4V3KC

Rnf38-ubch5b-ub complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
KADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Activation of a Primed Ring E3-E2-Ubiquitin Complex by Non-Covalent Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
total genus 14
structure length 75
sequence length 75
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4v3kC00
2KREA 3GL6A 2KU3A 2D8SA 4UP5A 3QZVA 1FP0A 2MNZA 2HDPA 5G0FA 4YBMA 3ZVZB 5TBNA 5D1LB 3ZVYA 4W4UA 2L5UA 3L1ZB 2G6QA 3EB5A 1WEMA 5B78A 2VPDA 2L75A 3HCSA 2LXPC 4FK5A 1BORA 2M85A 2LGKA 4A4CA 3N9LA 5B75A 4X3GA 4LLBA 1WEQA 5DINA 3MHSA 3C5KA 2NAAA 1F62A 2KGGA 2DX8A 4UP0A 4I7CA 4AYCA 3LQJA 2MT5A 4L58A 4R7EA 5LKZA 2LDRA 5AIUA 3GV4A 4Q6FA 3KQIA 3HCUA 1JM7A 2ZETC 4PTBA 4YABA 2MUMA 2XB1A 1XWHA 4WZ3B 4IC2A 4YAXA 5TDWA 2ECGA 2KE1A 2MA6A 2F6JA 4YC9A 3O70A 2E6SA 4P5OB 3U5MA 3N9QA 3O36A 1VYXA 3PURA 2YURA 3ZTGA 4GNGA 1HYIA 5FB1A 4L7XA 4NN2A 1VFYA 3U5PA 2YREA 3DPLR 4B7YC 1MM2A 5G05B 2KR4A 2KWKA 5JG6A 4WA6A 3ZYQA 5B76A 1HYJA 2H0DB 5DKAA 3NG2A 2LGLA 5TDRA 3RTRB 3N9PA 5LKTA 2MIQA 2BAYA 2LGVA 5I3LA 5KH7A 3FL2A 2YUCA 1WEVA 4A0CD 4UI9B 2LXHC 1X4IA 3DQVR 4LK9A 3M99A 3L11A 5KH3A 1V87A 3V43A 2EA6A 1X4JA 2L80A 1LDKC 1WILA 2YSMA 4V3KC 2ECJA 5B8DA 3U5NA 2FUIA 4BBQA 2OXQC 1JOCA 2KFTA 2YU4A 3SOUA 3O33A 2G43A 2VJFA 2ECNA 2LV9A 3SHBA 4XI1A 3M62A 2QICA 2IDAA 4I7BA 2JMJA 4YBTA 1Z2QA 3LQIA 3T7LA 4GB0A 3LQHA 4GNFA 3PHDA 4CCGX 1U6GB 2KWOA 2YQLA 3I2DA 4F52B 4ZUXU 1N87A 1Z60A 2CSZA 1E4UA 4CA1A 2F6NA 2QIZA 1ZBDB 2KIZA 2EGPA 4S3OB 2Y1MA 5TABA 4LADB 2PUYA 3C6WA 2VJEA 1Z6UA 3IHPA 3RPGC 2YQMA 2YYRA 5H1VA 2E6RA 2LN0A 1CHCA 2K17A 5FERA 2K16A 4AVXA 5B77A 1X4UA 5C11A 3ZPV1 5B79A 2K4DA 1FBVA 5AITA 2LRIC 4A4BA 4BHWA 3ZNIA 2M3HA 2YT5A 1G25A 3KV6A 4N4FA 1T1HA 4ZDTA 4O64A 4GNEA 2L43A 5H1UA 1VD4A 3O7AA 2KYUA 5D1KB 