2JMDA

Solution structure of the ring domain of human traf6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
GPLGSKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, interactions, and dynamics of the RING domain from human TRAF6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords TNF receptor-associated factor 6
total genus 11
structure length 63
sequence length 63
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jmdA00
2G43A 2VPGA 1N87A 2OXQC 2XEUA 2VJFB 2ECIA 2L5UA 2LRIC 2LGKA 2KU3A 2HDPA 1LDKC 1HYIA 1JM7A 1CHCA 5D1MB 2JRJA 3N9PA 1LDJB 1JOCA 2CSZA 2DX8A 2F6JA 4A4CA 2VJEA 5TRBA 4ZQLA 1ZBDB 4WZ0A 3U5NA 4R2YA 3SOWA 2L80A 3KV5A 2Y1MA 4YATA 4AYCB 2JMJA 4UP5A 2NAAA 2MNYA 4QF3A 3U5OA 4F52B 2K17A 1WGMA 2IDAA 2LXHC 4LKAA 4R7EA 1U6GB 3ZPVE 4YADA 2L75A 3KV6A 2MD8C 3LQHA 4AUQB 3HTKC 4GNGA 2E6RA 4CCGX 3ZYQA 2YSJA 4GNEA 2YSMA 3RTRB 3O34A 2BAYA 3N9LA 5H1TA 3LRQA 2I50A 1K2FA 4BHWA 3ZPV1 3N9NA 3VK6A 4I7BA 2C2LA 4FJCA 4LLBA 4FIPA 4MSXA 4O64A 2K1JA 1G25A 3RPGB 2H0DB 2KIZA 5B76A 4W4UA 3GV4A 3MHHA 3PURA 3MHSA 4PPEA 4QF2A 2KWJA 2MA6A 2YQLA 5DKAA 1WFKA 3ZTGA 4N4FA 3O7AA 1X4JA 5JG6A 3ZVZB 1WEMA 2KWOA 3C5KA 3RPGC 3QZVA 3DQVR 3L1XA 2M6MA 4UP0A 4A0CD 2VPEA 5H9MA 2MT5A 3EB6A 2VNFA 2KFTA 2L0BA 3HCUA 5LKZA 3SOXA 4P5OB 2EA6A 4GNDA 1JM7B 2LXPC 5TDRA 2K16A 2YURA 1WIMA 2KR4A 1WEVA 2MIQA 3T7LA 5KH3A 2YHOA 5LKUA 5FB1A 2G45A 2E6SA 2CKLB 3DPLR 3O36A 4TKPB 2YT5A 1WILA 1MM3A 2K4DA 5I3LA 2CT2A 3PUQA 4IC3A 2VP7A 4YABA 5AITA 5J3XA 2YU4A 2YREA 2YQMA 2ECJA 5B8DA 4B7YC 4LJNA 2KGGA 1WEQA 2Y43A 5G04B 4FK5A 4YC9A 2CKLA 3T6RA 4YAXA 2AN6A 2PNXA 5C11A 4S3OC 1BORA 2EODA 5FERA 4YBTA 1FBVA 2HYED 4V3KC 2CSYA 2KE1A 2ECNA 2ECTA 4WA6A 3V43A 1IYMA 5C13A 3LQJA 4B86C 2QJ0A 2LGGA 2EGPA 3N9QA 3U5MA 5D1LB 1X4UA 2VJFA 2RI7A 4L7XA 4WZ3B 4R8PK 4FO9A 2YHNA 2YW8A 1VYXA 2UZGA 2F6NA 5FB0A 2ECVA 5H1UA 2FUUA 4X3GA 4AYCA 4XI1A 1VFYA 2KGIA 3O35A 2JMIA 2PUYA 1FP0A 1HYJA 4S3OB 1T1HA 1X4IA 3HCSA 4AVXA 2VPDA 4L58A 5H1VA 2F42A 3PHDA 2FUIA 2QIZA 5LCWB 4GNFA 3HCTA 3ASLA 2ZETC 4ZDTA 3M63A 3KNVA 2G6QA 2KREA 4WZ2A 5LKXA 2KWKA 3LQIA 3ZVYA 2MNZA 3FL2A 2RSDA 3SHBA 2ECGA 4V3LC 5B77A 4ZUXU 4AP4A 2D8SA 1WEEA 4YBSA 2KYUA 1Z60A 3IHPA 3U5PA 1F62A 2LV9A 3ZNIA 1WE9A 3EB5A 4PTBA 2LN0A 3O33A 1V87A 4GB0A 5B78A 3L11A 2Y1NA 5TBNA 1XWHA 1VD4A 3O70A 2ECWA 2L43A 4LK9A 4YBMA 2QICA 4I7DA 2VPBA 5B79A 2MD7B 5LKTA 2LDRA 2FSAA 5TDWA 2H0DA 2LGVA 1WEOA 1WEWA 