4XI1A

Crystal structure of u-box 2 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris, wild-type
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
YTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQQIKVYNFYRKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase LubX
total genus 18
structure length 76
sequence length 76
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4xi1A00
2M6MA 1WGMA 4WZ2A 2E6SA 4IC3A 2E6RA 4FO9A 2M1RA 2VJFB 5LKTA 4YBTA 5TDWA 4R2YA 5KH7A 4LLBA 1WEQA 3O35A 5DINA 4CCGX 2VJEB 5D1MB 3N9PA 2FUUA 2ECGA 5TDRA 2KWJA 2NAAA 2UZGA 5FEYA 3M62A 5LKZA 3T6RA 2HDPA 2CT2A 2PNXA 5G0FA 1K2FA 2VNFA 2LGGA 3U5PA 3MHSA 1WEMA 5DKAA 2YYRA 4I7DA 5D1LB 1LDKC 3M99A 5B78A 2MIQA 5C13A 2ECIA 3N9MA 2YUCA 3LQHA 1Z2QA 2RSDA 2VPDA 4S3OB 3M63A 4FJCA 1DVPA 5TABA 4YATA 2BAYA 2YQLA 4R7EA 3O33A 1MM2A 4AYCA 1CHCA 4N4FA 1WEOA 2K1JA 5B8DA 2G45A 1WEVA 4LJNA 2EODA 5TRBA 2LGLA 2L5UA 2LDRA 4V3KC 3PURA 2MNZA 2XB1A 5FERA 3SOUA 2KGGA 5I3LA 5G04B 2KREA 4UP0A 2XEUA 2ECTA 5LCWB 5LKUA 1IYMA 2EGPA 2HYED 2G43A 1LDJB 4A0CD 1FBVA 4I7BA 3PHDA 2KGIA 2KR4A 2JRJA 2MNYA 2C2VS 1WILA 3KV5A 5KH3A 2H0DA 1XWHA 4PPEA 3O70A 3ASLA 5KH9A 5B75A 5H1TA 5AIUA 2YSJA 2VPGA 3LQJA 4GNDA 3SHBA 2KWKA 2YQMA 3ZPVE 2DX8A 2KWNA 2VJEA 2Y43A 2MT5A 4QF3A 2KYUA 4P5OB 1HYJA 3DQVR 2K17A 2L43A 3DPLR 4AVXA 4BBQA 3I2DA 4BHWA 4GNFA 3ZVYA 1V87A 2L80A 3O7AA 3C6WA 2KIZA 3RPGC 4WZ3B 4AP4A 2KWOA 4L7XA 3GL6A 4ZDTA 4GNEA 4PTBA 3VK6A 3ZTGA 3L11A 5H1UA 2IDAA 1MM3A 1G25A 4TKPB 5H9MA 1Z60A 1WEWA 3U5NA 2Y1NA 5JG6A 5FB1A 5D1KB 2LRIC 2VPEA 4GB0A 1F62A 3ZPV1 3GV4A 2H0DB 5B76A 2CSYA 2ZETC 2ECJA 2F6JA 3L1ZB 3L1XA 1VD4A 3IHPA 2ECVA 5B77A 4QF2A 3HTKC 4ZUXU 5B79A 4LK9A 1X4UA 4YC9A 5G05B 1RMDA 2YW8A 4A4CA 3C5KA 4B7YC 2ECWA 2YHOA 2L0BA 4MVTA 5AITA 2MUMA 2FUIA 2VJFA 4O64A 2YT5A 5H1VA 4IC2A 1BORA 3EB6A 4UI9B 1WENA 3T7LA 2MA6A 4F52B 5TBNA 5J3XA 4UP5A 3N9QA 4WZ0A 3N9NA 5FB0A 3RPGB 1T1HA 2YHNA 3N9LA 1JM7A 2YU4A 2F42A 3O36A 4B86C 4W4UA 3KV6A 3O37A 1N87A 3ZVZB 4YBMA 3ZNIA 2QJ0A 2QIZA 3NG2A 1U6GB 2RI7A 4NN2A 2LXHC 4YABA 3RTRB 1WFKA 3MHHA 4MSXA 4LADB 2MA5A 2LXPC 3O34A 3U5OA 4A4BA 1FP0A 2LQ6A 4X3GA 2AN6A 3HCTA 3LRQA 2G6QA 2YSMA 3KNVA 1VYXA 4N3WA 2VP7A 2D8SA 1E4UA 4FIPA 1JOCA 2YURA 2VPBA 2M85A 2KE1A 3PUQA 2MD7B 4AUQB 3QZVA 4WA6A 3U5MA 3HCSA 4I7CA 1HYIA 1WESA 3LQIA 1WIMA 4AYCB 2JMJA 1WE9A 4YAXA 5LKXA 1VFYA 2ECNA 3SOWA 2QICA 2MD8C 3SOXA 2CKLB 4A49A 2LGKA 1WEPA 4Q6FA 2CKLA 1Z6UA 3KQIA 4S3OC 3FL2A 2I50A 2L75A 2JMIA 2K4DA 3V43A 2CSZA 2LGVA 2K16A 4FK5A 4GNGA 4XI1A 1X4JA 2LV9A 4V3LC 1ZBDB 2F6NA 2LN0A 3ZYQA 4YBSA 3HCUA 2JMDA 4L58A 2KU3A 2FSAA 4R8PK 3EB5A 4CA1A 3N9OA 4C9ZA 1X4IA 2M3HA 4LKAA 4YADA 2Y1MA 1WEEA 2OXQC 1JM7B 2PUYA 5C11A 2EA6A 2C2LA 5EYAF 2YREA 1WEUA 4ZQLA 2KFTA
