2JMDA

Solution structure of the ring domain of human traf6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
GPLGSKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF receptor-associated factor 6
publication title Structure, interactions, and dynamics of the RING domain from human TRAF6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 63
sequence length 63
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jmdA00
4V3KC 1FP0A 1IYMA 1RMDA 2KU3A 2EGPA 2KGIA 1N87A 4I7CA 4L58A 4GNGA 4ZUXU 3ZYQA 5C13A 3L1XA 4R2YA 5B77A 4R8PK 5AIUA 1WIMA 2F6JA 2YT5A 4NN2A 5C11A 2YREA 4QF2A 3C5KA 2F42A 2JRJA 2LRIC 3N9MA 1MM2A 3SOXA 3ZNIA 3KQIA 1U6GB 5FB1A 4FK5A 1Z60A 4TKPB 3DQVR 3M99A 3IHPA 5FEYA 3LQHA 2QICA 4FJCA 3NG2A 3ZTGA 2VJEB 4R7EA 2K16A 5H9MA 2PNXA 2FUIA 4W4UA 1WEUA 2MA5A 1WGMA 2KGGA 2K4DA 5DINA 2XB1A 2LDRA 2ECIA 5LKZA 2QJ0A 3LRQA 2OXQC 1WEOA 1ZBDB 3C6WA 1DVPA 3O36A 4X3GA 4FO9A 4AUQB 3HCSA 3SHBA 5TDWA 2YURA 3FL2A 4LKAA 2LGKA 2YQLA 2C2LA 1WEWA 4ZDTA 4YAXA 1MM3A 1E4UA 3GV4A 1FBVA 2VNFA 2MUMA 2M3HA 4N3WA 4S3OC 2ECJA 2YHOA 3I2DA 1WFKA 4XI1A 4S3OB 3RTRB 4AP4A 2LV9A 2IDAA 2YSJA 5FERA 1VYXA 2ECVA 2K1JA 2I50A 2YW8A 4MVTA 4WZ3B 5TDRA 2Y1NA 2M6MA 1XWHA 4GNFA 3U5PA 2KIZA 2JMDA 3M63A 1WENA 5I3LA 2JMJA 4B86C 5D1LB 1LDKC 4L7XA 4GNDA 2H0DA 2ECTA 3KNVA 3T6RA 3MHHA 4BBQA 2KR4A 2L43A 2CSYA 1BORA 3N9LA 2CKLA 2G45A 4YBTA 5H1VA 4LK9A 4UP5A 2EODA 2FSAA 3HCTA 3O33A 3SOWA 3U5MA 3LQIA 5B78A 3HCUA 2KE1A 2KYUA 4CA1A 5LKUA 1WE9A 3N9PA 1VFYA 2NAAA 5J3XA 1LDJB 2VJFA 1X4JA 5D1KB 2K17A 4QF3A 2ECWA 2LXHC 1Z6UA 2L80A 2VP7A 2ZETC 2LQ6A 2RSDA 1JOCA 4YC9A 2ECGA 4N4FA 1WEQA 3O7AA 4AYCA 3O70A 4BHWA 2Y43A 5G0FA 2C2VS 1JM7B 2JMIA 3RPGC 3ASLA 3RPGB 4YABA 4Q6FA 2HYED 5TRBA 2L75A 4GNEA 2M85A 3U5OA 3MHSA 5B75A 4A4CA 3V43A 2KWJA 2LGGA 2EA6A 4UP0A 2PUYA 3N9OA 4LJNA 4F52B 3PURA 4A49A 5G04B 4PPEA 4YATA 4C9ZA 2VPGA 2MNZA 3EB6A 2KFTA 1K2FA 2LGLA 1WEMA 4LLBA 4IC3A 2VPBA 2ECNA 2KWNA 2VPDA 4WA6A 5JG6A 4B7YC 5EYAF 3ZPVE 2MIQA 2MNYA 1G25A 1CHCA 3L1ZB 4YBSA 2YSMA 4MSXA 3KV5A 3T7LA 2KWOA 2D8SA 4A4BA 4GB0A 4PTBA 5KH3A 2KREA 2M1RA 4YADA 5B79A 5TBNA 3QZVA 1VD4A 2KWKA 3EB5A 2YU4A 3U5NA 4YBMA 1HYJA 2QIZA 2MT5A 5H1TA 3N9NA 3N9QA 5B76A 2YQMA 3O34A 2BAYA 2G43A 4ZQLA 1F62A 3LQJA 1WEEA 2VJEA 1WILA 2H0DB 2CT2A 5AITA 2XEUA 3ZPV1 4A0CD 2DX8A 1Z2QA 2YYRA 4CCGX 3L11A 2CKLB 3M62A 4LADB 3ZVZB 4V3LC 3SOUA 1WEVA 4O64A 5KH7A 1X4UA 1WEPA 2E6SA 2F6NA 