1RMDA 1WESA 5G0FA 2LGLA 4CA1A 1MM2A 3M62A 1Z6UA 4C9ZA 4A49A 2C2VS 3GL6A 2XB1A 5EYAF 2KWNA 4IC2A 3N9MA 2M1RA 2YYRA 5KH7A 4NN2A 3M99A 5B75A 3N9OA 5DINA 5KH9A 4LADB 2MA5A 5FEYA 5TABA 5AIUA 1WEPA 4I7CA 2MUMA 5D1KB 3SOUA 1WEUA 3NG2A 3O37A 3L1ZB 4MVTA 1E4UA 3I2DA 4UI9B 3KQIA 1WENA 4N3WA 1Z2QA 2M85A 5G05B 1DVPA 2JMDA 2LQ6A 4A4BA 4BBQA 2M3HA 4Q6FA 2VJEB 3C6WA 2YUCA
chains in the Genus database with same CATH superfamily
2G43A 5SVIA 2VPGA 1N87A 2OXQC 2P57A 2XEUA 2VJFB 2XOCA 3LDYA 2ECIA 2L5UA 2LRIC 2LGKA 2KU3A 2HDPA 1LDKC 1HYIA 1JM7A 1CHCA 5SVYA 3O47A 5D1MB 2JRJA 3N9PA 1LDJB 1JOCA 2CSZA 2DX8A 2F6JA 4A4CA 2VJEA 1MBMA 5TRBA 4ZQLA 1ZBDB 4WZ0A 3U5NA 4R2YA 2YVRA 3SOWA 4OGEA 2L80A 3DDTA 2CONA 3KV5A 2Y1MA 4YATA 4AYCB 2JMJA 4UP5A 2FD4A 2NAAA 3E2DA 2MNYA 4QF3A 3U5OA 4F52B 2K17A 1WGMA 2DJAA 2IDAA 2LXHC 4LKAA 4R7EA 1U6GB 3ZPVE 4YADA 2L75A 3KV6A 3FJUB 2MD8C 3LQHA 4AUQB 3HTKC 4GNGA 2E6RA 4CCGX 3ZYQA 2YSJA 4GNEA 2YSMA 3RTRB 5K3QA 3O34A 2BAYA 3T9KA 3N9LA 2RR4A 5H1TA 3LRQA 2I50A 1K2FA 4F1PA 3ZPV1 4BHWA 3N9NA 3VK6A 4I7BA 2C2LA 4FJCA 4LLBA 4FIPA 4MSXA 3Q1DA 4O64A 2K1JA 1G25A 3RPGB 2H0DB 2KIZA 5B76A 3M7KA 4W4UA 2XOZA 3GV4A 3MHHA 3PURA 3MHSA 4PPEA 2CSVA 4QF2A 2L7PA 2KWJA 2MA6A 2YQLA 5DKAA 1WFKA 3ZTGA 4N4FA 3O7AA 1X4JA 5JG6A 3ZVZB 1WEMA 2KWOA 3C5KA 3RPGC 3QZVA 2FFWA 3DQVR 3FANA 2LAUA 3L1XA 2M6MA 4UP0A 4A0CD 2VPEA 5H9MA 2MT5A 3EB6A 2VNFA 2KFTA 2L0BA 2M13A 1DCQA 2OWAA 3HCUA 5LKZA 3SOXA 4P5OB 2EA6A 4GNDA 1JM7B 2LXPC 5TDRA 2K16A 2YURA 1WIMA 2JM3A 2KR4A 1WEVA 2MIQA 3T7LA 5KH3A 2YHOA 5LKUA 5FB1A 2G45A 5SVIB 2E6SA 2CKLB 3DPLR 3O36A 4TKPB 2YT5A 1WILA 1MM3A 2K4DA 5I3LA 2D8UA 2CT2A 3PUQA 4IC3A 2VP7A 4YABA 5AITA 5J3XA 2YU4A 2DSMA 2YREA 2YQMA 2ECJA 5B8DA 4B7YC 4LJNA 2KGGA 1WEQA 2Y43A 5G04B 4FK5A 4YC9A 4Z0OA 2MKEA 2CKLA 3T6RA 3KDEC 4YAXA 2AN6A 2PNXA 5C11A 2KKXA 4S3OC 1BORA 2EODA 5FERA 4YBTA 1FBVA 2HYED 4V3KC 2CSYA 3DWDA 2KE1A 2ECNA 2JUNA 2ECTA 3FEHA 4WA6A 3V43A 1IYMA 5C13A 3LQJA 4B86C 2QJ0A 2LGGA 2EGPA 3N9QA 3U5MA 5D1LB 1X4UA 2VJFA 2RI7A 4L7XA 4H9DA 4WZ3B 4R8PK 4FO9A 2YHNA 2YW8A 1VYXA 2UZGA 3SUBA 2F6NA 5FB0A 2ECVA 5H1UA 2FUUA 4X3GA 4AYCA 4XI1A 1VFYA 2KGIA 3O35A 2JMIA 2PUYA 4Z0RA 1FP0A 2CRWA 4QQ4A 1HYJA 4S3OB 1T1HA 1X4IA 3HCSA 4AVXA 2VPDA 4L58A 5H1VA 2F42A 3LJUX 3H7HA 2KKYA 3PHDA 2IQJA 2FUIA 2QIZA 5LCWB 3FAOA 4GNFA 2CRRA 3HCTA 3ASLA 2ZETC 4ZDTA 3M63A 3KNVA 2G6QA 2KREA 4WZ2A 5LKXA 2KWKA 3LQIA 3ZVYA 2MNZA 3FL2A 