chains in the Genus database with same CATH superfamily
3FJUB 2M6MA 1WGMA 4WZ2A 2E6SA 4IC3A 2E6RA 4FO9A 2M1RA 2VJFB 5LKTA 4YBTA 5TDWA 4R2YA 5KH7A 4LLBA 1WEQA 3O35A 5DINA 4CCGX 2VJEB 5D1MB 3N9PA 2FUUA 2CRRA 2ECGA 3FEHA 5TDRA 2KWJA 2NAAA 2UZGA 5FEYA 3M62A 5LKZA 3T6RA 2HDPA 2CSVA 2CT2A 2PNXA 5G0FA 1K2FA 2VNFA 2LGGA 3U5PA 2OWAA 3MHSA 1WEMA 5DKAA 2YYRA 4I7DA 5D1LB 1LDKC 3M99A 5B78A 2MIQA 2IQJA 3KDEC 5C13A 2ECIA 3MDBC 3N9MA 2YUCA 3LQHA 1Z2QA 2RSDA 2VPDA 4S3OB 3LJUX 4H9DA 3M63A 4FJCA 1DVPA 5TABA 2CONA 4YATA 2BAYA 2YQLA 4R7EA 3O33A 2FFWA 1MM2A 4AYCA 2JUNA 1CHCA 4N4FA 1WEOA 2K1JA 5B8DA 2JM3A 2G45A 2B0OE 1WEVA 4LJNA 2EODA 5TRBA 2LGLA 2KKXA 2L5UA 2LDRA 4V3KC 2P57A 3PURA 3DDTA 2MNZA 2XB1A 5FERA 3SOUA 2KGGA 2DSMA 5I3LA 5G04B 2KREA 4UP0A 4QQ4A 2XEUA 2ECTA 5LCWB 5LKUA 1IYMA 2EGPA 2HYED 2G43A 1LDJB 3PLWA 4A0CD 1FBVA 4I7BA 3PHDA 2KGIA 2KR4A 2JRJA 4OGCA 2MNYA 2C2VS 1WILA 3KV5A 5KH3A 2H0DA 1XWHA 4PPEA 2DJAA 3O70A 3ASLA 5KH9A 2L7PA 5B75A 5H1TA 5AIUA 2YSJA 2VPGA 3LQJA 4GNDA 3SHBA 2KWKA 3DWDA 2YQMA 3ZPVE 2DX8A 2KWNA 2VJEA 2Y43A 5SVIB 2MT5A 4QF3A 2KYUA 4P5OB 1HYJA 3DQVR 2K17A 2L43A 3FAOA 3DPLR 4AVXA 4F1PA 4BBQA 3I2DA 4BHWA 4GNFA 3ZVYA 1V87A 2L80A 3O7AA 2EGMA 3C6WA 2KIZA 3RPGC 4WZ3B 4AP4A 2KWOA 4L7XA 3GL6A 4ZDTA 4GNEA 4PTBA 3VK6A 1MBMA 3ZTGA 3L11A 5H1UA 2IDAA 1MM3A 1G25A 5SVIA 4TKPB 5H9MA 1Z60A 1WEWA 3U5NA 2Y1NA 5JG6A 5FB1A 5D1KB 2LRIC 2VPEA 4GB0A 1F62A 3ZPV1 3GV4A 2H0DB 5B76A 2CSYA 2ZETC 2ECJA 2F6JA 3L1ZB 3L1XA 1VD4A 3IHPA 2ECVA 5B77A 4QF2A 2XOYA 3HTKC 4ZUXU 5B79A 4LK9A 1X4UA 4YC9A 5G05B 1RMDA 2YW8A 4A4CA 3C5KA 4B7YC 2YVRA 2ECWA 2YHOA 2L0BA 4MVTA 5AITA 2MUMA 2FUIA 2VJFA 4OGEA 2FD4A 4O64A 2YT5A 5H1VA 4IC2A 1BORA 3EB6A 4UI9B 5K3QA 1WENA 3LVQE 3T7LA 2MA6A 4F52B 5TBNA 5J3XA 2KKYA 4UP5A 3N9QA 5FB0A 3N9NA 4WZ0A 3RPGB 1T1HA 2D8UA 2YHNA 3N9LA 1JM7A 1DCQA 2YU4A 2F42A 2MKEA 4O62A 3O36A 4B86C 4W4UA 3KV6A 3FM8C 3O37A 1N87A 3ZVZB 4YBMA 3ZNIA 2QJ0A 2QIZA 3NG2A 4Z0OA 1U6GB 2RI7A 4NN2A 2LXHC 4YABA 2E61A 3RTRB 1WFKA 3MHHA 4MSXA 3O47A 2XOZA 3M7KA 4LADB 2MA5A 2LXPC 3O34A 3U5OA 4A4BA 