  2EGP A;  2I50 A;  3N9Q A;  4ZDT A;  3LQI A;  3O36 A;  2VPG A;  5C13 A;  3ZNI A;  5LKU A;  3KV6 A;  1WE9 A;  2IQJ A;  4A4B A;  2KRE A;  5LKT A;  1T1H A;  1F62 A;  4OGE A;  3MHS A;  2XB1 A;  3LJU X;  1HYI A;  4Z0R A;  3U5P A;  3E2D A;  5FEY A;  4GB0 A;  3SHB A;  5B75 A;  3N9M A;  2YSM A;  4I7C A;  3KDE C;  3MDB C;  2ECJ A;  3C5K A;  2VPB A;  2UZG A;  2JM3 A;  5FB1 A;  4R2Y A;  5SVI B;  2K4D A;  1V87 A;  2FSA A;  2EGM A;  2XEU A;  1X4J A;  1K2F A;  2FUI A;  2JRJ A;  4CA1 A;  5TDR A;  1N87 A;  4O64 A;  2BAY A;  3ZVZ B;  2CSY A;  2Y43 A;  2ECN A;  4YAT A;  3GL6 A;  4N4F A;  1Z6U A;  2ECI A;  4YAD A;  3HTK C;  3H7H A;  3QZV A;  4OGC A;  3VK6 A;  5KH3 A;  3T6R A;  3HCS A;  3HCU A;  4L58 A;  4LJN A;  1FP0 A;  5K3Q A;  4UP0 A;  2EOD A;  4UI9 B;  1WEP A;  2M3H A;  5DKA A;  4N3W A;  1WGM A;  2KKX A;  2LGK A;  5B8D A;  3PLW A;  3SOX A;  4WA6 A;  2FUU A;  5TAB A;  3M99 A;  2KWJ A;  3RPG C;  2L7P A;  5LCW B;  1Z60 A;  3ZPV E;  4S3O C;  4I7D A;  2KIZ A;  4AYC B;  5TBN A;  2M13 A;  2YW8 A;  2YHO A;  4YBT A;  4FO9 A;  2KGI A;  2M6M A;  2YQM A;  3LQH A;  2KYU A;  4AUQ B;  4BHW A;  2YUR A;  2K1J A;  4A4C A;  2FD4 A;  2ZET C;  1DCQ A;  3O37 A;  4QQ4 A;  1LDJ B;  4V3L C;  3KQI A;  2JMJ A;  2B0O E;  2E61 A;  3FJU B;  2MD7 B;  3ZPV 1;  2HYE D;  2MA6 A;  2K16 A;  5J3X A;  3KV5 A;  1VFY A;  2XOC A;  1WEQ A;  2XP0 A;  2C2L A;  4IC3 A;  2QIC A;  5DIN A;  4GNF A;  2LGL A;  3MHH A;  2KGG A;  1HYJ A;  2XOZ A;  2DSM A;  2MNZ A;  1JM7 A;  3O35 A;  3SUB A;  2KU3 A;  1WIM A;  2VJE A;  2OXQ C;  4P5O B;  5AIT A;  2OWA A;  2LGG A;  1U6G B;  3T7L A;  2XOY A;  2EXU A;  5FER A;  1MM3 A;  3JUE A;  1ZBD B;  5G05 B;  2LRI C;  2MUM A;  2L43 A;  4AVX A;  3HCT A;  1RMD A;  3I2D A;  2CKL A;  2DJA A;  2MIQ A;  2ECT A;  2ECG A; 
#chains in the Genus database with same CATH homology
 5D1M B;  2YHN A;  4GNG A;  2ECW A;  3O34 A;  4YBM A;  2LXH C;  2KFT A;  1MM2 A;  4FIP A;  2KR4 A;  2H0D A;  5FB0 A;  4V3K C;  4IC2 A;  4WZ0 A;  5H1V A;  4FK5 A;  5KH9 A;  2CSZ A;  2LQ6 A;  4MSX A;  5LKZ A;  4MVT A;  2RSD A;  3SOU A;  2YT5 A;  3IHP A;  1E4U A;  2YQL A;  5LKX A;  5EYA F;  3L11 A;  5D1K B;  4QF2 A;  2L0B A;  1WEU A;  3GV4 A;  1X4I A;  4LK9 A;  3L1X A;  4UP5 A;  2G45 A;  4LKA A;  2AN6 A;  2KWN A;  4YBS A;  2M1R A;  5AIU A;  2KE1 A;  3ZYQ A;  2E6R A;  4GNE A;  1IYM A;  2JMD A;  2KWK A;  4A49 A;  4PTB A;  3M63 A;  1BOR A;  3FL2 A;  5B78 A;  2LN0 A;  5D1L B;  4Q6F A;  3NG2 A;  2JMI A;  2MNY A;  4WZ2 A;  4TKP B;  2LXP C;  1JM7 B;  2D8S A;  4YAB A;  4R8P K;  2MA5 A;  1JOC A;  2VJE B;  2VJF A;  4ZUX U;  1FBV A;  2F6J A;  3EB6 A;  5H1T A;  1WEN A;  3RTR B;  1VD4 A;  2VPD A;  5JG6 A;  5G04 B;  