4R2YA 2RSDA 2M1RA 4B86C 2M6MA 2L0BA 4IC3A 2KWNA 2Y43A 5J3XA 3L1XA 3N9NA 2QJ0A 1WENA 3HTKC 2F42A 2AN6A 2CKLB 2MA5A 2ECWA 1WFKA 2VPGA 5FEYA 5H9MA 3KV5A 4AP4A 2LGGA 1K2FA 4QF3A 3KNVA 2K1JA 1DVPA 1WEOA 5KH9A 2MD7B 3RPGB 2VJFB 3ASLA 5FB0A 4S3OC 4YBSA 2VJEB 5G04B 3LRQA 4FO9A 3ZPVE 3M63A 4PPEA 5H1TA 3U5OA 2JRJA 2VPBA 5D1MB 4LJNA 2MNYA 2RI7A 4V3LC 4WZ0A 3O34A 2XEUA 2ECIA 2CT2A 2YW8A 1WEWA 2HYED 3O35A 3N9MA 2YHOA 4C9ZA 5EYAF 1IYMA 2YSJA 2VPEA 3SOWA 4AUQB 2VP7A 2EODA 2PNXA 2ECTA 4I7DA 2MD8C 2CSYA 5LKUA 1WEEA 5C13A 4MVTA 3T6RA 2FUUA 4ZQLA 4R8PK 4YATA 2C2VS 4FIPA 1LDJB 2ECVA 3SOXA 4LKAA 4A49A 2H0DA 2LQ6A 4TKPB 5LCWB 2G45A 5LKXA 2JMDA 2UZGA 1MM3A 5TRBA 4N3WA 2CKLA 2YHNA 2C2LA 2KWJA 1WE9A 2JMIA 2Y1NA 3O37A 3N9OA 1RMDA 2FSAA 4MSXA 1WIMA 2VNFA 1WGMA 4QF2A 2I50A 3PUQA 1WEPA 4YADA 4FJCA 1WESA 1JM7B 4WZ2A 3EB6A 3MHHA 3VK6A 4AYCB 4GNDA 3HCTA 2KGIA 1WEUA
chains in the Genus database with same CATH superfamily
2KREA 3GL6A 2KU3A 2D8SA 4UP5A 3QZVA 3LJUX 1FP0A 2MNZA 2HDPA 5G0FA 4YBMA 3ZVZB 5TBNA 5D1LB 3ZVYA 4W4UA 2LAUA 2L5UA 3L1ZB 2G6QA 3EB5A 1WEMA 1MBMA 5B78A 2VPDA 2L75A 3HCSA 2LXPC 4FK5A 1BORA 2M85A 2E61A 2LGKA 4A4CA 3N9LA 5B75A 4X3GA 4LLBA 1WEQA 5DINA 3MHSA 3C5KA 2NAAA 1F62A 2KGGA 2DX8A 4UP0A 4I7CA 4AYCA 3LQJA 2MT5A 4L58A 4R7EA 5LKZA 2LDRA 5AIUA 3GV4A 4Q6FA 3FANA 3KQIA 3HCUA 1JM7A 2ZETC 4PTBA 4YABA 2MUMA 2XOCA 2XB1A 1XWHA 4WZ3B 4IC2A 4YAXA 5TDWA 2ECGA 2KE1A 2MA6A 2F6JA 4YC9A 3O70A 2E6SA 4P5OB 3U5MA 3N9QA 3O36A 1VYXA 3PURA 2YURA 3ZTGA 4GNGA 2OWAA 2CRRA 1HYIA 5FB1A 4L7XA 4NN2A 1VFYA 3U5PA 2YREA 4Z0OA 3DPLR 4B7YC 1MM2A 5G05B 2KR4A 3LDYA 3FAOA 2KWKA 2M13A 5JG6A 4WA6A 3ZYQA 5B76A 2XOZA 2DSMA 1HYJA 2H0DB 5SVIA 5DKAA 3NG2A 2LGLA 5TDRA 3RTRB 3N9PA 2YVRA 5LKTA 2L7PA 2MIQA 2BAYA 2LGVA 5I3LA 5KH7A 3FL2A 2YUCA 1WEVA 4A0CD 4UI9B 2LXHC 2DJAA 1X4IA 3DQVR 