1FP0A 2LQ6A 4X3GA 2AN6A 3HCTA 3LRQA 3H7HA 2CRWA 2G6QA 2YSMA 3KNVA 1VYXA 4N3WA 2VP7A 2D8SA 1E4UA 4FIPA 1JOCA 2YURA 2VPBA 2M85A 2KE1A 3PUQA 3FANA 2MD7B 4AUQB 3QZVA 4WA6A 3U5MA 3HCSA 4I7CA 1HYIA 1WESA 3LQIA 1WIMA 4AYCB 2JMJA 1WE9A 3SUBA 4YAXA 5LKXA 2LAUA 1VFYA 2RR4A 2ECNA 2M13A 3SOWA 2QICA 2MD8C 3SOXA 2CKLB 4A49A 2LGKA 3T9KA 1WEPA 4Q6FA 2CKLA 1Z6UA 3KQIA 4S3OC 3FL2A 2I50A 2L75A 3Q1DA 2JMIA 2K4DA 3V43A 2CSZA 2LGVA 2K16A 4FK5A 4GNGA 3LVRE 4XI1A 1X4JA 2LV9A 4V3LC 1ZBDB 2F6NA 2LN0A 3ZYQA 4YBSA 3HCUA 5SVXA 2JMDA 4L58A 2KU3A 2FSAA 3LDYA 4R8PK 3EB5A 5SVYA 4CA1A 2XP0A 3N9OA 4C9ZA 2XOCA 1X4IA 3JUEA 2M3HA 3E2DA 4LKAA 4YADA 2Y1MA 1WEEA 2OXQC 1JM7B 2PUYA 5C11A 2EA6A 2C2LA 2EXUA 5EYAF 2YREA 1WEUA 4ZQLA 2KFTA 4Z0RA
chains in the Genus database with same CATH topology
2M6MA 1WGMA 4WZ2A 2E6SA 4IC3A 2E6RA 4FO9A 2M1RA 2VJFB 5LKTA 4YBTA 5TDWA 4R2YA 5KH7A 4LLBA 1WEQA 3O35A 5DINA 4CCGX 2VJEB 5D1MB 3N9PA 2FUUA 2ECGA 5TDRA 2KWJA 2NAAA 2UZGA 5FEYA 3M62A 5LKZA 3T6RA 2HDPA 2CT2A 2PNXA 5G0FA 1K2FA 2VNFA 2LGGA 3U5PA 3MHSA 1WEMA 5DKAA 2YYRA 4I7DA 5D1LB 1LDKC 3M99A 5B78A 2MIQA 5C13A 2ECIA 3N9MA 2YUCA 3LQHA 1Z2QA 2RSDA 2VPDA 4S3OB 3M63A 4FJCA 1DVPA 5TABA 4YATA 2BAYA 2YQLA 4R7EA 3O33A 1MM2A 4AYCA 1CHCA 4N4FA 1WEOA 2K1JA 5B8DA 2G45A 1WEVA 4LJNA 2EODA 5TRBA 2LGLA 2L5UA 2LDRA 4V3KC 3PURA 2MNZA 2XB1A 5FERA 3SOUA 2KGGA 5I3LA 5G04B 2KREA 4UP0A 2XEUA 2ECTA 5LCWB 5LKUA 1IYMA 2EGPA 2HYED 2G43A 1LDJB 4A0CD 1FBVA 4I7BA 3PHDA 2KGIA 2KR4A 2JRJA 2MNYA 2C2VS 1WILA 3KV5A 5KH3A 2H0DA 1XWHA 4PPEA 3O70A 3ASLA 5KH9A 5B75A 5H1TA 5AIUA 2YSJA 2VPGA 3LQJA 4GNDA 3SHBA 2KWKA 2YQMA 3ZPVE 2DX8A 2KWNA 2VJEA 2Y43A 2MT5A 4QF3A 2KYUA 4P5OB 1HYJA 3DQVR 2K17A 2L43A 3DPLR 4AVXA 4BBQA 3I2DA 4BHWA 4GNFA 3ZVYA 1V87A 2L80A 3O7AA 3C6WA 2KIZA 3RPGC 4WZ3B 4AP4A 2KWOA 4L7XA 3GL6A 4ZDTA 4GNEA 4PTBA 3VK6A 3ZTGA 3L11A 5H1UA 2IDAA 1MM3A 1G25A 4TKPB 5H9MA 1Z60A 1WEWA 3U5NA 2Y1NA 5JG6A 5FB1A 5D1KB 2LRIC 2VPEA 4GB0A 1F62A 3ZPV1 3GV4A 2H0DB 5B76A 2CSYA 2ZETC 2ECJA 2F6JA 3L1ZB 3L1XA 1VD4A 3IHPA 2ECVA 5B77A 4QF2A 3HTKC 4ZUXU 5B79A 4LK9A 1X4UA 4YC9A 5G05B 1RMDA 2YW8A 4A4CA 3C5KA 4B7YC 2ECWA 2YHOA 2L0BA 4MVTA 5AITA 2MUMA 2FUIA 2VJFA 4O64A 2YT5A 5H1VA 4IC2A 1BORA 3EB6A 4UI9B 1WENA 3T7LA 2MA6A 4F52B 5TBNA 5J3XA 4UP5A 3N9QA 4WZ0A 3N9NA 5FB0A 3RPGB 1T1HA 2YHNA 3N9LA 1JM7A 2YU4A 2F42A 3O36A 4B86C 4W4UA 3KV6A 3O37A 1N87A 3ZVZB 4YBMA 3ZNIA 2QJ0A 2QIZA 3NG2A 