3VK6A 1HYIA 4I7BA 1V87A 2YHNA 4WZ2A 2VJFB 5B8DA 4FIPA 2MD8C 2VPEA 2LXPC 2L0BA 2MD7B 3O35A 1JM7A 5H1UA 4I7DA 2G6QA 1WESA 2L5UA 4UI9B 2UZGA 3ZVYA 5FB0A 2CSZA 2AN6A 5TABA 5LKXA 5KH9A 2RI7A 4AYCB 5G05B 4WZ0A 4P5OB 5LCWB 3KV6A 2HDPA 5D1MB 2LGVA 2E6RA 3DPLR 3PUQA 2Y1MA 3GL6A 5DKAA 3HTKC 3O37A 2YUCA 5LKTA 4AVXA 4IC2A 2LN0A 2MA6A 3PHDA 1T1HA 2FUUA 1X4IA
chains in the Genus database with same CATH superfamily
4V3KC 1FP0A 1IYMA 1RMDA 2KU3A 3LVQE 2EGPA 2KGIA 2LAUA 1N87A 4I7CA 3FEHA 4L58A 4GNGA 4ZUXU 3ZYQA 5C13A 3FJUB 3L1XA 4R2YA 5B77A 4Z0OA 5AIUA 4R8PK 1WIMA 2F6JA 3SUBA 2YT5A 4NN2A 5C11A 2YREA 4QF2A 3FANA 3C5KA 2F42A 2JRJA 2LRIC 3N9MA 1MM2A 3SOXA 3ZNIA 3KQIA 1U6GB 5FB1A 4FK5A 1Z60A 4TKPB 3H7HA 3DQVR 3JUEA 3M99A 2L7PA 3IHPA 5FEYA 3LQHA 2QICA 4FJCA 3NG2A 3ZTGA 2VJEB 4R7EA 2K16A 5H9MA 2PNXA 4OGEA 2FUIA 4W4UA 1WEUA 2MA5A 4OGCA 1WGMA 2KGGA 2K4DA 5DINA 2XB1A 2LDRA 2ECIA 5LKZA 2CRRA 1MBMA 2QJ0A 3LRQA 2OXQC 1WEOA 1ZBDB 3C6WA 1DVPA 2JUNA 3O36A 4X3GA 4FO9A 4AUQB 3KDEC 3HCSA 5SVIB 3SHBA 5TDWA 2YURA 3FL2A 4LKAA 2LGKA 2YQLA 2C2LA 1WEWA 4ZDTA 4YAXA 4QQ4A 1MM3A 1E4UA 3GV4A 1FBVA 2VNFA 4O62A 2MUMA 2M3HA 4N3WA 4S3OC 2ECJA 2YHOA 3I2DA 1WFKA 2RR4A 4XI1A 4S3OB 3RTRB 4AP4A 3PLWA 2LV9A 2IDAA 2YSJA 5FERA 1VYXA 2ECVA 2K1JA 2XOZA 2I50A 2YW8A 4MVTA 4WZ3B 5TDRA 2Y1NA 2M6MA 1XWHA 2P57A 4GNFA 3U5PA 2KIZA 2JMDA 3M63A 1WENA 5I3LA 3FM8C 2JMJA 3MDBC 4B86C 5D1LB 1LDKC 4L7XA 5SVXA 4GNDA 2H0DA 2ECTA 3KNVA 3T6RA 2KKXA 2DSMA 2YVRA 3MHHA 4BBQA 2KR4A 2L43A 2CSYA 2FD4A 1BORA 3N9LA 2CKLA 2G45A 3DDTA 4YBTA 2B0OE 5H1VA 4LK9A 4UP5A 2EODA 2FSAA 3HCTA 3O33A 3SOWA 3U5MA 3LQIA 5B78A 3HCUA 2KE1A 3DWDA 2KYUA 4CA1A 5LKUA 1WE9A 3N9PA 1VFYA 2NAAA 5J3XA 1LDJB 2VJFA 1X4JA 5D1KB 2K17A 4QF3A 2MKEA 2ECWA 2LXHC 1Z6UA 2L80A 2VP7A 2ZETC 2CONA 2LQ6A 2RSDA 1JOCA 2CRWA 4YC9A 2ECGA 4N4FA 1WEQA 3O7AA 2D8UA 4AYCA 3O70A 4BHWA 1DCQA 2Y43A 5G0FA 2DJAA 2C2VS 2XP0A 1JM7B 2JMIA 3RPGC 2CSVA 3ASLA 3RPGB 4YABA 4Q6FA 2HYED 5TRBA 2L75A 4GNEA 2M85A 3U5OA 3MHSA 5B75A 4A4CA 3V43A 2KWJA 2LGGA 2E61A 2EA6A 4UP0A 2JM3A 2PUYA 3N9OA 4LJNA 4F52B 3PURA 4A49A 5G04B 4PPEA 4YATA 4C9ZA 4F1PA 2VPGA 3O47A 2MNZA 3EB6A 2KFTA 1K2FA 3E2DA 2LGLA 1WEMA 4LLBA 4IC3A 4Z0RA 2VPBA 2ECNA 2KWNA 2VPDA 4WA6A 5JG6A 4B7YC 5EYAF 3ZPVE 2MIQA 2MNYA 1G25A 1CHCA 2M13A 3L1ZB 4YBSA 2YSMA 4MSXA 3KV5A 3T7LA 3T9KA 2KWOA 2D8SA 4A4BA 4GB0A 4PTBA 5KH3A 2KREA 2M1RA 4YADA 5B79A 5TBNA 3QZVA 1VD4A 2KWKA 