2RSDA 4OGCA 3SHBA 2ECGA 2B0OE 4V3LC 5B77A 4ZUXU 4AP4A 2D8SA 1WEEA 3LVQE 4YBSA 2KYUA 1Z60A 3IHPA 3U5PA 1F62A 2LV9A 3ZNIA 1WE9A 3EB5A 3JUEA 4PTBA 2LN0A 3O33A 1V87A 4GB0A 5B78A 5SVXA 3L11A 2Y1NA 5TBNA 1XWHA 1VD4A 3O70A 2ECWA 2L43A 4LK9A 4YBMA 2QICA 4I7DA 2VPBA 5B79A 2MD7B 5LKTA 2LDRA 2FSAA 5TDWA 2H0DA 2LGVA 2XP0A 1WEOA 1WEWA 2E61A 1RMDA 1WESA 3LVRE 5G0FA 2LGLA 4CA1A 1MM2A 3M62A 1Z6UA 4C9ZA 4A49A 2C2VS 3GL6A 4O62A 2XB1A 5EYAF 2KWNA 4IC2A 3FM8C 3N9MA 2M1RA 2YYRA 5KH7A 4NN2A 2EXUA 2XOYA 3M99A 5B75A 3N9OA 5DINA 5KH9A 4LADB 2MA5A 5FEYA 5TABA 5AIUA 1WEPA 2EGMA 4I7CA 2MUMA 5D1KB 3SOUA 1WEUA 3NG2A 3O37A 3L1ZB 4MVTA 1E4UA 3I2DA 4UI9B 3KQIA 1WENA 4N3WA 1Z2QA 2M85A 5G05B 1DVPA 2JMDA 2LQ6A 4A4BA 3MDBC 4BBQA 2M3HA 3PLWA 4Q6FA 2VJEB 3C6WA 2YUCA
chains in the Genus database with same CATH topology
2G43A 2VPGA 1N87A 2OXQC 2XEUA 2VJFB 2ECIA 2L5UA 2LRIC 2LGKA 2KU3A 2HDPA 1LDKC 1HYIA 1JM7A 1CHCA 5D1MB 2JRJA 3N9PA 1LDJB 1JOCA 2CSZA 2DX8A 2F6JA 4A4CA 2VJEA 5TRBA 4ZQLA 1ZBDB 4WZ0A 3U5NA 4R2YA 3SOWA 2L80A 3KV5A 2Y1MA 4YATA 4AYCB 2JMJA 4UP5A 2NAAA 2MNYA 4QF3A 3U5OA 4F52B 2K17A 1WGMA 2IDAA 2LXHC 4LKAA 4R7EA 1U6GB 3ZPVE 4YADA 2L75A 3KV6A 2MD8C 3LQHA 4AUQB 3HTKC 4GNGA 2E6RA 4CCGX 3ZYQA 2YSJA 4GNEA 2YSMA 3RTRB 3O34A 2BAYA 3N9LA 5H1TA 3LRQA 2I50A 1K2FA 4BHWA 3ZPV1 3N9NA 3VK6A 4I7BA 2C2LA 4FJCA 4LLBA 4FIPA 4MSXA 4O64A 2K1JA 1G25A 3RPGB 2H0DB 2KIZA 5B76A 4W4UA 3GV4A 3MHHA 3PURA 3MHSA 4PPEA 4QF2A 2KWJA 2MA6A 2YQLA 5DKAA 1WFKA 3ZTGA 4N4FA 3O7AA 1X4JA 5JG6A 3ZVZB 1WEMA 2KWOA 3C5KA 3RPGC 3QZVA 3DQVR 3L1XA 2M6MA 4UP0A 4A0CD 2VPEA 5H9MA 2MT5A 3EB6A 2VNFA 2KFTA 2L0BA 3HCUA 5LKZA 3SOXA 4P5OB 2EA6A 4GNDA 1JM7B 2LXPC 5TDRA 2K16A 2YURA 1WIMA 2KR4A 1WEVA 2MIQA 3T7LA 5KH3A 2YHOA 5LKUA 5FB1A 2G45A 2E6SA 2CKLB 3DPLR 3O36A 4TKPB 2YT5A 1WILA 1MM3A 2K4DA 5I3LA 2CT2A 3PUQA 4IC3A 2VP7A 4YABA 5AITA 5J3XA 2YU4A 2YREA 2YQMA 2ECJA 5B8DA 4B7YC 4LJNA 2KGGA 1WEQA 2Y43A 5G04B 4FK5A 4YC9A 2CKLA 3T6RA 4YAXA 2AN6A 2PNXA 5C11A 4S3OC 1BORA 2EODA 5FERA 4YBTA 1FBVA 2HYED 4V3KC 2CSYA 2KE1A 2ECNA 2ECTA 4WA6A 3V43A 1IYMA 5C13A 3LQJA 4B86C 2QJ0A 2LGGA 2EGPA 3N9QA 3U5MA 5D1LB 1X4UA 2VJFA 2RI7A 4L7XA 4WZ3B 4R8PK 4FO9A 2YHNA 2YW8A 1VYXA 2UZGA 2F6NA 5FB0A 2ECVA 5H1UA 2FUUA 4X3GA 4AYCA 4XI1A 1VFYA 2KGIA 3O35A 2JMIA 2PUYA 1FP0A 1HYJA 4S3OB 1T1HA 1X4IA 3HCSA 4AVXA 2VPDA 4L58A 5H1VA 2F42A 3PHDA 2FUIA 2QIZA 5LCWB 4GNFA 3HCTA 3ASLA 2ZETC 4ZDTA 3M63A 