1WES A;  2YYR A;  4XI1 A;  3N9P A;  4ZQL A;  2YSJ A;  3ZVY A;  3N9L A;  2CKL B;  3DPL R;  2Y1N A;  2RI7 A;  2QJ0 A;  3EB5 A;  2MD8 C;  3ZTG A;  1WIL A;  3KNV A;  2M85 A;  1VYX A;  3LQJ A;  2H0D B;  2HDP A;  2PUY A;  5C11 A;  2DX8 A;  2KWO A;  1WEM A;  1WEV A;  3O70 A;  2PNX A;  3RPG B;  5TRB A;  4S3O B;  2L75 A;  4B86 C;  1XWH A;  3L1Z B;  2EA6 A;  5B79 A;  5TDW A;  3DQV R;  1CHC A;  2F6N A;  4W4U A;  2Y1M A;  2F42 A;  3U5M A;  2IDA A;  5G0F A;  2E6S A;  5B77 A;  5I3L A;  4GND A;  4QF3 A;  2G6Q A;  3U5O A;  2LDR A;  5H9M A;  5B76 A;  4PPE A;  3M62 A;  3PHD A;  1LDK C;  3PUR A;  1WEO A;  4B7Y C;  1X4U A;  4I7B A;  3LRQ A;  3O33 A;  2CT2 A;  3C6W A;  4AP4 A;  2YU4 A;  1DVP A;  4BBQ A;  2G43 A;  4L7X A;  2QIZ A;  1Z2Q A;  4LLB A;  1WFK A;  3SOW A;  2NAA A;  2L80 A;  2LGV A;  2VPE A;  4WZ3 B;  1G25 A;  4CCG X;  2VJF B;  3N9N A;  4FJC A;  3N9O A;  4F52 B;  4C9Z A;  4NN2 A;  4R7E A;  4AYC A;  3ASL A;  5KH7 A;  2VP7 A;  2K17 A;  2MT5 A;  4YC9 A;  4A0C D;  2LV9 A;  4LAD B;  4X3G A;  3U5N A;  3V43 A;  2YUC A;  2VNF A;  2ECV A;  2YRE A;  5H1U A;  2L5U A;  3PUQ A;  1WEW A;  4YAX A;  3O7A A;  2C2V S;  1WEE A;  2EGP A;  2I50 A;  3N9Q A;  4ZDT A;  3LQI A;  3O36 A;  2VPG A;  5C13 A;  3ZNI A;  5LKU A;  3KV6 A;  1WE9 A;  4A4B A;  2KRE A;  5LKT A;  1T1H A;  1F62 A;  3MHS A;  2XB1 A;  1HYI A;  3U5P A;  5FEY A;  4GB0 A;  3SHB A;  5B75 A;  3N9M A;  2YSM A;  4I7C A;  2ECJ A;  3C5K A;  2VPB A;  2UZG A;  5FB1 A;  4R2Y A;  2K4D A;  1V87 A;  2FSA A;  2XEU A;  1X4J A;  1K2F A;  2FUI A;  2JRJ A;  4CA1 A;  5TDR A;  1N87 A;  4O64 A;  2BAY A;  3ZVZ B;  2CSY A;  2Y43 A;  2ECN A;  4YAT A;  3GL6 A;  4N4F A;  1Z6U A;  2ECI A;  4YAD A;  3HTK C;  3QZV A;  3VK6 A;  5KH3 A;  3T6R A;  3HCS A;  3HCU A;  4L58 A;  4LJN A;  1FP0 A;  4UP0 A;  2EOD A;  4UI9 B;  1WEP A;  2M3H A;  5DKA A;  4N3W A;  1WGM A;  2LGK A;  5B8D A;  3SOX A;  4WA6 A;  2FUU A;  5TAB A;  3M99 A;  2KWJ A;  3RPG C;  5LCW B;  1Z60 A;  3ZPV E;  4S3O C;  4I7D A;  2KIZ A;  4AYC B;  5TBN A;  2YW8 A;  2YHO A;  4YBT A;  4FO9 A;  2KGI A;  2M6M A;  2YQM A;  3LQH A;  2KYU A;  4AUQ B;  4BHW A;  2YUR A;  2K1J A;  4A4C A;  2ZET C;  3O37 A;  1LDJ B;  4V3L C;  3KQI A;  2JMJ A;  2MD7 B;  3ZPV 1;  2HYE D;  2MA6 A;  2K16 A;  5J3X A;  3KV5 A;  1VFY A;  1WEQ A;  2C2L A;  4IC3 A;  2QIC A;  5DIN A;  4GNF A;  2LGL A;  3MHH A;  2KGG A;  1HYJ A;  2MNZ A;  1JM7 A;  3O35 A;  2KU3 A;  1WIM A;  2VJE A;  2OXQ C;  4P5O B;  5AIT A;  2LGG A;  1U6G B;  3T7L A;  5FER A;  1MM3 A;  1ZBD B;  5G05 B;  2LRI C;  2MUM A;  2L43 A;  4AVX A;  3HCT A;  1RMD A;  3I2D A;  2CKL A;  2MIQ A;  2ECT A;  2ECG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...