2JMDA

Solution structure of the ring domain of human traf6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
b'GPLGSKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF receptor-associated factor 6
publication title Structure, interactions, and dynamics of the RING domain from human TRAF6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 63
sequence length 63
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jmdA00
5LKXA 3GL6A 2ECWA 4XI1A 2YYRA 1G25A 4MVTA 5KH3A 4IC2A 3O33A 5DINA 5LKTA 2YQMA 4FK5A 2KWKA 3N9QA 5AIUA 4V3KC 4I7DA 4WZ2A 3T7LA 2DX8A 2MNZA 2EA6A 4B86C 2H0DA 2MUMA 4PPEA 3KNVA 3O36A 4YATA 5TRBA 1Z2QA 4N3WA 1HYIA 2ECIA 2ECTA 2LGKA 4YADA 4FIPA 2LDRA 3N9NA 4MSXA 2VNFA 2YU4A 5G04B 2JRJA 2YW8A 4ZQLA 3DQVR 2JMDA 1RMDA 4GNFA 5KH9A 3U5PA 5H1TA 2MA5A 3QZVA 2YSJA 4BBQA 5TBNA 1IYMA 5B77A 1V87A 3ZVYA 4A4BA 5JG6A 2VPGA 2KWJA 2YREA 3C6WA 2M3HA 1X4JA 2L0BA 2LXHC 1JM7A 2OXQC 2KGGA 2Y43A 1WEQA 2FUUA 3PUQA 3M62A 1FBVA 2KWNA 5B76A 1JOCA 4ZDTA 3L1XA 5FB1A 2KE1A 5B78A 1VFYA 5D1LB 3FL2A 1WENA 1WEWA 3EB6A 3U5NA 2C2LA 2C2VS 5FERA 4A0CD 2XEUA 2LN0A 5DKAA 2YHNA 2K4DA 2VPBA 4L7XA 2IDAA 4TKPB 3LQIA 3ZTGA 2YUCA 5EYAF 5TDWA 4CA1A 3LQHA 5H1UA 2LXPC 1XWHA 2L5UA 2CKLA 4GNDA 4B7YC 1WEUA 3N9PA 4CCGX 2F6JA 4AYCA 4LLBA 4GB0A 2RSDA 2E6SA 2LGLA 2F42A 2YHOA 4BHWA 1BORA 2KYUA 1X4IA 4GNEA 4R2YA 5LKUA 3O7AA 4Q6FA 3HCUA 4YBTA 2PUYA 2RI7A 2K16A 4YBMA 2KIZA 2JMJA 3ZNIA 5KH7A 2PNXA 2H0DB 2KREA 2VJEA 3ZVZB 2LRIC 4W4UA 2Y1MA 2VP7A 1DVPA 3SOUA 5C11A 2KWOA 5LCWB 3O35A 2KGIA 1VYXA 2BAYA 1WFKA 2K1JA 1WGMA 2Y1NA 4YBSA 4QF3A 3KV5A 3N9OA 4LJNA 3N9LA 4UI9B 2L43A 2KU3A 2QJ0A 3N9MA 1N87A 2ECVA 2CSYA 1U6GB 3VK6A 2VJFA 2D8SA 3SOWA 5B8DA 3MHHA 1T1HA 3L11A 3HCTA 4R8PK 3U5MA 2L80A 4WA6A 2JMIA 3HTKC 2G45A 1JM7B 4FO9A 4AP4A 2ECNA 2FSAA 3EB5A 2KR4A 2VPEA 4P5OB 2XB1A 5G05B 2YQLA 3T6RA 4FJCA 5D1KB 3LQJA 2AN6A 5TDRA 2MD7B 3V43A 1Z6UA 5G0FA 5B75A 4ZUXU 2LV9A 1HYJA 5J3XA 3DPLR 4QF2A 4UP5A 2F6NA 4V3LC 1WEPA 3PHDA 4I7CA 2I50A 1LDKC 4PTBA 2EODA 4YC9A 2NAAA 5LKZA 2YT5A 5FB0A 5B79A 1K2FA 3ZYQA 2QICA 2G6QA 3O34A 4O64A 1FP0A 2QIZA 2MT5A 2CKLB 3L1ZB 3ZPVE 4X3GA 2UZGA 3SOXA 4I7BA 1X4UA 4YAXA 2LGGA 4LKAA 2HDPA 4AYCB 4LADB 5C13A 2YURA 3PURA 5AITA 3O37A 2K17A 1ZBDB 2FUIA 2M1RA 2G43A 3SHBA 1WEVA 2HYED 1WESA 2VPDA 3MHSA 4F52B 1Z60A 1WILA 2CT2A 4GNGA 3RPGB 4S3OB 3ZPV1 3M99A 4NN2A 2VJEB 1WE9A 3HCSA 4WZ0A 2YSMA 3O70A 2M6MA 1LDJB 