5K3QA 2KKYA 3EB5A 2YU4A 3LVRE 3LJUX 3U5NA 4YBMA 1HYJA 2QIZA 5SVYA 2MT5A 5H1TA 3N9NA 3N9QA 5B76A 2YQMA 3O34A 2BAYA 2G43A 4ZQLA 1F62A 3LQJA 1WEEA 2VJEA 1WILA 2H0DB 2CT2A 5AITA 2XEUA 3ZPV1 4A0CD 2DX8A 1Z2QA 2YYRA 4CCGX 3L11A 2CKLB 3M62A 4LADB 2EXUA 3ZVZB 3Q1DA 4V3LC 1WEVA 3SOUA 3LDYA 4H9DA 4O64A 5KH7A 2FFWA 1X4UA 1WEPA 2E6SA 2F6NA 3VK6A 1HYIA 4I7BA 1V87A 2YHNA 4WZ2A 2VJFB 5B8DA 4FIPA 2MD8C 2VPEA 2LXPC 3FAOA 2L0BA 2MD7B 3O35A 1JM7A 5H1UA 2EGMA 4I7DA 5SVIA 2G6QA 1WESA 2L5UA 4UI9B 2UZGA 3ZVYA 5FB0A 2CSZA 2AN6A 5TABA 5LKXA 5KH9A 2RI7A 4AYCB 5G05B 4WZ0A 4P5OB 5LCWB 3KV6A 2HDPA 5D1MB 2LGVA 2E6RA 3DPLR 3PUQA 2Y1MA 3GL6A 5DKAA 3HTKC 3O37A 2YUCA 3M7KA 2XOYA 5LKTA 4AVXA 4IC2A 2LN0A 2MA6A 2OWAA 3PHDA 1T1HA 2IQJA 2FUUA 1X4IA 2XOCA
chains in the Genus database with same CATH topology
4V3KC 1FP0A 1IYMA 1RMDA 2KU3A 2EGPA 2KGIA 1N87A 4I7CA 4L58A 4GNGA 4ZUXU 3ZYQA 5C13A 3L1XA 4R2YA 5B77A 4R8PK 5AIUA 1WIMA 2F6JA 2YT5A 4NN2A 5C11A 2YREA 4QF2A 3C5KA 2F42A 2JRJA 2LRIC 3N9MA 1MM2A 3SOXA 3ZNIA 3KQIA 1U6GB 5FB1A 4FK5A 1Z60A 4TKPB 3DQVR 3M99A 3IHPA 5FEYA 3LQHA 2QICA 4FJCA 3NG2A 3ZTGA 2VJEB 4R7EA 2K16A 5H9MA 2PNXA 2FUIA 4W4UA 1WEUA 2MA5A 1WGMA 2KGGA 2K4DA 5DINA 2XB1A 2LDRA 2ECIA 5LKZA 2QJ0A 3LRQA 2OXQC 1WEOA 1ZBDB 3C6WA 1DVPA 3O36A 4X3GA 4FO9A 4AUQB 3HCSA 3SHBA 5TDWA 2YURA 3FL2A 4LKAA 2LGKA 2YQLA 2C2LA 1WEWA 4ZDTA 4YAXA 1MM3A 1E4UA 3GV4A 1FBVA 2VNFA 2MUMA 2M3HA 4N3WA 4S3OC 2ECJA 2YHOA 3I2DA 1WFKA 4XI1A 4S3OB 3RTRB 4AP4A 2LV9A 2IDAA 2YSJA 5FERA 1VYXA 2ECVA 2K1JA 2I50A 2YW8A 4MVTA 4WZ3B 5TDRA 2Y1NA 2M6MA 1XWHA 4GNFA 3U5PA 2KIZA 2JMDA 3M63A 1WENA 5I3LA 2JMJA 4B86C 5D1LB 1LDKC 4L7XA 4GNDA 2H0DA 2ECTA 3KNVA 3T6RA 3MHHA 4BBQA 2KR4A 2L43A 2CSYA 1BORA 3N9LA 2CKLA 2G45A 4YBTA 5H1VA 4LK9A 4UP5A 2EODA 2FSAA 3HCTA 3O33A 3SOWA 3U5MA 3LQIA 5B78A 3HCUA 2KE1A 2KYUA 4CA1A 5LKUA 1WE9A 3N9PA 1VFYA 2NAAA 5J3XA 1LDJB 2VJFA 1X4JA 5D1KB 2K17A 4QF3A 2ECWA 2LXHC 1Z6UA 2L80A 2VP7A 2ZETC 2LQ6A 2RSDA 1JOCA 4YC9A 2ECGA 4N4FA 1WEQA 3O7AA 4AYCA 3O70A 4BHWA 2Y43A 5G0FA 2C2VS 1JM7B 2JMIA 3RPGC 3ASLA 3RPGB 4YABA 4Q6FA 2HYED 5TRBA 2L75A 4GNEA 2M85A 3U5OA 3MHSA 5B75A 4A4CA 3V43A 2KWJA 2LGGA 2EA6A 4UP0A 2PUYA 3N9OA 4LJNA 4F52B 3PURA 4A49A 5G04B 4PPEA 4YATA 4C9ZA 2VPGA 2MNZA 3EB6A 2KFTA 1K2FA 2LGLA 1WEMA 4LLBA 4IC3A 2VPBA 2ECNA 2KWNA 2VPDA 4WA6A 5JG6A 4B7YC 5EYAF 3ZPVE 2MIQA 2MNYA 1G25A 1CHCA 3L1ZB 4YBSA 2YSMA 4MSXA 3KV5A 3T7LA 