1U6GB 2RI7A 4NN2A 2LXHC 4YABA 3RTRB 1WFKA 3MHHA 4MSXA 4LADB 2MA5A 2LXPC 3O34A 3U5OA 4A4BA 1FP0A 2LQ6A 4X3GA 2AN6A 3HCTA 3LRQA 2G6QA 2YSMA 3KNVA 1VYXA 4N3WA 2VP7A 2D8SA 1E4UA 4FIPA 1JOCA 2YURA 2VPBA 2M85A 2KE1A 3PUQA 2MD7B 4AUQB 3QZVA 4WA6A 3U5MA 3HCSA 4I7CA 1HYIA 1WESA 3LQIA 1WIMA 4AYCB 2JMJA 1WE9A 4YAXA 5LKXA 1VFYA 2ECNA 3SOWA 2QICA 2MD8C 3SOXA 2CKLB 4A49A 2LGKA 1WEPA 4Q6FA 2CKLA 1Z6UA 3KQIA 4S3OC 3FL2A 2I50A 2L75A 2JMIA 2K4DA 3V43A 2CSZA 2LGVA 2K16A 4FK5A 4GNGA 4XI1A 1X4JA 2LV9A 4V3LC 1ZBDB 2F6NA 2LN0A 3ZYQA 4YBSA 3HCUA 2JMDA 4L58A 2KU3A 2FSAA 4R8PK 3EB5A 4CA1A 3N9OA 4C9ZA 1X4IA 2M3HA 4LKAA 4YADA 2Y1MA 1WEEA 2OXQC 1JM7B 2PUYA 5C11A 2EA6A 2C2LA 5EYAF 2YREA 1WEUA 4ZQLA 2KFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6M A;  1WGM A;  4WZ2 A;  2E6S A;  4IC3 A;  2E6R A;  4FO9 A;  2M1R A;  2VJF B;  5LKT A;  4YBT A;  5TDW A;  4R2Y A;  5KH7 A;  4LLB A;  1WEQ A;  3O35 A;  5DIN A;  4CCG X;  2VJE B;  5D1M B;  3N9P A;  2FUU A;  2ECG A;  5TDR A;  2KWJ A;  2NAA A;  2UZG A;  5FEY A;  3M62 A;  5LKZ A;  3T6R A;  2HDP A;  2CT2 A;  2PNX A;  5G0F A;  1K2F A;  2VNF A;  2LGG A;  3U5P A;  3MHS A;  1WEM A;  5DKA A;  2YYR A;  4I7D A;  5D1L B;  1LDK C;  3M99 A;  5B78 A;  2MIQ A;  5C13 A;  2ECI A;  3N9M A;  2YUC A;  3LQH A;  1Z2Q A;  2RSD A;  2VPD A;  4S3O B;  3M63 A;  4FJC A;  1DVP A;  5TAB A;  4YAT A;  2BAY A;  2YQL A;  4R7E A;  3O33 A;  1MM2 A;  4AYC A;  1CHC A;  4N4F A;  1WEO A;  2K1J A;  5B8D A;  2G45 A;  1WEV A;  4LJN A;  2EOD A;  5TRB A;  2LGL A;  2L5U A;  2LDR A;  4V3K C;  3PUR A;  2MNZ A;  2XB1 A;  5FER A;  3SOU A;  2KGG A;  5I3L A;  5G04 B;  2KRE A;  4UP0 A;  2XEU A;  2ECT A;  5LCW B;  5LKU A;  1IYM A;  2EGP A;  2HYE D;  2G43 A;  1LDJ B;  4A0C D;  1FBV A;  4I7B A;  3PHD A;  2KGI A;  2KR4 A;  2JRJ A;  2MNY A;  2C2V S;  1WIL A;  3KV5 A;  5KH3 A;  2H0D A;  1XWH A;  4PPE A;  3O70 A;  3ASL A;  5KH9 A;  5B75 A;  5H1T A;  5AIU A;  2YSJ A;  2VPG A;  3LQJ A;  4GND A;  3SHB A;  2KWK A;  2YQM A;  3ZPV E;  2DX8 A;  2KWN A;  2VJE A;  2Y43 A;  2MT5 A;  4QF3 A;  2KYU A;  4P5O B;  1HYJ A;  3DQV R;  2K17 A;  2L43 A;  3DPL R;  4AVX A;  4BBQ A;  3I2D A;  4BHW A;  4GNF A;  3ZVY A;  1V87 A;  2L80 A;  3O7A A;  3C6W A;  2KIZ A;  3RPG C;  4WZ3 B;  4AP4 A;  2KWO A;  4L7X A;  3GL6 A;  4ZDT A;  4GNE A;  4PTB A;  3VK6 A;  3ZTG A;  3L11 A;  5H1U A;  2IDA A;  1MM3 A;  1G25 A;  4TKP B;  5H9M A;  1Z60 