5I3LA 5H1VA 4L58A 3IHPA 4IC3A 4AUQB 2MD8C 5D1MB 3M63A 3RPGC 4S3OC 2L75A 3GV4A 2EGPA 4UP0A 3ASLA 2VJFB 4AVXA 1WEEA 2ECJA 1CHCA 1F62A 3NG2A 2M85A 3KV6A 3KQIA 3LRQA 3U5OA 1VD4A 1MM2A 2KFTA 2CSZA 4LK9A 5FEYA 4R7EA 3I2DA 4WZ3B 1WEOA 2LQ6A 4A49A 2MA6A 2ZETC 2MNYA 3RTRB 4YABA 4A4CA 2MIQA 5TABA 3C5KA 1E4UA 1WEMA 4N4FA 1WIMA 2E6RA 2ECGA 5H9MA 4C9ZA 1MM3A 2LGVA
chains in the Genus database with same CATH superfamily
5LKXA 3GL6A 2ECWA 4XI1A 2FFWA 4Z0RA 2YYRA 1G25A 4MVTA 5KH3A 4IC2A 3O33A 5DINA 5LKTA 2YQMA 4FK5A 2KWKA 3N9QA 5AIUA 4V3KC 3M7KA 4I7DA 4WZ2A 3T7LA 2DX8A 2MNZA 2EA6A 4B86C 2H0DA 2MUMA 4PPEA 3KNVA 3O36A 3PLWA 4YATA 3Q1DA 5SVIA 5TRBA 1MBMA 1Z2QA 4N3WA 1HYIA 2YVRA 2ECIA 2P57A 2ECTA 2LGKA 4YADA 4FIPA 2LDRA 3N9NA 4MSXA 2VNFA 2YU4A 5G04B 5K3QA 2JRJA 2YW8A 4ZQLA 3DQVR 2E61A 3LDYA 2JMDA 3FJUB 1RMDA 4GNFA 5KH9A 3U5PA 5H1TA 2DJAA 2MA5A 3FEHA 3QZVA 2YSJA 4BBQA 5TBNA 1IYMA 5B77A 1V87A 3ZVYA 2EGMA 4A4BA 5JG6A 2VPGA 2KWJA 2YREA 3C6WA 2M3HA 1X4JA 2L0BA 2LXHC 1JM7A 2OXQC 2KGGA 2Y43A 1WEQA 2FUUA 3PUQA 3M62A 1FBVA 2KWNA 3DDTA 2KKYA 5B76A 1JOCA 4ZDTA 3L1XA 5FB1A 2KE1A 2CSVA 3MDBC 5B78A 1VFYA 5D1LB 3FL2A 3FM8C 1WENA 3SUBA 2FD4A 1WEWA 3EB6A 3U5NA 2C2LA 2C2VS 3T9KA 5FERA 4OGCA 4A0CD 2XEUA 2LN0A 5DKAA 4O62A 2YHNA 2K4DA 2VPBA 2M13A 4L7XA 2IDAA 4TKPB 3LQIA 3O47A 3ZTGA 2YUCA 5EYAF 5TDWA 4CA1A 3LQHA 3KDEC 3LVQE 5H1UA 2LXPC 1XWHA 2L5UA 2CKLA 4GNDA 4B7YC 1WEUA 3N9PA 4CCGX 2F6JA 4AYCA 4LLBA 4GB0A 2RSDA 2E6SA 2LGLA 2F42A 2YHOA 4BHWA 1BORA 4H9DA 2KYUA 1X4IA 4R2YA 2JUNA 4GNEA 5LKUA 3O7AA 4Q6FA 3HCUA 4YBTA 2PUYA 2RI7A 2K16A 2DSMA 4YBMA 2KIZA 2JMJA 3ZNIA 5KH7A 4F1PA 2PNXA 2H0DB 2KREA 2VJEA 3ZVZB 2LRIC 4W4UA 2Y1MA 5SVIB 2VP7A 1DVPA 3SOUA 5C11A 3LVRE 2KWOA 3FANA 5LCWB 3O35A 2KGIA 1VYXA 2BAYA 3DWDA 1WFKA 2CONA 2K1JA 1WGMA 2Y1NA 4YBSA 4QF3A 3KV5A 3N9OA 4LJNA 3N9LA 4UI9B 2XOCA 2L43A 2KU3A 2QJ0A 3N9MA 1N87A 2ECVA 3H7HA 2CSYA 1U6GB 3VK6A 2VJFA 2D8SA 5SVYA 3SOWA 5B8DA 3MHHA 1T1HA 3L11A 3HCTA 3FAOA 4R8PK 3U5MA 2L80A 4WA6A 2JMIA 3HTKC 2G45A 1JM7B 4FO9A 4AP4A 2ECNA 2FSAA 3EB5A 2KR4A 2VPEA 4P5OB 2XB1A 5G05B 2YQLA 3T6RA 2JM3A 2OWAA 4FJCA 5D1KB 3LQJA 2AN6A 5TDRA 2MD7B 3V43A 1Z6UA 5G0FA 5B75A 4ZUXU 2LV9A 2CRWA 1HYJA 5J3XA 3DPLR 4QF2A 2B0OE 4UP5A 2F6NA 4V3LC 1WEPA 3PHDA 4I7CA 2I50A 1LDKC 4PTBA 2EODA 4YC9A 2NAAA 5LKZA 2YT5A 5FB0A 4Z0OA 5B79A 1K2FA 3ZYQA 2QICA 2G6QA 3O34A 4O64A 1FP0A 2QIZA 2MT5A 2CKLB 3L1ZB 3E2DA 3ZPVE 