2KWOA 2D8SA 4A4BA 4GB0A 4PTBA 5KH3A 2KREA 2M1RA 4YADA 5B79A 5TBNA 3QZVA 1VD4A 2KWKA 3EB5A 2YU4A 3U5NA 4YBMA 1HYJA 2QIZA 2MT5A 5H1TA 3N9NA 3N9QA 5B76A 2YQMA 3O34A 2BAYA 2G43A 4ZQLA 1F62A 3LQJA 1WEEA 2VJEA 1WILA 2H0DB 2CT2A 5AITA 2XEUA 3ZPV1 4A0CD 2DX8A 1Z2QA 2YYRA 4CCGX 3L11A 2CKLB 3M62A 4LADB 3ZVZB 4V3LC 3SOUA 1WEVA 4O64A 5KH7A 1X4UA 1WEPA 2E6SA 2F6NA 3VK6A 1HYIA 4I7BA 1V87A 2YHNA 4WZ2A 2VJFB 5B8DA 4FIPA 2MD8C 2VPEA 2LXPC 2L0BA 2MD7B 3O35A 1JM7A 5H1UA 4I7DA 2G6QA 1WESA 2L5UA 4UI9B 2UZGA 3ZVYA 5FB0A 2CSZA 2AN6A 5TABA 5LKXA 5KH9A 2RI7A 4AYCB 5G05B 4WZ0A 4P5OB 5LCWB 3KV6A 2HDPA 5D1MB 2LGVA 2E6RA 3DPLR 3PUQA 2Y1MA 3GL6A 5DKAA 3HTKC 3O37A 2YUCA 5LKTA 4AVXA 4IC2A 2LN0A 2MA6A 3PHDA 1T1HA 2FUUA 1X4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3K C;  1FP0 A;  1IYM A;  1RMD A;  2KU3 A;  2EGP A;  2KGI A;  1N87 A;  4I7C A;  4L58 A;  4GNG A;  4ZUX U;  3ZYQ A;  5C13 A;  3L1X A;  4R2Y A;  5B77 A;  4R8P K;  5AIU A;  1WIM A;  2F6J A;  2YT5 A;  4NN2 A;  5C11 A;  2YRE A;  4QF2 A;  3C5K A;  2F42 A;  2JRJ A;  2LRI C;  3N9M A;  1MM2 A;  3SOX A;  3ZNI A;  3KQI A;  1U6G B;  5FB1 A;  4FK5 A;  1Z60 A;  4TKP B;  3DQV R;  3M99 A;  3IHP A;  5FEY A;  3LQH A;  2QIC A;  4FJC A;  3NG2 A;  3ZTG A;  2VJE B;  4R7E A;  2K16 A;  5H9M A;  2PNX A;  2FUI A;  4W4U A;  1WEU A;  2MA5 A;  1WGM A;  2KGG A;  2K4D A;  5DIN A;  2XB1 A;  2LDR A;  2ECI A;  5LKZ A;  2QJ0 A;  3LRQ A;  2OXQ C;  1WEO A;  1ZBD B;  3C6W A;  1DVP A;  3O36 A;  4X3G A;  4FO9 A;  4AUQ B;  3HCS A;  3SHB A;  5TDW A;  2YUR A;  3FL2 A;  4LKA A;  2LGK A;  2YQL A;  2C2L A;  1WEW A;  4ZDT A;  4YAX A;  1MM3 A;  1E4U A;  3GV4 A;  1FBV A;  2VNF A;  2MUM A;  2M3H A;  4N3W A;  4S3O C;  2ECJ A;  2YHO A;  3I2D A;  1WFK A;  4XI1 A;  4S3O B;  3RTR B;  4AP4 A;  2LV9 A;  2IDA A;  2YSJ A;  5FER A;  1VYX A;  2ECV A;  2K1J A;  2I50 A;  2YW8 A;  4MVT A;  4WZ3 B;  5TDR A;  2Y1N A;  2M6M A;  1XWH A;  4GNF A;  3U5P A;  2KIZ A;  2JMD A;  3M63 A;  1WEN A;  5I3L A;  2JMJ A;  4B86 C;  5D1L B;  1LDK C;  4L7X A;  4GND A;  2H0D A;  2ECT A;  3KNV A;  3T6R A;  3MHH A;  4BBQ A;  2KR4 A;  2L43 A;  2CSY A;  1BOR A;  3N9L A;  2CKL A;  2G45 A;  4YBT A;  5H1V A;  4LK9 A;  4UP5 A;  2EOD A;  2FSA A;  3HCT A;  3O33 A;  3SOW A;  3U5M A;  3LQI A;  5B78 A;  3HCU A;  2KE1 A;  2KYU A;  4CA1 A;  5LKU A;  1WE9 A;  3N9P A;  1VFY A;  2NAA A;  5J3X A;  1LDJ B;  2VJF A;  1X4J A;  5D1K B;  