3KNVA 2G6QA 2KREA 4WZ2A 5LKXA 2KWKA 3LQIA 3ZVYA 2MNZA 3FL2A 2RSDA 3SHBA 2ECGA 4V3LC 5B77A 4ZUXU 4AP4A 2D8SA 1WEEA 4YBSA 2KYUA 1Z60A 3IHPA 3U5PA 1F62A 2LV9A 3ZNIA 1WE9A 3EB5A 4PTBA 2LN0A 3O33A 1V87A 4GB0A 5B78A 3L11A 2Y1NA 5TBNA 1XWHA 1VD4A 3O70A 2ECWA 2L43A 4LK9A 4YBMA 2QICA 4I7DA 2VPBA 5B79A 2MD7B 5LKTA 2LDRA 2FSAA 5TDWA 2H0DA 2LGVA 1WEOA 1WEWA 1RMDA 1WESA 5G0FA 2LGLA 4CA1A 1MM2A 3M62A 1Z6UA 4C9ZA 4A49A 2C2VS 3GL6A 2XB1A 5EYAF 2KWNA 4IC2A 3N9MA 2M1RA 2YYRA 5KH7A 4NN2A 3M99A 5B75A 3N9OA 5DINA 5KH9A 4LADB 2MA5A 5FEYA 5TABA 5AIUA 1WEPA 4I7CA 2MUMA 5D1KB 3SOUA 1WEUA 3NG2A 3O37A 3L1ZB 4MVTA 1E4UA 3I2DA 4UI9B 3KQIA 1WENA 4N3WA 1Z2QA 2M85A 5G05B 1DVPA 2JMDA 2LQ6A 4A4BA 4BBQA 2M3HA 4Q6FA 2VJEB 3C6WA 2YUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G43 A;  2VPG A;  1N87 A;  2OXQ C;  2XEU A;  2VJF B;  2ECI A;  2L5U A;  2LRI C;  2LGK A;  2KU3 A;  2HDP A;  1LDK C;  1HYI A;  1JM7 A;  1CHC A;  5D1M B;  2JRJ A;  3N9P A;  1LDJ B;  1JOC A;  2CSZ A;  2DX8 A;  2F6J A;  4A4C A;  2VJE A;  5TRB A;  4ZQL A;  1ZBD B;  4WZ0 A;  3U5N A;  4R2Y A;  3SOW A;  2L80 A;  3KV5 A;  2Y1M A;  4YAT A;  4AYC B;  2JMJ A;  4UP5 A;  2NAA A;  2MNY A;  4QF3 A;  3U5O A;  4F52 B;  2K17 A;  1WGM A;  2IDA A;  2LXH C;  4LKA A;  4R7E A;  1U6G B;  3ZPV E;  4YAD A;  2L75 A;  3KV6 A;  2MD8 C;  3LQH A;  4AUQ B;  3HTK C;  4GNG A;  2E6R A;  4CCG X;  3ZYQ A;  2YSJ A;  4GNE A;  2YSM A;  3RTR B;  3O34 A;  2BAY A;  3N9L A;  5H1T A;  3LRQ A;  2I50 A;  1K2F A;  4BHW A;  3ZPV 1;  3N9N A;  3VK6 A;  4I7B A;  2C2L A;  4FJC A;  4LLB A;  4FIP A;  4MSX A;  4O64 A;  2K1J A;  1G25 A;  3RPG B;  2H0D B;  2KIZ A;  5B76 A;  4W4U A;  3GV4 A;  3MHH A;  3PUR A;  3MHS A;  4PPE A;  4QF2 A;  2KWJ A;  2MA6 A;  2YQL A;  5DKA A;  1WFK A;  3ZTG A;  4N4F A;  3O7A A;  1X4J A;  5JG6 A;  3ZVZ B;  1WEM A;  2KWO A;  3C5K A;  3RPG C;  3QZV A;  3DQV R;  3L1X A;  2M6M A;  4UP0 A;  4A0C D;  2VPE A;  5H9M A;  2MT5 A;  3EB6 A;  2VNF A;  2KFT A;  2L0B A;  3HCU A;  5LKZ A;  3SOX A;  4P5O B;  2EA6 A;  4GND A;  1JM7 B;  2LXP C;  5TDR A;  2K16 A;  2YUR A;  1WIM A;  2KR4 A;  1WEV A;  2MIQ A;  3T7L A;  5KH3 A;  2YHO A;  5LKU A;  5FB1 A;  2G45 A;  2E6S A;  2CKL B;  3DPL R;  3O36 A;  4TKP B;  2YT5 A;  1WIL A;  1MM3 A;  2K4D A;  5I3L A;  2CT2 A;  3PUQ A;  4IC3 A;  2VP7 A;  4YAB A;  5AIT A;  5J3X A;  2YU4 A;  2YRE A;  2YQM A;  2ECJ A;  5B8D A;  4B7Y C;  4LJN A;  