4X3GA 2UZGA 3SOXA 4I7BA 1X4UA 2L7PA 4YAXA 5SVXA 2LGGA 4LKAA 2HDPA 4AYCB 4LADB 5C13A 2YURA 3PURA 5AITA 3O37A 2K17A 1ZBDB 2FUIA 2M1RA 2G43A 1WEVA 3SHBA 2LAUA 2HYED 1WESA 2VPDA 1DCQA 3MHSA 4F52B 1Z60A 1WILA 2EXUA 2CT2A 4GNGA 3RPGB 4S3OB 3ZPV1 3M99A 4NN2A 2VJEB 1WE9A 3HCSA 4WZ0A 2IQJA 2YSMA 3O70A 2M6MA 1LDJB 5I3LA 5H1VA 4L58A 3IHPA 4IC3A 4AUQB 2MD8C 5D1MB 3M63A 3RPGC 4S3OC 2L75A 2XOZA 3GV4A 2EGPA 2D8UA 4UP0A 3ASLA 2VJFB 4AVXA 1WEEA 2ECJA 2XP0A 4OGEA 1CHCA 2MKEA 1F62A 3NG2A 2M85A 3KV6A 3KQIA 2KKXA 2XOYA 3LRQA 3U5OA 1VD4A 1MM2A 2KFTA 2CSZA 4LK9A 5FEYA 4R7EA 3I2DA 4WZ3B 1WEOA 2LQ6A 4A49A 2MA6A 2ZETC 2MNYA 4QQ4A 3RTRB 4YABA 2RR4A 4A4CA 2MIQA 5TABA 3C5KA 1E4UA 2CRRA 1WEMA 4N4FA 3JUEA 1WIMA 2E6RA 2ECGA 5H9MA 4C9ZA 1MM3A 2LGVA 3LJUX
chains in the Genus database with same CATH topology
5LKXA 3GL6A 2ECWA 4XI1A 2YYRA 1G25A 4MVTA 5KH3A 4IC2A 3O33A 5DINA 5LKTA 2YQMA 4FK5A 2KWKA 3N9QA 5AIUA 4V3KC 4I7DA 4WZ2A 3T7LA 2DX8A 2MNZA 2EA6A 4B86C 2H0DA 2MUMA 4PPEA 3KNVA 3O36A 4YATA 5TRBA 1Z2QA 4N3WA 1HYIA 2ECIA 2ECTA 2LGKA 4YADA 4FIPA 2LDRA 3N9NA 4MSXA 2VNFA 2YU4A 5G04B 2JRJA 2YW8A 4ZQLA 3DQVR 2JMDA 1RMDA 4GNFA 5KH9A 3U5PA 5H1TA 2MA5A 3QZVA 2YSJA 4BBQA 5TBNA 1IYMA 5B77A 1V87A 3ZVYA 4A4BA 5JG6A 2VPGA 2KWJA 2YREA 3C6WA 2M3HA 1X4JA 2L0BA 2LXHC 1JM7A 2OXQC 2KGGA 2Y43A 1WEQA 2FUUA 3PUQA 3M62A 1FBVA 2KWNA 5B76A 1JOCA 4ZDTA 3L1XA 5FB1A 2KE1A 5B78A 1VFYA 5D1LB 3FL2A 1WENA 1WEWA 3EB6A 3U5NA 2C2LA 2C2VS 5FERA 4A0CD 2XEUA 2LN0A 5DKAA 2YHNA 2K4DA 2VPBA 4L7XA 2IDAA 4TKPB 3LQIA 3ZTGA 2YUCA 5EYAF 5TDWA 4CA1A 3LQHA 5H1UA 2LXPC 1XWHA 2L5UA 2CKLA 4GNDA 4B7YC 1WEUA 3N9PA 4CCGX 2F6JA 4AYCA 4LLBA 4GB0A 2RSDA 2E6SA 2LGLA 2F42A 2YHOA 4BHWA 1BORA 2KYUA 1X4IA 4GNEA 4R2YA 5LKUA 3O7AA 4Q6FA 3HCUA 4YBTA 2PUYA 2RI7A 2K16A 4YBMA 2KIZA 2JMJA 3ZNIA 5KH7A 2PNXA 2H0DB 2KREA 2VJEA 3ZVZB 2LRIC 4W4UA 2Y1MA 2VP7A 1DVPA 3SOUA 5C11A 2KWOA 5LCWB 3O35A 2KGIA 1VYXA 2BAYA 1WFKA 2K1JA 1WGMA 2Y1NA 4YBSA 4QF3A 3KV5A 3N9OA 4LJNA 3N9LA 4UI9B 2L43A 2KU3A 2QJ0A 3N9MA 1N87A 2ECVA 2CSYA 1U6GB 3VK6A 2VJFA 2D8SA 3SOWA 5B8DA 3MHHA 1T1HA 3L11A 3HCTA 4R8PK 3U5MA 2L80A 4WA6A 2JMIA 3HTKC 2G45A 1JM7B 4FO9A 4AP4A 2ECNA 2FSAA 3EB5A 2KR4A 2VPEA 4P5OB 2XB1A 5G05B 2YQLA 3T6RA 4FJCA 5D1KB 3LQJA 2AN6A 5TDRA 2MD7B 3V43A 1Z6UA 5G0FA 5B75A 4ZUXU 2LV9A 1HYJA 5J3XA 3DPLR 4QF2A 4UP5A 2F6NA 4V3LC 1WEPA 3PHDA 4I7CA 2I50A 1LDKC 4PTBA 2EODA 4YC9A 2NAAA 5LKZA 2YT5A 5FB0A 