2K17 A;  4QF3 A;  2ECW A;  2LXH C;  1Z6U A;  2L80 A;  2VP7 A;  2ZET C;  2LQ6 A;  2RSD A;  1JOC A;  4YC9 A;  2ECG A;  4N4F A;  1WEQ A;  3O7A A;  4AYC A;  3O70 A;  4BHW A;  2Y43 A;  5G0F A;  2C2V S;  1JM7 B;  2JMI A;  3RPG C;  3ASL A;  3RPG B;  4YAB A;  4Q6F A;  2HYE D;  5TRB A;  2L75 A;  4GNE A;  2M85 A;  3U5O A;  3MHS A;  5B75 A;  4A4C A;  3V43 A;  2KWJ A;  2LGG A;  2EA6 A;  4UP0 A;  2PUY A;  3N9O A;  4LJN A;  4F52 B;  3PUR A;  4A49 A;  5G04 B;  4PPE A;  4YAT A;  4C9Z A;  2VPG A;  2MNZ A;  3EB6 A;  2KFT A;  1K2F A;  2LGL A;  1WEM A;  4LLB A;  4IC3 A;  2VPB A;  2ECN A;  2KWN A;  2VPD A;  4WA6 A;  5JG6 A;  4B7Y C;  5EYA F;  3ZPV E;  2MIQ A;  2MNY A;  1G25 A;  1CHC A;  3L1Z B;  4YBS A;  2YSM A;  4MSX A;  3KV5 A;  3T7L A;  2KWO A;  2D8S A;  4A4B A;  4GB0 A;  4PTB A;  5KH3 A;  2KRE A;  2M1R A;  4YAD A;  5B79 A;  5TBN A;  3QZV A;  1VD4 A;  2KWK A;  3EB5 A;  2YU4 A;  3U5N A;  4YBM A;  1HYJ A;  2QIZ A;  2MT5 A;  5H1T A;  3N9N A;  3N9Q A;  5B76 A;  2YQM A;  3O34 A;  2BAY A;  2G43 A;  4ZQL A;  1F62 A;  3LQJ A;  1WEE A;  2VJE A;  1WIL A;  2H0D B;  2CT2 A;  5AIT A;  2XEU A;  3ZPV 1;  4A0C D;  2DX8 A;  1Z2Q A;  2YYR A;  4CCG X;  3L11 A;  2CKL B;  3M62 A;  4LAD B;  3ZVZ B;  4V3L C;  3SOU A;  1WEV A;  4O64 A;  5KH7 A;  1X4U A;  1WEP A;  2E6S A;  2F6N A;  3VK6 A;  1HYI A;  4I7B A;  1V87 A;  2YHN A;  4WZ2 A;  2VJF B;  5B8D A;  4FIP A;  2MD8 C;  2VPE A;  2LXP C;  2L0B A;  2MD7 B;  3O35 A;  1JM7 A;  5H1U A;  4I7D A;  2G6Q A;  1WES A;  2L5U A;  4UI9 B;  2UZG A;  3ZVY A;  5FB0 A;  2CSZ A;  2AN6 A;  5TAB A;  5LKX A;  5KH9 A;  2RI7 A;  4AYC B;  5G05 B;  4WZ0 A;  4P5O B;  5LCW B;  3KV6 A;  2HDP A;  5D1M B;  2LGV A;  2E6R A;  3DPL R;  3PUQ A;  2Y1M A;  3GL6 A;  5DKA A;  3HTK C;  3O37 A;  2YUC A;  5LKT A;  4AVX A;  4IC2 A;  2LN0 A;  2MA6 A;  3PHD A;  1T1H A;  2FUU A;  1X4I A; 
#chains in the Genus database with same CATH topology
 4V3K C;  1FP0 A;  1IYM A;  1RMD A;  2KU3 A;  3LVQ E;  2EGP A;  2KGI A;  2LAU A;  1N87 A;  4I7C A;  3FEH A;  4L58 A;  4GNG A;  4ZUX U;  3ZYQ A;  5C13 A;  3FJU B;  3L1X A;  4R2Y A;  5B77 A;  4Z0O A;  5AIU A;  4R8P K;  1WIM A;  2F6J A;  3SUB A;  2YT5 A;  4NN2 A;  5C11 A;  2YRE A;  4QF2 A;  3FAN A;  3C5K A;  2F42 A;  2JRJ A;  2LRI C;  3N9M A;  1MM2 A;  3SOX A;  3ZNI A;  3KQI A;  1U6G B;  5FB1 A;  4FK5 A;  1Z60 A;  4TKP B;  3H7H A;  3DQV R;  3JUE A;  3M99 A;  2L7P A;  