A;  1WEW A;  3U5N A;  2Y1N A;  5JG6 A;  5FB1 A;  5D1K B;  2LRI C;  2VPE A;  4GB0 A;  1F62 A;  3ZPV 1;  3GV4 A;  2H0D B;  5B76 A;  2CSY A;  2ZET C;  2ECJ A;  2F6J A;  3L1Z B;  3L1X A;  1VD4 A;  3IHP A;  2ECV A;  5B77 A;  4QF2 A;  3HTK C;  4ZUX U;  5B79 A;  4LK9 A;  1X4U A;  4YC9 A;  5G05 B;  1RMD A;  2YW8 A;  4A4C A;  3C5K A;  4B7Y C;  2ECW A;  2YHO A;  2L0B A;  4MVT A;  5AIT A;  2MUM A;  2FUI A;  2VJF A;  4O64 A;  2YT5 A;  5H1V A;  4IC2 A;  1BOR A;  3EB6 A;  4UI9 B;  1WEN A;  3T7L A;  2MA6 A;  4F52 B;  5TBN A;  5J3X A;  4UP5 A;  3N9Q A;  4WZ0 A;  3N9N A;  5FB0 A;  3RPG B;  1T1H A;  2YHN A;  3N9L A;  1JM7 A;  2YU4 A;  2F42 A;  3O36 A;  4B86 C;  4W4U A;  3KV6 A;  3O37 A;  1N87 A;  3ZVZ B;  4YBM A;  3ZNI A;  2QJ0 A;  2QIZ A;  3NG2 A;  1U6G B;  2RI7 A;  4NN2 A;  2LXH C;  4YAB A;  3RTR B;  1WFK A;  3MHH A;  4MSX A;  4LAD B;  2MA5 A;  2LXP C;  3O34 A;  3U5O A;  4A4B A;  1FP0 A;  2LQ6 A;  4X3G A;  2AN6 A;  3HCT A;  3LRQ A;  2G6Q A;  2YSM A;  3KNV A;  1VYX A;  4N3W A;  2VP7 A;  2D8S A;  1E4U A;  4FIP A;  1JOC A;  2YUR A;  2VPB A;  2M85 A;  2KE1 A;  3PUQ A;  2MD7 B;  4AUQ B;  3QZV A;  4WA6 A;  3U5M A;  3HCS A;  4I7C A;  1HYI A;  1WES A;  3LQI A;  1WIM A;  4AYC B;  2JMJ A;  1WE9 A;  4YAX A;  5LKX A;  1VFY A;  2ECN A;  3SOW A;  2QIC A;  2MD8 C;  3SOX A;  2CKL B;  4A49 A;  2LGK A;  1WEP A;  4Q6F A;  2CKL A;  1Z6U A;  3KQI A;  4S3O C;  3FL2 A;  2I50 A;  2L75 A;  2JMI A;  2K4D A;  3V43 A;  2CSZ A;  2LGV A;  2K16 A;  4FK5 A;  4GNG A;  4XI1 A;  1X4J A;  2LV9 A;  4V3L C;  1ZBD B;  2F6N A;  2LN0 A;  3ZYQ A;  4YBS A;  3HCU A;  2JMD A;  4L58 A;  2KU3 A;  2FSA A;  4R8P K;  3EB5 A;  4CA1 A;  3N9O A;  4C9Z A;  1X4I A;  2M3H A;  4LKA A;  4YAD A;  2Y1M A;  1WEE A;  2OXQ C;  1JM7 B;  2PUY A;  5C11 A;  2EA6 A;  2C2L A;  5EYA F;  2YRE A;  1WEU A;  4ZQL A;  2KFT A; 
#chains in the Genus database with same CATH topology
 3FJU B;  2M6M A;  1WGM A;  4WZ2 A;  2E6S A;  4IC3 A;  2E6R A;  4FO9 A;  2M1R A;  2VJF B;  5LKT A;  4YBT A;  5TDW A;  4R2Y A;  5KH7 A;  4LLB A;  1WEQ A;  3O35 A;  5DIN A;  4CCG X;  2VJE B;  5D1M B;  3N9P A;  2FUU A;  2CRR A;  2ECG A;  3FEH A;  5TDR A;  2KWJ A;  2NAA A;  2UZG A;  5FEY A;  3M62 A;  5LKZ A;  3T6R A;  2HDP A;  2CSV A;  2CT2 A;  2PNX A;  5G0F A;  1K2F A;  2VNF A;  2LGG A;  3U5P A;  2OWA A;  3MHS A;  1WEM A;  5DKA A;  2YYR A;  4I7D A;  5D1L B;  1LDK C;  3M99 A;  