5B79A 1K2FA 3ZYQA 2QICA 2G6QA 3O34A 4O64A 1FP0A 2QIZA 2MT5A 2CKLB 3L1ZB 3ZPVE 4X3GA 2UZGA 3SOXA 4I7BA 1X4UA 4YAXA 2LGGA 4LKAA 2HDPA 4AYCB 4LADB 5C13A 2YURA 3PURA 5AITA 3O37A 2K17A 1ZBDB 2FUIA 2M1RA 2G43A 3SHBA 1WEVA 2HYED 1WESA 2VPDA 3MHSA 4F52B 1Z60A 1WILA 2CT2A 4GNGA 3RPGB 4S3OB 3ZPV1 3M99A 4NN2A 2VJEB 1WE9A 3HCSA 4WZ0A 2YSMA 3O70A 2M6MA 1LDJB 5I3LA 5H1VA 4L58A 3IHPA 4IC3A 4AUQB 2MD8C 5D1MB 3M63A 3RPGC 4S3OC 2L75A 3GV4A 2EGPA 4UP0A 3ASLA 2VJFB 4AVXA 1WEEA 2ECJA 1CHCA 1F62A 3NG2A 2M85A 3KV6A 3KQIA 3LRQA 3U5OA 1VD4A 1MM2A 2KFTA 2CSZA 4LK9A 5FEYA 4R7EA 3I2DA 4WZ3B 1WEOA 2LQ6A 4A49A 2MA6A 2ZETC 2MNYA 3RTRB 4YABA 4A4CA 2MIQA 5TABA 3C5KA 1E4UA 1WEMA 4N4FA 1WIMA 2E6RA 2ECGA 5H9MA 4C9ZA 1MM3A 2LGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKX A;  3GL6 A;  2ECW A;  4XI1 A;  2YYR A;  1G25 A;  4MVT A;  5KH3 A;  4IC2 A;  3O33 A;  5DIN A;  5LKT A;  2YQM A;  4FK5 A;  2KWK A;  3N9Q A;  5AIU A;  4V3K C;  4I7D A;  4WZ2 A;  3T7L A;  2DX8 A;  2MNZ A;  2EA6 A;  4B86 C;  2H0D A;  2MUM A;  4PPE A;  3KNV A;  3O36 A;  4YAT A;  5TRB A;  1Z2Q A;  4N3W A;  1HYI A;  2ECI A;  2ECT A;  2LGK A;  4YAD A;  4FIP A;  2LDR A;  3N9N A;  4MSX A;  2VNF A;  2YU4 A;  5G04 B;  2JRJ A;  2YW8 A;  4ZQL A;  3DQV R;  2JMD A;  1RMD A;  4GNF A;  5KH9 A;  3U5P A;  5H1T A;  2MA5 A;  3QZV A;  2YSJ A;  4BBQ A;  5TBN A;  1IYM A;  5B77 A;  1V87 A;  3ZVY A;  4A4B A;  5JG6 A;  2VPG A;  2KWJ A;  2YRE A;  3C6W A;  2M3H A;  1X4J A;  2L0B A;  2LXH C;  1JM7 A;  2OXQ C;  2KGG A;  2Y43 A;  1WEQ A;  2FUU A;  3PUQ A;  3M62 A;  1FBV A;  2KWN A;  5B76 A;  1JOC A;  4ZDT A;  3L1X A;  5FB1 A;  2KE1 A;  5B78 A;  1VFY A;  5D1L B;  3FL2 A;  1WEN A;  1WEW A;  3EB6 A;  3U5N A;  2C2L A;  2C2V S;  5FER A;  4A0C D;  2XEU A;  2LN0 A;  5DKA A;  2YHN A;  2K4D A;  2VPB A;  4L7X A;  2IDA A;  4TKP B;  3LQI A;  3ZTG A;  2YUC A;  5EYA F;  5TDW A;  4CA1 A;  3LQH A;  5H1U A;  2LXP C;  1XWH A;  2L5U A;  2CKL A;  4GND A;  4B7Y C;  1WEU A;  3N9P A;  4CCG X;  2F6J A;  4AYC A;  4LLB A;  4GB0 A;  2RSD A;  2E6S A;  2LGL A;  2F42 A;  2YHO A;  4BHW A;  1BOR A;  2KYU A;  1X4I A;  4GNE A;  4R2Y A;  5LKU A;  3O7A A;  4Q6F A;  3HCU A;  4YBT A;  2PUY A;  2RI7 A;  2K16 A;  4YBM A;  2KIZ A;  2JMJ A;  3ZNI A;  5KH7 A;  2PNX A;  2H0D B;  2KRE A;  2VJE A;  3ZVZ B;  2LRI C;  4W4U A;  2Y1M A;  2VP7 A;  1DVP A;  3SOU A;  5C11 A;  2KWO A;  5LCW B;  3O35 A;  2KGI A;  