4LK9A 3M99A 3L11A 5KH3A 1V87A 3V43A 2EA6A 1X4JA 3JUEA 2IQJA 2L80A 1LDKC 2CRWA 1WILA 3T9KA 2YSMA 4V3KC 2ECJA 5B8DA 3U5NA 2RR4A 2FUIA 4BBQA 2OXQC 1JOCA 2KFTA 2YU4A 3SOUA 3O33A 2G43A 2VJFA 3PLWA 2ECNA 2LV9A 3SHBA 4XI1A 3M62A 2QICA 2IDAA 4O62A 2JM3A 4I7BA 2JMJA 4YBTA 1Z2QA 3LQIA 3T7LA 4GB0A 2EGMA 3LQHA 4GNFA 3PHDA 4CCGX 1U6GB 2XP0A 2MKEA 2KWOA 2YQLA 3I2DA 3DWDA 4F52B 4ZUXU 1N87A 1Z60A 2CSZA 1E4UA 4CA1A 2F6NA 2QIZA 1ZBDB 2KIZA 2EGPA 4S3OB 2Y1MA 5TABA 4LADB 2PUYA 3C6WA 3KDEC 2VJEA 3DDTA 1Z6UA 3IHPA 3RPGC 2YQMA 2YYRA 5H1VA 2E6RA 2LN0A 1CHCA 2K17A 5FERA 2K16A 4AVXA 5B77A 1X4UA 5C11A 3ZPV1 5B79A 2K4DA 2D8UA 1FBVA 5AITA 2FD4A 2LRIC 4A4BA 4BHWA 2JUNA 3ZNIA 2M3HA 2YT5A 1G25A 3KV6A 4N4FA 1T1HA 4ZDTA 4O64A 3Q1DA 4GNEA 2L43A 5H1UA 1VD4A 3O7AA 2KYUA 5D1KB 4R2YA 3E2DA 2RSDA 2M1RA 4B86C 2M6MA 2L0BA 4IC3A 2KWNA 2Y43A 5J3XA 3L1XA 3N9NA 2QJ0A 1WENA 4OGCA 3HTKC 2F42A 2AN6A 2CKLB 2MA5A 2ECWA 1WFKA 2VPGA 5FEYA 2XOYA 5H9MA 3KV5A 4AP4A 2LGGA 1K2FA 4QF3A 3KNVA 2K1JA 1DVPA 1WEOA 5SVXA 5KH9A 3FM8C 4H9DA 2MD7B 3RPGB 2VJFB 2KKYA 3ASLA 5FB0A 4S3OC 4YBSA 1DCQA 2VJEB 5G04B 3LRQA 4FO9A 3M63A 4PPEA 3ZPVE 5H1TA 3U5OA 2JRJA 2VPBA 5D1MB 4LJNA 3O47A 2MNYA 2RI7A 4V3LC 4WZ0A 3O34A 2XEUA 2ECIA 2CT2A 2YW8A 1WEWA 2HYED 3O35A 2B0OE 3N9MA 2YHOA 4C9ZA 5EYAF 1IYMA 2YSJA 2VPEA 3SOWA 4AUQB 2VP7A 2EODA 2PNXA 2ECTA 4I7DA 2MD8C 2CSYA 5LKUA 1WEEA 5C13A 4MVTA 3T6RA 2FUUA 4OGEA 2CSVA 4ZQLA 4R8PK 4YATA 2C2VS 4FIPA 4QQ4A 1LDJB 4F1PA 2ECVA 3SOXA 3H7HA 4LKAA 2P57A 4A49A 2H0DA 5SVIB 3FEHA 2LQ6A 4TKPB 5LCWB 2G45A 5LKXA 2JMDA 2UZGA 4Z0RA 1MM3A 5TRBA 3FJUB 5K3QA 4N3WA 2CKLA 3LVRE 2KKXA 3M7KA 2YHNA 2C2LA 2EXUA 2KWJA 1WE9A 2JMIA 2Y1NA 3O37A 3N9OA 1RMDA 2FSAA 3SUBA 3MDBC 4MSXA 1WIMA 2VNFA 1WGMA 4QF2A 2I50A 3PUQA 1WEPA 4YADA 4FJCA 5SVYA 1WESA 3LVQE 1JM7B 4WZ2A 3EB6A 2CONA 2FFWA 3MHHA 3VK6A 4AYCB 4GNDA 3HCTA 2KGIA 1WEUA