3IHP A;  5FEY A;  3LQH A;  2QIC A;  4FJC A;  3NG2 A;  3ZTG A;  2VJE B;  4R7E A;  2K16 A;  5H9M A;  2PNX A;  4OGE A;  2FUI A;  4W4U A;  1WEU A;  2MA5 A;  4OGC A;  1WGM A;  2KGG A;  2K4D A;  5DIN A;  2XB1 A;  2LDR A;  2ECI A;  5LKZ A;  2CRR A;  1MBM A;  2QJ0 A;  3LRQ A;  2OXQ C;  1WEO A;  1ZBD B;  3C6W A;  1DVP A;  2JUN A;  3O36 A;  4X3G A;  4FO9 A;  4AUQ B;  3KDE C;  3HCS A;  5SVI B;  3SHB A;  5TDW A;  2YUR A;  3FL2 A;  4LKA A;  2LGK A;  2YQL A;  2C2L A;  1WEW A;  4ZDT A;  4YAX A;  4QQ4 A;  1MM3 A;  1E4U A;  3GV4 A;  1FBV A;  2VNF A;  4O62 A;  2MUM A;  2M3H A;  4N3W A;  4S3O C;  2ECJ A;  2YHO A;  3I2D A;  1WFK A;  2RR4 A;  4XI1 A;  4S3O B;  3RTR B;  4AP4 A;  3PLW A;  2LV9 A;  2IDA A;  2YSJ A;  5FER A;  1VYX A;  2ECV A;  2K1J A;  2XOZ A;  2I50 A;  2YW8 A;  4MVT A;  4WZ3 B;  5TDR A;  2Y1N A;  2M6M A;  1XWH A;  2P57 A;  4GNF A;  3U5P A;  2KIZ A;  2JMD A;  3M63 A;  1WEN A;  5I3L A;  3FM8 C;  2JMJ A;  3MDB C;  4B86 C;  5D1L B;  1LDK C;  4L7X A;  5SVX A;  4GND A;  2H0D A;  2ECT A;  3KNV A;  3T6R A;  2KKX A;  2DSM A;  2YVR A;  3MHH A;  4BBQ A;  2KR4 A;  2L43 A;  2CSY A;  2FD4 A;  1BOR A;  3N9L A;  2CKL A;  2G45 A;  3DDT A;  4YBT A;  2B0O E;  5H1V A;  4LK9 A;  4UP5 A;  2EOD A;  2FSA A;  3HCT A;  3O33 A;  3SOW A;  3U5M A;  3LQI A;  5B78 A;  3HCU A;  2KE1 A;  3DWD A;  2KYU A;  4CA1 A;  5LKU A;  1WE9 A;  3N9P A;  1VFY A;  2NAA A;  5J3X A;  1LDJ B;  2VJF A;  1X4J A;  5D1K B;  2K17 A;  4QF3 A;  2MKE A;  2ECW A;  2LXH C;  1Z6U A;  2L80 A;  2VP7 A;  2ZET C;  2CON A;  2LQ6 A;  2RSD A;  1JOC A;  2CRW A;  4YC9 A;  2ECG A;  4N4F A;  1WEQ A;  3O7A A;  2D8U A;  4AYC A;  3O70 A;  4BHW A;  1DCQ A;  2Y43 A;  5G0F A;  2DJA A;  2C2V S;  2XP0 A;  1JM7 B;  2JMI A;  3RPG C;  2CSV A;  3ASL A;  3RPG B;  4YAB A;  4Q6F A;  2HYE D;  5TRB A;  2L75 A;  4GNE A;  2M85 A;  3U5O A;  3MHS A;  5B75 A;  4A4C A;  3V43 A;  2KWJ A;  2LGG A;  2E61 A;  2EA6 A;  4UP0 A;  2JM3 A;  2PUY A;  3N9O A;  4LJN A;  4F52 B;  3PUR A;  4A49 A;  5G04 B;  4PPE A;  4YAT A;  4C9Z A;  4F1P A;  2VPG A;  3O47 A;  2MNZ A;  3EB6 A;  2KFT A;  1K2F A;  3E2D A;  2LGL A;  1WEM A;  4LLB A;  4IC3 A;  4Z0R A;  2VPB A;  2ECN A;  2KWN A;  2VPD A;  4WA6 A;  5JG6 A;  4B7Y C;  5EYA F;  3ZPV E;  2MIQ A;  2MNY A;  1G25 A;  1CHC A;  2M13 A;  3L1Z B;  4YBS A;  2YSM A;  4MSX A;  3KV5 A;  3T7L A;  3T9K A;  2KWO A;  2D8S A;  4A4B A;  4GB0 A;  4PTB A;  