1VYX A;  2BAY A;  1WFK A;  2K1J A;  1WGM A;  2Y1N A;  4YBS A;  4QF3 A;  3KV5 A;  3N9O A;  4LJN A;  3N9L A;  4UI9 B;  2L43 A;  2KU3 A;  2QJ0 A;  3N9M A;  1N87 A;  2ECV A;  2CSY A;  1U6G B;  3VK6 A;  2VJF A;  2D8S A;  3SOW A;  5B8D A;  3MHH A;  1T1H A;  3L11 A;  3HCT A;  4R8P K;  3U5M A;  2L80 A;  4WA6 A;  2JMI A;  3HTK C;  2G45 A;  1JM7 B;  4FO9 A;  4AP4 A;  2ECN A;  2FSA A;  3EB5 A;  2KR4 A;  2VPE A;  4P5O B;  2XB1 A;  5G05 B;  2YQL A;  3T6R A;  4FJC A;  5D1K B;  3LQJ A;  2AN6 A;  5TDR A;  2MD7 B;  3V43 A;  1Z6U A;  5G0F A;  5B75 A;  4ZUX U;  2LV9 A;  1HYJ A;  5J3X A;  3DPL R;  4QF2 A;  4UP5 A;  2F6N A;  4V3L C;  1WEP A;  3PHD A;  4I7C A;  2I50 A;  1LDK C;  4PTB A;  2EOD A;  4YC9 A;  2NAA A;  5LKZ A;  2YT5 A;  5FB0 A;  5B79 A;  1K2F A;  3ZYQ A;  2QIC A;  2G6Q A;  3O34 A;  4O64 A;  1FP0 A;  2QIZ A;  2MT5 A;  2CKL B;  3L1Z B;  3ZPV E;  4X3G A;  2UZG A;  3SOX A;  4I7B A;  1X4U A;  4YAX A;  2LGG A;  4LKA A;  2HDP A;  4AYC B;  4LAD B;  5C13 A;  2YUR A;  3PUR A;  5AIT A;  3O37 A;  2K17 A;  1ZBD B;  2FUI A;  2M1R A;  2G43 A;  3SHB A;  1WEV A;  2HYE D;  1WES A;  2VPD A;  3MHS A;  4F52 B;  1Z60 A;  1WIL A;  2CT2 A;  4GNG A;  3RPG B;  4S3O B;  3ZPV 1;  3M99 A;  4NN2 A;  2VJE B;  1WE9 A;  3HCS A;  4WZ0 A;  2YSM A;  3O70 A;  2M6M A;  1LDJ B;  5I3L A;  5H1V A;  4L58 A;  3IHP A;  4IC3 A;  4AUQ B;  2MD8 C;  5D1M B;  3M63 A;  3RPG C;  4S3O C;  2L75 A;  3GV4 A;  2EGP A;  4UP0 A;  3ASL A;  2VJF B;  4AVX A;  1WEE A;  2ECJ A;  1CHC A;  1F62 A;  3NG2 A;  2M85 A;  3KV6 A;  3KQI A;  3LRQ A;  3U5O A;  1VD4 A;  1MM2 A;  2KFT A;  2CSZ A;  4LK9 A;  5FEY A;  4R7E A;  3I2D A;  4WZ3 B;  1WEO A;  2LQ6 A;  4A49 A;  2MA6 A;  2ZET C;  2MNY A;  3RTR B;  4YAB A;  4A4C A;  2MIQ A;  5TAB A;  3C5K A;  1E4U A;  1WEM A;  4N4F A;  1WIM A;  2E6R A;  2ECG A;  5H9M A;  4C9Z A;  1MM3 A;  2LGV A; 
#chains in the Genus database with same CATH topology
 5LKX A;  3GL6 A;  2ECW A;  4XI1 A;  2FFW A;  4Z0R A;  2YYR A;  1G25 A;  4MVT A;  5KH3 A;  4IC2 A;  3O33 A;  5DIN A;  5LKT A;  2YQM A;  4FK5 A;  2KWK A;  3N9Q A;  5AIU A;  4V3K C;  3M7K A;  4I7D A;  4WZ2 A;  3T7L A;  2DX8 A;  2MNZ A;  2EA6 A;  4B86 C;  2H0D A;  2MUM A;  4PPE A;  3KNV A;  3O36 A;  3PLW A;  4YAT A;  3Q1D A;  5SVI A;  5TRB A;  1MBM A;  1Z2Q A;  4N3W A;  1HYI A;  2YVR A;  2ECI A;  2P57 A;  2ECT A;  2LGK A;  4YAD A;  4FIP A;  2LDR A;  3N9N A;  4MSX A;  