5B78 A;  2MIQ A;  2IQJ A;  3KDE C;  5C13 A;  2ECI A;  3MDB C;  3N9M A;  2YUC A;  3LQH A;  1Z2Q A;  2RSD A;  2VPD A;  4S3O B;  3LJU X;  4H9D A;  3M63 A;  4FJC A;  1DVP A;  5TAB A;  2CON A;  4YAT A;  2BAY A;  2YQL A;  4R7E A;  3O33 A;  2FFW A;  1MM2 A;  4AYC A;  2JUN A;  1CHC A;  4N4F A;  1WEO A;  2K1J A;  5B8D A;  2JM3 A;  2G45 A;  2B0O E;  1WEV A;  4LJN A;  2EOD A;  5TRB A;  2LGL A;  2KKX A;  2L5U A;  2LDR A;  4V3K C;  2P57 A;  3PUR A;  3DDT A;  2MNZ A;  2XB1 A;  5FER A;  3SOU A;  2KGG A;  2DSM A;  5I3L A;  5G04 B;  2KRE A;  4UP0 A;  4QQ4 A;  2XEU A;  2ECT A;  5LCW B;  5LKU A;  1IYM A;  2EGP A;  2HYE D;  2G43 A;  1LDJ B;  3PLW A;  4A0C D;  1FBV A;  4I7B A;  3PHD A;  2KGI A;  2KR4 A;  2JRJ A;  4OGC A;  2MNY A;  2C2V S;  1WIL A;  3KV5 A;  5KH3 A;  2H0D A;  1XWH A;  4PPE A;  2DJA A;  3O70 A;  3ASL A;  5KH9 A;  2L7P A;  5B75 A;  5H1T A;  5AIU A;  2YSJ A;  2VPG A;  3LQJ A;  4GND A;  3SHB A;  2KWK A;  3DWD A;  2YQM A;  3ZPV E;  2DX8 A;  2KWN A;  2VJE A;  2Y43 A;  5SVI B;  2MT5 A;  4QF3 A;  2KYU A;  4P5O B;  1HYJ A;  3DQV R;  2K17 A;  2L43 A;  3FAO A;  3DPL R;  4AVX A;  4F1P A;  4BBQ A;  3I2D A;  4BHW A;  4GNF A;  3ZVY A;  1V87 A;  2L80 A;  3O7A A;  2EGM A;  3C6W A;  2KIZ A;  3RPG C;  4WZ3 B;  4AP4 A;  2KWO A;  4L7X A;  3GL6 A;  4ZDT A;  4GNE A;  4PTB A;  3VK6 A;  1MBM A;  3ZTG A;  3L11 A;  5H1U A;  2IDA A;  1MM3 A;  1G25 A;  5SVI A;  4TKP B;  5H9M A;  1Z60 A;  1WEW A;  3U5N A;  2Y1N A;  5JG6 A;  5FB1 A;  5D1K B;  2LRI C;  2VPE A;  4GB0 A;  1F62 A;  3ZPV 1;  3GV4 A;  2H0D B;  5B76 A;  2CSY A;  2ZET C;  2ECJ A;  2F6J A;  3L1Z B;  3L1X A;  1VD4 A;  3IHP A;  2ECV A;  5B77 A;  4QF2 A;  2XOY A;  3HTK C;  4ZUX U;  5B79 A;  4LK9 A;  1X4U A;  4YC9 A;  5G05 B;  1RMD A;  2YW8 A;  4A4C A;  3C5K A;  4B7Y C;  2YVR A;  2ECW A;  2YHO A;  2L0B A;  4MVT A;  5AIT A;  2MUM A;  2FUI A;  2VJF A;  4OGE A;  2FD4 A;  4O64 A;  2YT5 A;  5H1V A;  4IC2 A;  1BOR A;  3EB6 A;  4UI9 B;  5K3Q A;  1WEN A;  3LVQ E;  3T7L A;  2MA6 A;  4F52 B;  5TBN A;  5J3X A;  2KKY A;  4UP5 A;  3N9Q A;  5FB0 A;  3N9N A;  4WZ0 A;  3RPG B;  1T1H A;  2D8U A;  2YHN A;  3N9L A;  1JM7 A;  1DCQ A;  2YU4 A;  2F42 A;  2MKE A;  4O62 A;  3O36 A;  4B86 C;  4W4U A;  3KV6 A;  3FM8 C;  3O37 A;  1N87 A;  3ZVZ B;  4YBM A;  3ZNI A;  2QJ0 A;  2QIZ A;  3NG2 A;  4Z0O A;  1U6G B;  2RI7 A;  4NN2 A;  2LXH C;  4YAB A;  2E61 A;  3RTR B;  1WFK A;  