5KH3 A;  2KRE A;  2M1R A;  4YAD A;  5B79 A;  5TBN A;  3QZV A;  1VD4 A;  2KWK A;  5K3Q A;  2KKY A;  3EB5 A;  2YU4 A;  3LVR E;  3LJU X;  3U5N A;  4YBM A;  1HYJ A;  2QIZ A;  5SVY A;  2MT5 A;  5H1T A;  3N9N A;  3N9Q A;  5B76 A;  2YQM A;  3O34 A;  2BAY A;  2G43 A;  4ZQL A;  1F62 A;  3LQJ A;  1WEE A;  2VJE A;  1WIL A;  2H0D B;  2CT2 A;  5AIT A;  2XEU A;  3ZPV 1;  4A0C D;  2DX8 A;  1Z2Q A;  2YYR A;  4CCG X;  3L11 A;  2CKL B;  3M62 A;  4LAD B;  2EXU A;  3ZVZ B;  3Q1D A;  4V3L C;  1WEV A;  3SOU A;  3LDY A;  4H9D A;  4O64 A;  5KH7 A;  2FFW A;  1X4U A;  1WEP A;  2E6S A;  2F6N A;  3VK6 A;  1HYI A;  4I7B A;  1V87 A;  2YHN A;  4WZ2 A;  2VJF B;  5B8D A;  4FIP A;  2MD8 C;  2VPE A;  2LXP C;  3FAO A;  2L0B A;  2MD7 B;  3O35 A;  1JM7 A;  5H1U A;  2EGM A;  4I7D A;  5SVI A;  2G6Q A;  1WES A;  2L5U A;  4UI9 B;  2UZG A;  3ZVY A;  5FB0 A;  2CSZ A;  2AN6 A;  5TAB A;  5LKX A;  5KH9 A;  2RI7 A;  4AYC B;  5G05 B;  4WZ0 A;  4P5O B;  5LCW B;  3KV6 A;  2HDP A;  5D1M B;  2LGV A;  2E6R A;  3DPL R;  3PUQ A;  2Y1M A;  3GL6 A;  5DKA A;  3HTK C;  3O37 A;  2YUC A;  3M7K A;  2XOY A;  5LKT A;  4AVX A;  4IC2 A;  2LN0 A;  2MA6 A;  2OWA A;  3PHD A;  1T1H A;  2IQJ A;  2FUU A;  1X4I A;  2XOC A; 
#chains in the Genus database with same CATH homology
 4V3K C;  1FP0 A;  1IYM A;  1RMD A;  2KU3 A;  2EGP A;  2KGI A;  1N87 A;  4I7C A;  4L58 A;  4GNG A;  4ZUX U;  3ZYQ A;  5C13 A;  3L1X A;  4R2Y A;  5B77 A;  4R8P K;  5AIU A;  1WIM A;  2F6J A;  2YT5 A;  4NN2 A;  5C11 A;  2YRE A;  4QF2 A;  3C5K A;  2F42 A;  2JRJ A;  2LRI C;  3N9M A;  1MM2 A;  3SOX A;  3ZNI A;  3KQI A;  1U6G B;  5FB1 A;  4FK5 A;  1Z60 A;  4TKP B;  3DQV R;  3M99 A;  3IHP A;  5FEY A;  3LQH A;  2QIC A;  4FJC A;  3NG2 A;  3ZTG A;  2VJE B;  4R7E A;  2K16 A;  5H9M A;  2PNX A;  2FUI A;  4W4U A;  1WEU A;  2MA5 A;  1WGM A;  2KGG A;  2K4D A;  5DIN A;  2XB1 A;  2LDR A;  2ECI A;  5LKZ A;  2QJ0 A;  3LRQ A;  2OXQ C;  1WEO A;  1ZBD B;  3C6W A;  1DVP A;  3O36 A;  4X3G A;  4FO9 A;  4AUQ B;  3HCS A;  3SHB A;  5TDW A;  2YUR A;  3FL2 A;  4LKA A;  2LGK A;  2YQL A;  2C2L A;  1WEW A;  4ZDT A;  4YAX A;  1MM3 A;  1E4U A;  3GV4 A;  1FBV A;  2VNF A;  2MUM A;  2M3H A;  4N3W A;  4S3O C;  2ECJ A;  2YHO A;  3I2D A;  1WFK A;  4XI1 A;  4S3O B;  3RTR B;  4AP4 A;  2LV9 A;  2IDA A;  2YSJ A;  5FER A;  1VYX A;  2ECV A;  2K1J A;  2I50 A;  2YW8 A;  4MVT A;  4WZ3 B;  5TDR A;  2Y1N A;  2M6M A;  1XWH