2KGG A;  1WEQ A;  2Y43 A;  5G04 B;  4FK5 A;  4YC9 A;  2CKL A;  3T6R A;  4YAX A;  2AN6 A;  2PNX A;  5C11 A;  4S3O C;  1BOR A;  2EOD A;  5FER A;  4YBT A;  1FBV A;  2HYE D;  4V3K C;  2CSY A;  2KE1 A;  2ECN A;  2ECT A;  4WA6 A;  3V43 A;  1IYM A;  5C13 A;  3LQJ A;  4B86 C;  2QJ0 A;  2LGG A;  2EGP A;  3N9Q A;  3U5M A;  5D1L B;  1X4U A;  2VJF A;  2RI7 A;  4L7X A;  4WZ3 B;  4R8P K;  4FO9 A;  2YHN A;  2YW8 A;  1VYX A;  2UZG A;  2F6N A;  5FB0 A;  2ECV A;  5H1U A;  2FUU A;  4X3G A;  4AYC A;  4XI1 A;  1VFY A;  2KGI A;  3O35 A;  2JMI A;  2PUY A;  1FP0 A;  1HYJ A;  4S3O B;  1T1H A;  1X4I A;  3HCS A;  4AVX A;  2VPD A;  4L58 A;  5H1V A;  2F42 A;  3PHD A;  2FUI A;  2QIZ A;  5LCW B;  4GNF A;  3HCT A;  3ASL A;  2ZET C;  4ZDT A;  3M63 A;  3KNV A;  2G6Q A;  2KRE A;  4WZ2 A;  5LKX A;  2KWK A;  3LQI A;  3ZVY A;  2MNZ A;  3FL2 A;  2RSD A;  3SHB A;  2ECG A;  4V3L C;  5B77 A;  4ZUX U;  4AP4 A;  2D8S A;  1WEE A;  4YBS A;  2KYU A;  1Z60 A;  3IHP A;  3U5P A;  1F62 A;  2LV9 A;  3ZNI A;  1WE9 A;  3EB5 A;  4PTB A;  2LN0 A;  3O33 A;  1V87 A;  4GB0 A;  5B78 A;  3L11 A;  2Y1N A;  5TBN A;  1XWH A;  1VD4 A;  3O70 A;  2ECW A;  2L43 A;  4LK9 A;  4YBM A;  2QIC A;  4I7D A;  2VPB A;  5B79 A;  2MD7 B;  5LKT A;  2LDR A;  2FSA A;  5TDW A;  2H0D A;  2LGV A;  1WEO A;  1WEW A;  1RMD A;  1WES A;  5G0F A;  2LGL A;  4CA1 A;  1MM2 A;  3M62 A;  1Z6U A;  4C9Z A;  4A49 A;  2C2V S;  3GL6 A;  2XB1 A;  5EYA F;  2KWN A;  4IC2 A;  3N9M A;  2M1R A;  2YYR A;  5KH7 A;  4NN2 A;  3M99 A;  5B75 A;  3N9O A;  5DIN A;  5KH9 A;  4LAD B;  2MA5 A;  5FEY A;  5TAB A;  5AIU A;  1WEP A;  4I7C A;  2MUM A;  5D1K B;  3SOU A;  1WEU A;  3NG2 A;  3O37 A;  3L1Z B;  4MVT A;  1E4U A;  3I2D A;  4UI9 B;  3KQI A;  1WEN A;  4N3W A;  1Z2Q A;  2M85 A;  5G05 B;  1DVP A;  2JMD A;  2LQ6 A;  4A4B A;  4BBQ A;  2M3H A;  4Q6F A;  2VJE B;  3C6W A;  2YUC A; 
#chains in the Genus database with same CATH topology
 2G43 A;  5SVI A;  2VPG A;  1N87 A;  2OXQ C;  2P57 A;  2XEU A;  2VJF B;  2XOC A;  3LDY A;  2ECI A;  2L5U A;  2LRI C;  2LGK A;  2KU3 A;  2HDP A;  1LDK C;  1HYI A;  1JM7 A;  1CHC A;  5SVY A;  3O47 A;  5D1M B;  2JRJ A;  3N9P A;  1LDJ B;  1JOC A;  2CSZ A;  2DX8 A;  2F6J A;  4A4C A;  2VJE A;  1MBM A;  5TRB A;  4ZQL A;  1ZBD B;  4WZ0 A;  3U5N A;  4R2Y A;  2YVR A;  3SOW A;  4OGE A;  2L80 A;  3DDT A;  2CON A;  3KV5 A;  2Y1M A;  4YAT A;  4AYC B;  2JMJ A;  4UP5 A;  2FD4 