2VNF A;  2YU4 A;  5G04 B;  5K3Q A;  2JRJ A;  2YW8 A;  4ZQL A;  3DQV R;  2E61 A;  3LDY A;  2JMD A;  3FJU B;  1RMD A;  4GNF A;  5KH9 A;  3U5P A;  5H1T A;  2DJA A;  2MA5 A;  3FEH A;  3QZV A;  2YSJ A;  4BBQ A;  5TBN A;  1IYM A;  5B77 A;  1V87 A;  3ZVY A;  2EGM A;  4A4B A;  5JG6 A;  2VPG A;  2KWJ A;  2YRE A;  3C6W A;  2M3H A;  1X4J A;  2L0B A;  2LXH C;  1JM7 A;  2OXQ C;  2KGG A;  2Y43 A;  1WEQ A;  2FUU A;  3PUQ A;  3M62 A;  1FBV A;  2KWN A;  3DDT A;  2KKY A;  5B76 A;  1JOC A;  4ZDT A;  3L1X A;  5FB1 A;  2KE1 A;  2CSV A;  3MDB C;  5B78 A;  1VFY A;  5D1L B;  3FL2 A;  3FM8 C;  1WEN A;  3SUB A;  2FD4 A;  1WEW A;  3EB6 A;  3U5N A;  2C2L A;  2C2V S;  3T9K A;  5FER A;  4OGC A;  4A0C D;  2XEU A;  2LN0 A;  5DKA A;  4O62 A;  2YHN A;  2K4D A;  2VPB A;  2M13 A;  4L7X A;  2IDA A;  4TKP B;  3LQI A;  3O47 A;  3ZTG A;  2YUC A;  5EYA F;  5TDW A;  4CA1 A;  3LQH A;  3KDE C;  3LVQ E;  5H1U A;  2LXP C;  1XWH A;  2L5U A;  2CKL A;  4GND A;  4B7Y C;  1WEU A;  3N9P A;  4CCG X;  2F6J A;  4AYC A;  4LLB A;  4GB0 A;  2RSD A;  2E6S A;  2LGL A;  2F42 A;  2YHO A;  4BHW A;  1BOR A;  4H9D A;  2KYU A;  1X4I A;  4R2Y A;  2JUN A;  4GNE A;  5LKU A;  3O7A A;  4Q6F A;  3HCU A;  4YBT A;  2PUY A;  2RI7 A;  2K16 A;  2DSM A;  4YBM A;  2KIZ A;  2JMJ A;  3ZNI A;  5KH7 A;  4F1P A;  2PNX A;  2H0D B;  2KRE A;  2VJE A;  3ZVZ B;  2LRI C;  4W4U A;  2Y1M A;  5SVI B;  2VP7 A;  1DVP A;  3SOU A;  5C11 A;  3LVR E;  2KWO A;  3FAN A;  5LCW B;  3O35 A;  2KGI A;  1VYX A;  2BAY A;  3DWD A;  1WFK A;  2CON A;  2K1J A;  1WGM A;  2Y1N A;  4YBS A;  4QF3 A;  3KV5 A;  3N9O A;  4LJN A;  3N9L A;  4UI9 B;  2XOC A;  2L43 A;  2KU3 A;  2QJ0 A;  3N9M A;  1N87 A;  2ECV A;  3H7H A;  2CSY A;  1U6G B;  3VK6 A;  2VJF A;  2D8S A;  5SVY A;  3SOW A;  5B8D A;  3MHH A;  1T1H A;  3L11 A;  3HCT A;  3FAO A;  4R8P K;  3U5M A;  2L80 A;  4WA6 A;  2JMI A;  3HTK C;  2G45 A;  1JM7 B;  4FO9 A;  4AP4 A;  2ECN A;  2FSA A;  3EB5 A;  2KR4 A;  2VPE A;  4P5O B;  2XB1 A;  5G05 B;  2YQL A;  3T6R A;  2JM3 A;  2OWA A;  4FJC A;  5D1K B;  3LQJ A;  2AN6 A;  5TDR A;  2MD7 B;  3V43 A;  1Z6U A;  5G0F A;  5B75 A;  4ZUX U;  2LV9 A;  2CRW A;  1HYJ A;  5J3X A;  3DPL R;  4QF2 A;  2B0O E;  4UP5 A;  2F6N A;  4V3L C;  1WEP A;  3PHD A;  4I7C A;  2I50 A;  1LDK C;  4PTB A;  2EOD A;  4YC9 A;  2NAA A;  5LKZ A;  2YT5 A;  5FB0 A;  4Z0O A;  5B79 A;  1K2F A;  3ZYQ A;  2QIC A;  2G6Q A;  3O34 A;  