A;  4GNF A;  3U5P A;  2KIZ A;  2JMD A;  3M63 A;  1WEN A;  5I3L A;  2JMJ A;  4B86 C;  5D1L B;  1LDK C;  4L7X A;  4GND A;  2H0D A;  2ECT A;  3KNV A;  3T6R A;  3MHH A;  4BBQ A;  2KR4 A;  2L43 A;  2CSY A;  1BOR A;  3N9L A;  2CKL A;  2G45 A;  4YBT A;  5H1V A;  4LK9 A;  4UP5 A;  2EOD A;  2FSA A;  3HCT A;  3O33 A;  3SOW A;  3U5M A;  3LQI A;  5B78 A;  3HCU A;  2KE1 A;  2KYU A;  4CA1 A;  5LKU A;  1WE9 A;  3N9P A;  1VFY A;  2NAA A;  5J3X A;  1LDJ B;  2VJF A;  1X4J A;  5D1K B;  2K17 A;  4QF3 A;  2ECW A;  2LXH C;  1Z6U A;  2L80 A;  2VP7 A;  2ZET C;  2LQ6 A;  2RSD A;  1JOC A;  4YC9 A;  2ECG A;  4N4F A;  1WEQ A;  3O7A A;  4AYC A;  3O70 A;  4BHW A;  2Y43 A;  5G0F A;  2C2V S;  1JM7 B;  2JMI A;  3RPG C;  3ASL A;  3RPG B;  4YAB A;  4Q6F A;  2HYE D;  5TRB A;  2L75 A;  4GNE A;  2M85 A;  3U5O A;  3MHS A;  5B75 A;  4A4C A;  3V43 A;  2KWJ A;  2LGG A;  2EA6 A;  4UP0 A;  2PUY A;  3N9O A;  4LJN A;  4F52 B;  3PUR A;  4A49 A;  5G04 B;  4PPE A;  4YAT A;  4C9Z A;  2VPG A;  2MNZ A;  3EB6 A;  2KFT A;  1K2F A;  2LGL A;  1WEM A;  4LLB A;  4IC3 A;  2VPB A;  2ECN A;  2KWN A;  2VPD A;  4WA6 A;  5JG6 A;  4B7Y C;  5EYA F;  3ZPV E;  2MIQ A;  2MNY A;  1G25 A;  1CHC A;  3L1Z B;  4YBS A;  2YSM A;  4MSX A;  3KV5 A;  3T7L A;  2KWO A;  2D8S A;  4A4B A;  4GB0 A;  4PTB A;  5KH3 A;  2KRE A;  2M1R A;  4YAD A;  5B79 A;  5TBN A;  3QZV A;  1VD4 A;  2KWK A;  3EB5 A;  2YU4 A;  3U5N A;  4YBM A;  1HYJ A;  2QIZ A;  2MT5 A;  5H1T A;  3N9N A;  3N9Q A;  5B76 A;  2YQM A;  3O34 A;  2BAY A;  2G43 A;  4ZQL A;  1F62 A;  3LQJ A;  1WEE A;  2VJE A;  1WIL A;  2H0D B;  2CT2 A;  5AIT A;  2XEU A;  3ZPV 1;  4A0C D;  2DX8 A;  1Z2Q A;  2YYR A;  4CCG X;  3L11 A;  2CKL B;  3M62 A;  4LAD B;  3ZVZ B;  4V3L C;  3SOU A;  1WEV A;  4O64 A;  5KH7 A;  1X4U A;  1WEP A;  2E6S A;  2F6N A;  3VK6 A;  1HYI A;  4I7B A;  1V87 A;  2YHN A;  4WZ2 A;  2VJF B;  5B8D A;  4FIP A;  2MD8 C;  2VPE A;  2LXP C;  2L0B A;  2MD7 B;  3O35 A;  1JM7 A;  5H1U A;  4I7D A;  2G6Q A;  1WES A;  2L5U A;  4UI9 B;  2UZG A;  3ZVY A;  5FB0 A;  2CSZ A;  2AN6 A;  5TAB A;  5LKX A;  5KH9 A;  2RI7 A;  4AYC B;  5G05 B;  4WZ0 A;  4P5O B;  5LCW B;  3KV6 A;  2HDP A;  5D1M B;  2LGV A;  2E6R A;  3DPL R;  3PUQ A;  2Y1M A;  3GL6 A;  5DKA A;  3HTK C;  3O37 A;  2YUC A;  5LKT A;  4AVX A;  4IC2 A;  2LN0 A;  2MA6 A;  3PHD A;  1T1H A;  2FUU A;  1X4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...