3MHH A;  4MSX A;  3O47 A;  2XOZ A;  3M7K A;  4LAD B;  2MA5 A;  2LXP C;  3O34 A;  3U5O A;  4A4B A;  1FP0 A;  2LQ6 A;  4X3G A;  2AN6 A;  3HCT A;  3LRQ A;  3H7H A;  2CRW A;  2G6Q A;  2YSM A;  3KNV A;  1VYX A;  4N3W A;  2VP7 A;  2D8S A;  1E4U A;  4FIP A;  1JOC A;  2YUR A;  2VPB A;  2M85 A;  2KE1 A;  3PUQ A;  3FAN A;  2MD7 B;  4AUQ B;  3QZV A;  4WA6 A;  3U5M A;  3HCS A;  4I7C A;  1HYI A;  1WES A;  3LQI A;  1WIM A;  4AYC B;  2JMJ A;  1WE9 A;  3SUB A;  4YAX A;  5LKX A;  2LAU A;  1VFY A;  2RR4 A;  2ECN A;  2M13 A;  3SOW A;  2QIC A;  2MD8 C;  3SOX A;  2CKL B;  4A49 A;  2LGK A;  3T9K A;  1WEP A;  4Q6F A;  2CKL A;  1Z6U A;  3KQI A;  4S3O C;  3FL2 A;  2I50 A;  2L75 A;  3Q1D A;  2JMI A;  2K4D A;  3V43 A;  2CSZ A;  2LGV A;  2K16 A;  4FK5 A;  4GNG A;  3LVR E;  4XI1 A;  1X4J A;  2LV9 A;  4V3L C;  1ZBD B;  2F6N A;  2LN0 A;  3ZYQ A;  4YBS A;  3HCU A;  5SVX A;  2JMD A;  4L58 A;  2KU3 A;  2FSA A;  3LDY A;  4R8P K;  3EB5 A;  5SVY A;  4CA1 A;  2XP0 A;  3N9O A;  4C9Z A;  2XOC A;  1X4I A;  3JUE A;  2M3H A;  3E2D A;  4LKA A;  4YAD A;  2Y1M A;  1WEE A;  2OXQ C;  1JM7 B;  2PUY A;  5C11 A;  2EA6 A;  2C2L A;  2EXU A;  5EYA F;  2YRE A;  1WEU A;  4ZQL A;  2KFT A;  4Z0R A; 
#chains in the Genus database with same CATH homology
 2M6M A;  1WGM A;  4WZ2 A;  2E6S A;  4IC3 A;  2E6R A;  4FO9 A;  2M1R A;  2VJF B;  5LKT A;  4YBT A;  5TDW A;  4R2Y A;  5KH7 A;  4LLB A;  1WEQ A;  3O35 A;  5DIN A;  4CCG X;  2VJE B;  5D1M B;  3N9P A;  2FUU A;  2ECG A;  5TDR A;  2KWJ A;  2NAA A;  2UZG A;  5FEY A;  3M62 A;  5LKZ A;  3T6R A;  2HDP A;  2CT2 A;  2PNX A;  5G0F A;  1K2F A;  2VNF A;  2LGG A;  3U5P A;  3MHS A;  1WEM A;  5DKA A;  2YYR A;  4I7D A;  5D1L B;  1LDK C;  3M99 A;  5B78 A;  2MIQ A;  5C13 A;  2ECI A;  3N9M A;  2YUC A;  3LQH A;  1Z2Q A;  2RSD A;  2VPD A;  4S3O B;  3M63 A;  4FJC A;  1DVP A;  5TAB A;  4YAT A;  2BAY A;  2YQL A;  4R7E A;  3O33 A;  1MM2 A;  4AYC A;  1CHC A;  4N4F A;  1WEO A;  2K1J A;  5B8D A;  2G45 A;  1WEV A;  4LJN A;  2EOD A;  5TRB A;  2LGL A;  2L5U A;  2LDR A;  4V3K C;  3PUR A;  2MNZ A;  2XB1 A;  5FER A;  3SOU A;  2KGG A;  5I3L A;  5G04 B;  2KRE A;  4UP0 A;  2XEU A;  2ECT A;  5LCW B;  5LKU A;  1IYM A;  2EGP A;  2HYE D;  2G43 A;  1LDJ B;  4A0C D;  1FBV A;  4I7B A;  3PHD A;  2KGI A;  2KR4 A;  2JRJ A;  2MNY A;  2C2V S;  1WIL A;  3KV5 A;  5KH3 A;  2H0D A;  1XWH A;  4PPE A;  3O70 A;  3ASL A;  5KH9 