4O64 A;  1FP0 A;  2QIZ A;  2MT5 A;  2CKL B;  3L1Z B;  3E2D A;  3ZPV E;  4X3G A;  2UZG A;  3SOX A;  4I7B A;  1X4U A;  2L7P A;  4YAX A;  5SVX A;  2LGG A;  4LKA A;  2HDP A;  4AYC B;  4LAD B;  5C13 A;  2YUR A;  3PUR A;  5AIT A;  3O37 A;  2K17 A;  1ZBD B;  2FUI A;  2M1R A;  2G43 A;  1WEV A;  3SHB A;  2LAU A;  2HYE D;  1WES A;  2VPD A;  1DCQ A;  3MHS A;  4F52 B;  1Z60 A;  1WIL A;  2EXU A;  2CT2 A;  4GNG A;  3RPG B;  4S3O B;  3ZPV 1;  3M99 A;  4NN2 A;  2VJE B;  1WE9 A;  3HCS A;  4WZ0 A;  2IQJ A;  2YSM A;  3O70 A;  2M6M A;  1LDJ B;  5I3L A;  5H1V A;  4L58 A;  3IHP A;  4IC3 A;  4AUQ B;  2MD8 C;  5D1M B;  3M63 A;  3RPG C;  4S3O C;  2L75 A;  2XOZ A;  3GV4 A;  2EGP A;  2D8U A;  4UP0 A;  3ASL A;  2VJF B;  4AVX A;  1WEE A;  2ECJ A;  2XP0 A;  4OGE A;  1CHC A;  2MKE A;  1F62 A;  3NG2 A;  2M85 A;  3KV6 A;  3KQI A;  2KKX A;  2XOY A;  3LRQ A;  3U5O A;  1VD4 A;  1MM2 A;  2KFT A;  2CSZ A;  4LK9 A;  5FEY A;  4R7E A;  3I2D A;  4WZ3 B;  1WEO A;  2LQ6 A;  4A49 A;  2MA6 A;  2ZET C;  2MNY A;  4QQ4 A;  3RTR B;  4YAB A;  2RR4 A;  4A4C A;  2MIQ A;  5TAB A;  3C5K A;  1E4U A;  2CRR A;  1WEM A;  4N4F A;  3JUE A;  1WIM A;  2E6R A;  2ECG A;  5H9M A;  4C9Z A;  1MM3 A;  2LGV A;  3LJU X; 
#chains in the Genus database with same CATH homology
 5LKX A;  3GL6 A;  2ECW A;  4XI1 A;  2YYR A;  1G25 A;  4MVT A;  5KH3 A;  4IC2 A;  3O33 A;  5DIN A;  5LKT A;  2YQM A;  4FK5 A;  2KWK A;  3N9Q A;  5AIU A;  4V3K C;  4I7D A;  4WZ2 A;  3T7L A;  2DX8 A;  2MNZ A;  2EA6 A;  4B86 C;  2H0D A;  2MUM A;  4PPE A;  3KNV A;  3O36 A;  4YAT A;  5TRB A;  1Z2Q A;  4N3W A;  1HYI A;  2ECI A;  2ECT A;  2LGK A;  4YAD A;  4FIP A;  2LDR A;  3N9N A;  4MSX A;  2VNF A;  2YU4 A;  5G04 B;  2JRJ A;  2YW8 A;  4ZQL A;  3DQV R;  2JMD A;  1RMD A;  4GNF A;  5KH9 A;  3U5P A;  5H1T A;  2MA5 A;  3QZV A;  2YSJ A;  4BBQ A;  5TBN A;  1IYM A;  5B77 A;  1V87 A;  3ZVY A;  4A4B A;  5JG6 A;  2VPG A;  2KWJ A;  2YRE A;  3C6W A;  2M3H A;  1X4J A;  2L0B A;  2LXH C;  1JM7 A;  2OXQ C;  2KGG A;  2Y43 A;  1WEQ A;  2FUU A;  3PUQ A;  3M62 A;  1FBV A;  2KWN A;  5B76 A;  1JOC A;  4ZDT A;  3L1X A;  5FB1 A;  2KE1 A;  5B78 A;  1VFY A;  5D1L B;  3FL2 A;  1WEN A;  1WEW A;  3EB6 A;  3U5N A;  2C2L A;  2C2V S;  5FER A;  4A0C D;  2XEU A;  2LN0 A;  5DKA A;  2YHN A;  2K4D A;  2VPB A;  4L7X A;  2IDA A;  4TKP B;  3LQI A;  3ZTG A;  2YUC A;  5EYA F;  5TDW A;  4CA1 A;  3LQH A;  5H1U A;  2LXP