A;  2NAA A;  3E2D A;  2MNY A;  4QF3 A;  3U5O A;  4F52 B;  2K17 A;  1WGM A;  2DJA A;  2IDA A;  2LXH C;  4LKA A;  4R7E A;  1U6G B;  3ZPV E;  4YAD A;  2L75 A;  3KV6 A;  3FJU B;  2MD8 C;  3LQH A;  4AUQ B;  3HTK C;  4GNG A;  2E6R A;  4CCG X;  3ZYQ A;  2YSJ A;  4GNE A;  2YSM A;  3RTR B;  5K3Q A;  3O34 A;  2BAY A;  3T9K A;  3N9L A;  2RR4 A;  5H1T A;  3LRQ A;  2I50 A;  1K2F A;  4F1P A;  3ZPV 1;  4BHW A;  3N9N A;  3VK6 A;  4I7B A;  2C2L A;  4FJC A;  4LLB A;  4FIP A;  4MSX A;  3Q1D A;  4O64 A;  2K1J A;  1G25 A;  3RPG B;  2H0D B;  2KIZ A;  5B76 A;  3M7K A;  4W4U A;  2XOZ A;  3GV4 A;  3MHH A;  3PUR A;  3MHS A;  4PPE A;  2CSV A;  4QF2 A;  2L7P A;  2KWJ A;  2MA6 A;  2YQL A;  5DKA A;  1WFK A;  3ZTG A;  4N4F A;  3O7A A;  1X4J A;  5JG6 A;  3ZVZ B;  1WEM A;  2KWO A;  3C5K A;  3RPG C;  3QZV A;  2FFW A;  3DQV R;  3FAN A;  2LAU A;  3L1X A;  2M6M A;  4UP0 A;  4A0C D;  2VPE A;  5H9M A;  2MT5 A;  3EB6 A;  2VNF A;  2KFT A;  2L0B A;  2M13 A;  1DCQ A;  2OWA A;  3HCU A;  5LKZ A;  3SOX A;  4P5O B;  2EA6 A;  4GND A;  1JM7 B;  2LXP C;  5TDR A;  2K16 A;  2YUR A;  1WIM A;  2JM3 A;  2KR4 A;  1WEV A;  2MIQ A;  3T7L A;  5KH3 A;  2YHO A;  5LKU A;  5FB1 A;  2G45 A;  5SVI B;  2E6S A;  2CKL B;  3DPL R;  3O36 A;  4TKP B;  2YT5 A;  1WIL A;  1MM3 A;  2K4D A;  5I3L A;  2D8U A;  2CT2 A;  3PUQ A;  4IC3 A;  2VP7 A;  4YAB A;  5AIT A;  5J3X A;  2YU4 A;  2DSM A;  2YRE A;  2YQM A;  2ECJ A;  5B8D A;  4B7Y C;  4LJN A;  2KGG A;  1WEQ A;  2Y43 A;  5G04 B;  4FK5 A;  4YC9 A;  4Z0O A;  2MKE A;  2CKL A;  3T6R A;  3KDE C;  4YAX A;  2AN6 A;  2PNX A;  5C11 A;  2KKX A;  4S3O C;  1BOR A;  2EOD A;  5FER A;  4YBT A;  1FBV A;  2HYE D;  4V3K C;  2CSY A;  3DWD A;  2KE1 A;  2ECN A;  2JUN A;  2ECT A;  3FEH A;  4WA6 A;  3V43 A;  1IYM A;  5C13 A;  3LQJ A;  4B86 C;  2QJ0 A;  2LGG A;  2EGP A;  3N9Q A;  3U5M A;  5D1L B;  1X4U A;  2VJF A;  2RI7 A;  4L7X A;  4H9D A;  4WZ3 B;  4R8P K;  4FO9 A;  2YHN A;  2YW8 A;  1VYX A;  2UZG A;  3SUB A;  2F6N A;  5FB0 A;  2ECV A;  5H1U A;  2FUU A;  4X3G A;  4AYC A;  4XI1 A;  1VFY A;  2KGI A;  3O35 A;  2JMI A;  2PUY A;  4Z0R A;  1FP0 A;  2CRW A;  4QQ4 A;  1HYJ A;  4S3O B;  1T1H A;  1X4I A;  3HCS A;  4AVX A;  2VPD A;  4L58 A;  5H1V A;  2F42 A;  3LJU X;  3H7H A;  2KKY A;  3PHD A;  2IQJ A;  2FUI A;  2QIZ A;  5LCW B;  3FAO A;  4GNF A;  2CRR A;  3HCT A;  3ASL A;  2ZET C;  4ZDT A;  3M63 A;  3KNV A;  2G6Q A;  2KRE A;  