A;  5B75 A;  5H1T A;  5AIU A;  2YSJ A;  2VPG A;  3LQJ A;  4GND A;  3SHB A;  2KWK A;  2YQM A;  3ZPV E;  2DX8 A;  2KWN A;  2VJE A;  2Y43 A;  2MT5 A;  4QF3 A;  2KYU A;  4P5O B;  1HYJ A;  3DQV R;  2K17 A;  2L43 A;  3DPL R;  4AVX A;  4BBQ A;  3I2D A;  4BHW A;  4GNF A;  3ZVY A;  1V87 A;  2L80 A;  3O7A A;  3C6W A;  2KIZ A;  3RPG C;  4WZ3 B;  4AP4 A;  2KWO A;  4L7X A;  3GL6 A;  4ZDT A;  4GNE A;  4PTB A;  3VK6 A;  3ZTG A;  3L11 A;  5H1U A;  2IDA A;  1MM3 A;  1G25 A;  4TKP B;  5H9M A;  1Z60 A;  1WEW A;  3U5N A;  2Y1N A;  5JG6 A;  5FB1 A;  5D1K B;  2LRI C;  2VPE A;  4GB0 A;  1F62 A;  3ZPV 1;  3GV4 A;  2H0D B;  5B76 A;  2CSY A;  2ZET C;  2ECJ A;  2F6J A;  3L1Z B;  3L1X A;  1VD4 A;  3IHP A;  2ECV A;  5B77 A;  4QF2 A;  3HTK C;  4ZUX U;  5B79 A;  4LK9 A;  1X4U A;  4YC9 A;  5G05 B;  1RMD A;  2YW8 A;  4A4C A;  3C5K A;  4B7Y C;  2ECW A;  2YHO A;  2L0B A;  4MVT A;  5AIT A;  2MUM A;  2FUI A;  2VJF A;  4O64 A;  2YT5 A;  5H1V A;  4IC2 A;  1BOR A;  3EB6 A;  4UI9 B;  1WEN A;  3T7L A;  2MA6 A;  4F52 B;  5TBN A;  5J3X A;  4UP5 A;  3N9Q A;  4WZ0 A;  3N9N A;  5FB0 A;  3RPG B;  1T1H A;  2YHN A;  3N9L A;  1JM7 A;  2YU4 A;  2F42 A;  3O36 A;  4B86 C;  4W4U A;  3KV6 A;  3O37 A;  1N87 A;  3ZVZ B;  4YBM A;  3ZNI A;  2QJ0 A;  2QIZ A;  3NG2 A;  1U6G B;  2RI7 A;  4NN2 A;  2LXH C;  4YAB A;  3RTR B;  1WFK A;  3MHH A;  4MSX A;  4LAD B;  2MA5 A;  2LXP C;  3O34 A;  3U5O A;  4A4B A;  1FP0 A;  2LQ6 A;  4X3G A;  2AN6 A;  3HCT A;  3LRQ A;  2G6Q A;  2YSM A;  3KNV A;  1VYX A;  4N3W A;  2VP7 A;  2D8S A;  1E4U A;  4FIP A;  1JOC A;  2YUR A;  2VPB A;  2M85 A;  2KE1 A;  3PUQ A;  2MD7 B;  4AUQ B;  3QZV A;  4WA6 A;  3U5M A;  3HCS A;  4I7C A;  1HYI A;  1WES A;  3LQI A;  1WIM A;  4AYC B;  2JMJ A;  1WE9 A;  4YAX A;  5LKX A;  1VFY A;  2ECN A;  3SOW A;  2QIC A;  2MD8 C;  3SOX A;  2CKL B;  4A49 A;  2LGK A;  1WEP A;  4Q6F A;  2CKL A;  1Z6U A;  3KQI A;  4S3O C;  3FL2 A;  2I50 A;  2L75 A;  2JMI A;  2K4D A;  3V43 A;  2CSZ A;  2LGV A;  2K16 A;  4FK5 A;  4GNG A;  4XI1 A;  1X4J A;  2LV9 A;  4V3L C;  1ZBD B;  2F6N A;  2LN0 A;  3ZYQ A;  4YBS A;  3HCU A;  2JMD A;  4L58 A;  2KU3 A;  2FSA A;  4R8P K;  3EB5 A;  4CA1 A;  3N9O A;  4C9Z A;  1X4I A;  2M3H A;  4LKA A;  4YAD A;  2Y1M A;  1WEE A;  2OXQ C;  1JM7 B;  2PUY A;  5C11 A;  2EA6 A;  2C2L A;  5EYA F;  2YRE A;  1WEU A;  4ZQL A;  2KFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...