C;  1XWH A;  2L5U A;  2CKL A;  4GND A;  4B7Y C;  1WEU A;  3N9P A;  4CCG X;  2F6J A;  4AYC A;  4LLB A;  4GB0 A;  2RSD A;  2E6S A;  2LGL A;  2F42 A;  2YHO A;  4BHW A;  1BOR A;  2KYU A;  1X4I A;  4GNE A;  4R2Y A;  5LKU A;  3O7A A;  4Q6F A;  3HCU A;  4YBT A;  2PUY A;  2RI7 A;  2K16 A;  4YBM A;  2KIZ A;  2JMJ A;  3ZNI A;  5KH7 A;  2PNX A;  2H0D B;  2KRE A;  2VJE A;  3ZVZ B;  2LRI C;  4W4U A;  2Y1M A;  2VP7 A;  1DVP A;  3SOU A;  5C11 A;  2KWO A;  5LCW B;  3O35 A;  2KGI A;  1VYX A;  2BAY A;  1WFK A;  2K1J A;  1WGM A;  2Y1N A;  4YBS A;  4QF3 A;  3KV5 A;  3N9O A;  4LJN A;  3N9L A;  4UI9 B;  2L43 A;  2KU3 A;  2QJ0 A;  3N9M A;  1N87 A;  2ECV A;  2CSY A;  1U6G B;  3VK6 A;  2VJF A;  2D8S A;  3SOW A;  5B8D A;  3MHH A;  1T1H A;  3L11 A;  3HCT A;  4R8P K;  3U5M A;  2L80 A;  4WA6 A;  2JMI A;  3HTK C;  2G45 A;  1JM7 B;  4FO9 A;  4AP4 A;  2ECN A;  2FSA A;  3EB5 A;  2KR4 A;  2VPE A;  4P5O B;  2XB1 A;  5G05 B;  2YQL A;  3T6R A;  4FJC A;  5D1K B;  3LQJ A;  2AN6 A;  5TDR A;  2MD7 B;  3V43 A;  1Z6U A;  5G0F A;  5B75 A;  4ZUX U;  2LV9 A;  1HYJ A;  5J3X A;  3DPL R;  4QF2 A;  4UP5 A;  2F6N A;  4V3L C;  1WEP A;  3PHD A;  4I7C A;  2I50 A;  1LDK C;  4PTB A;  2EOD A;  4YC9 A;  2NAA A;  5LKZ A;  2YT5 A;  5FB0 A;  5B79 A;  1K2F A;  3ZYQ A;  2QIC A;  2G6Q A;  3O34 A;  4O64 A;  1FP0 A;  2QIZ A;  2MT5 A;  2CKL B;  3L1Z B;  3ZPV E;  4X3G A;  2UZG A;  3SOX A;  4I7B A;  1X4U A;  4YAX A;  2LGG A;  4LKA A;  2HDP A;  4AYC B;  4LAD B;  5C13 A;  2YUR A;  3PUR A;  5AIT A;  3O37 A;  2K17 A;  1ZBD B;  2FUI A;  2M1R A;  2G43 A;  3SHB A;  1WEV A;  2HYE D;  1WES A;  2VPD A;  3MHS A;  4F52 B;  1Z60 A;  1WIL A;  2CT2 A;  4GNG A;  3RPG B;  4S3O B;  3ZPV 1;  3M99 A;  4NN2 A;  2VJE B;  1WE9 A;  3HCS A;  4WZ0 A;  2YSM A;  3O70 A;  2M6M A;  1LDJ B;  5I3L A;  5H1V A;  4L58 A;  3IHP A;  4IC3 A;  4AUQ B;  2MD8 C;  5D1M B;  3M63 A;  3RPG C;  4S3O C;  2L75 A;  3GV4 A;  2EGP A;  4UP0 A;  3ASL A;  2VJF B;  4AVX A;  1WEE A;  2ECJ A;  1CHC A;  1F62 A;  3NG2 A;  2M85 A;  3KV6 A;  3KQI A;  3LRQ A;  3U5O A;  1VD4 A;  1MM2 A;  2KFT A;  2CSZ A;  4LK9 A;  5FEY A;  4R7E A;  3I2D A;  4WZ3 B;  1WEO A;  2LQ6 A;  4A49 A;  2MA6 A;  2ZET C;  2MNY A;  3RTR B;  4YAB A;  4A4C A;  2MIQ A;  5TAB A;  3C5K A;  1E4U A;  1WEM A;  4N4F A;  1WIM A;  2E6R A;  2ECG A;  5H9M A;  4C9Z A;  1MM3 A;  2LGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...