4WZ2 A;  5LKX A;  2KWK A;  3LQI A;  3ZVY A;  2MNZ A;  3FL2 A;  2RSD A;  4OGC A;  3SHB A;  2ECG A;  2B0O E;  4V3L C;  5B77 A;  4ZUX U;  4AP4 A;  2D8S A;  1WEE A;  3LVQ E;  4YBS A;  2KYU A;  1Z60 A;  3IHP A;  3U5P A;  1F62 A;  2LV9 A;  3ZNI A;  1WE9 A;  3EB5 A;  3JUE A;  4PTB A;  2LN0 A;  3O33 A;  1V87 A;  4GB0 A;  5B78 A;  5SVX A;  3L11 A;  2Y1N A;  5TBN A;  1XWH A;  1VD4 A;  3O70 A;  2ECW A;  2L43 A;  4LK9 A;  4YBM A;  2QIC A;  4I7D A;  2VPB A;  5B79 A;  2MD7 B;  5LKT A;  2LDR A;  2FSA A;  5TDW A;  2H0D A;  2LGV A;  2XP0 A;  1WEO A;  1WEW A;  2E61 A;  1RMD A;  1WES A;  3LVR E;  5G0F A;  2LGL A;  4CA1 A;  1MM2 A;  3M62 A;  1Z6U A;  4C9Z A;  4A49 A;  2C2V S;  3GL6 A;  4O62 A;  2XB1 A;  5EYA F;  2KWN A;  4IC2 A;  3FM8 C;  3N9M A;  2M1R A;  2YYR A;  5KH7 A;  4NN2 A;  2EXU A;  2XOY A;  3M99 A;  5B75 A;  3N9O A;  5DIN A;  5KH9 A;  4LAD B;  2MA5 A;  5FEY A;  5TAB A;  5AIU A;  1WEP A;  2EGM A;  4I7C A;  2MUM A;  5D1K B;  3SOU A;  1WEU A;  3NG2 A;  3O37 A;  3L1Z B;  4MVT A;  1E4U A;  3I2D A;  4UI9 B;  3KQI A;  1WEN A;  4N3W A;  1Z2Q A;  2M85 A;  5G05 B;  1DVP A;  2JMD A;  2LQ6 A;  4A4B A;  3MDB C;  4BBQ A;  2M3H A;  3PLW A;  4Q6F A;  2VJE B;  3C6W A;  2YUC A; 
#chains in the Genus database with same CATH homology
 2G43 A;  2VPG A;  1N87 A;  2OXQ C;  2XEU A;  2VJF B;  2ECI A;  2L5U A;  2LRI C;  2LGK A;  2KU3 A;  2HDP A;  1LDK C;  1HYI A;  1JM7 A;  1CHC A;  5D1M B;  2JRJ A;  3N9P A;  1LDJ B;  1JOC A;  2CSZ A;  2DX8 A;  2F6J A;  4A4C A;  2VJE A;  5TRB A;  4ZQL A;  1ZBD B;  4WZ0 A;  3U5N A;  4R2Y A;  3SOW A;  2L80 A;  3KV5 A;  2Y1M A;  4YAT A;  4AYC B;  2JMJ A;  4UP5 A;  2NAA A;  2MNY A;  4QF3 A;  3U5O A;  4F52 B;  2K17 A;  1WGM A;  2IDA A;  2LXH C;  4LKA A;  4R7E A;  1U6G B;  3ZPV E;  4YAD A;  2L75 A;  3KV6 A;  2MD8 C;  3LQH A;  4AUQ B;  3HTK C;  4GNG A;  2E6R A;  4CCG X;  3ZYQ A;  2YSJ A;  4GNE A;  2YSM A;  3RTR B;  3O34 A;  2BAY A;  3N9L A;  5H1T A;  3LRQ A;  2I50 A;  1K2F A;  4BHW A;  3ZPV 1;  3N9N A;  3VK6 A;  4I7B A;  2C2L A;  4FJC A;  4LLB A;  4FIP A;  4MSX A;  4O64 A;  2K1J A;  1G25 A;  3RPG B;  2H0D B;  2KIZ A;  5B76 A;  4W4U A;  3GV4 A;  3MHH A;  3PUR A;  3MHS A;  4PPE A;  4QF2 A;  2KWJ A;  2MA6 A;  2YQL A;  5DKA A;  1WFK A;  3ZTG A;  4N4F A;  3O7A A;  1X4J A;  5JG6 A;  3ZVZ B;  1WEM A;  2KWO A;  3C5K A;  3RPG C;  3QZV A;  3DQV R;  3L1X A;  2M6M A;  4UP0 A;  4A0C D;  2VPE A;  5H9M A;  2MT5 A;  3EB6 A;  2VNF A;  2KFT A;  2L0B A;  3HCU A;  5LKZ A;  3SOX A;  4P5O B;  2EA6 A;  4GND A;  1JM7 B;  2LXP C;  5TDR A;  2K16 A;  2YUR A;  1WIM A;  2KR4 A;  1WEV A;  2MIQ A;  3T7L A;  5KH3 A;  2YHO A;  5LKU A;  5FB1 A;  2G45 A;  2E6S A;  2CKL B;  3DPL R;  3O36 A;  4TKP B;  2YT5 A;  1WIL A;  1MM3 A;  2K4D A;  5I3L A;  2CT2 A;  3PUQ A;  4IC3 A;  2VP7 A;  4YAB A;  5AIT A;  5J3X A;  2YU4 A;  2YRE A;  2YQM A;  2ECJ A;  5B8D A;  4B7Y C;  4LJN A;  2KGG A;  1WEQ A;  2Y43 A;  5G04 B;  4FK5 A;  4YC9 A;  2CKL A;  3T6R A;  4YAX A;  2AN6 A;  2PNX A;  5C11 A;  4S3O C;  1BOR A;  2EOD A;  5FER A;  4YBT A;  1FBV A;  2HYE D;  4V3K C;  2CSY A;  2KE1 A;  2ECN A;  2ECT A;  4WA6 A;  3V43 A;  1IYM A;  5C13 A;  3LQJ A;  4B86 C;  2QJ0 A;  2LGG A;  2EGP A;  3N9Q A;  3U5M A;  5D1L B;  1X4U A;  2VJF A;  2RI7 A;  4L7X A;  4WZ3 B;  4R8P K;  4FO9 A;  2YHN A;  2YW8 A;  1VYX A;  2UZG A;  2F6N A;  5FB0 A;  2ECV A;  5H1U A;  2FUU A;  4X3G A;  4AYC A;  4XI1 A;  1VFY A;  2KGI A;  3O35 A;  2JMI A;  2PUY A;  1FP0 A;  1HYJ A;  4S3O B;  1T1H A;  1X4I A;  3HCS A;  4AVX A;  2VPD A;  4L58 A;  5H1V A;  2F42 A;  3PHD A;  2FUI A;  2QIZ A;  5LCW B;  4GNF A;  3HCT A;  3ASL A;  2ZET C;  4ZDT A;  3M63 A;  3KNV A;  2G6Q A;  2KRE A;  4WZ2 A;  5LKX A;  2KWK A;  3LQI A;  3ZVY A;  2MNZ A;  3FL2 A;  2RSD A;  3SHB A;  2ECG A;  4V3L C;  5B77 A;  4ZUX U;  4AP4 A;  2D8S A;  1WEE A;  4YBS A;  2KYU A;  1Z60 A;  3IHP A;  3U5P A;  1F62 A;  2LV9 A;  3ZNI A;  1WE9 A;  3EB5 A;  4PTB A;  2LN0 A;  3O33 A;  1V87 A;  4GB0 A;  5B78 A;  3L11 A;  2Y1N A;  5TBN A;  1XWH A;  1VD4 A;  3O70 A;  2ECW A;  2L43 A;  4LK9 A;  4YBM A;  2QIC A;  4I7D A;  2VPB A;  5B79 A;  2MD7 B;  5LKT A;  2LDR A;  2FSA A;  5TDW A;  2H0D A;  2LGV A;  1WEO A;  1WEW A;  1RMD A;  1WES A;  5G0F A;  2LGL A;  4CA1 A;  1MM2 A;  3M62 A;  1Z6U A;  4C9Z A;  4A49 A;  2C2V S;  3GL6 A;  2XB1 A;  5EYA F;  2KWN A;  4IC2 A;  3N9M A;  2M1R A;  2YYR A;  5KH7 A;  4NN2 A;  3M99 A;  5B75 A;  3N9O A;  5DIN A;  5KH9 A;  4LAD B;  2MA5 A;  5FEY A;  5TAB A;  5AIU A;  1WEP A;  4I7C A;  2MUM A;  5D1K B;  3SOU A;  1WEU A;  3NG2 A;  3O37 A;  3L1Z B;  4MVT A;  1E4U A;  3I2D A;  4UI9 B;  3KQI A;  1WEN A;  4N3W A;  1Z2Q A;  2M85 A;  5G05 B;  1DVP A;  2JMD A;  2LQ6 A;  4A4B A;  4BBQ A;  2M3H A;  4Q6F A;  2VJE B;  3C6W A;  2YUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...