chains in the Genus database with same CATH topology
2KREA 3GL6A 2KU3A 2D8SA 4UP5A 3QZVA 1FP0A 2MNZA 2HDPA 5G0FA 4YBMA 3ZVZB 5TBNA 5D1LB 3ZVYA 4W4UA 2L5UA 3L1ZB 2G6QA 3EB5A 1WEMA 5B78A 2VPDA 2L75A 3HCSA 2LXPC 4FK5A 1BORA 2M85A 2LGKA 4A4CA 3N9LA 5B75A 4X3GA 4LLBA 1WEQA 5DINA 3MHSA 3C5KA 2NAAA 1F62A 2KGGA 2DX8A 4UP0A 4I7CA 4AYCA 3LQJA 2MT5A 4L58A 4R7EA 5LKZA 2LDRA 5AIUA 3GV4A 4Q6FA 3KQIA 3HCUA 1JM7A 2ZETC 4PTBA 4YABA 2MUMA 2XB1A 1XWHA 4WZ3B 4IC2A 4YAXA 5TDWA 2ECGA 2KE1A 2MA6A 2F6JA 4YC9A 3O70A 2E6SA 4P5OB 3U5MA 3N9QA 3O36A 1VYXA 3PURA 2YURA 3ZTGA 4GNGA 1HYIA 5FB1A 4L7XA 4NN2A 1VFYA 3U5PA 2YREA 3DPLR 4B7YC 1MM2A 5G05B 2KR4A 2KWKA 5JG6A 4WA6A 3ZYQA 5B76A 1HYJA 2H0DB 5DKAA 3NG2A 2LGLA 5TDRA 3RTRB 3N9PA 5LKTA 2MIQA 2BAYA 2LGVA 5I3LA 5KH7A 3FL2A 2YUCA 1WEVA 4A0CD 4UI9B 2LXHC 1X4IA 3DQVR 4LK9A 3M99A 3L11A 5KH3A 1V87A 3V43A 2EA6A 1X4JA 2L80A 1LDKC 1WILA 2YSMA 4V3KC 2ECJA 5B8DA 3U5NA 2FUIA 4BBQA 2OXQC 1JOCA 2KFTA 2YU4A 3SOUA 3O33A 2G43A 2VJFA 2ECNA 2LV9A 3SHBA 4XI1A 3M62A 2QICA 2IDAA 4I7BA 2JMJA 4YBTA 1Z2QA 3LQIA 3T7LA 4GB0A 3LQHA 4GNFA 3PHDA 4CCGX 1U6GB 2KWOA 2YQLA 3I2DA 4F52B 4ZUXU 1N87A 1Z60A 2CSZA 1E4UA 4CA1A 2F6NA 2QIZA 1ZBDB 2KIZA 2EGPA 4S3OB 2Y1MA 5TABA 4LADB 2PUYA 3C6WA 2VJEA 1Z6UA 3IHPA 3RPGC 2YQMA 2YYRA 5H1VA 2E6RA 2LN0A 1CHCA 2K17A 5FERA 2K16A 4AVXA 5B77A 1X4UA 5C11A 3ZPV1 5B79A 2K4DA 1FBVA 5AITA 2LRIC 4A4BA 4BHWA 3ZNIA 2M3HA 2YT5A 1G25A 3KV6A 4N4FA 1T1HA 4ZDTA 4O64A 4GNEA 2L43A 5H1UA 1VD4A 3O7AA 2KYUA 5D1KB 4R2YA 2RSDA 2M1RA 4B86C 2M6MA 2L0BA 4IC3A 2KWNA 2Y43A 5J3XA 3L1XA 3N9NA 2QJ0A 1WENA 3HTKC 2F42A 2AN6A 2CKLB 2MA5A 2ECWA 1WFKA 2VPGA 5FEYA 5H9MA 3KV5A 4AP4A 2LGGA 1K2FA 4QF3A 3KNVA 2K1JA 1DVPA 1WEOA 5KH9A 2MD7B 3RPGB 2VJFB 3ASLA 5FB0A 4S3OC 4YBSA 2VJEB 5G04B 3LRQA 4FO9A 3ZPVE 3M63A 4PPEA 5H1TA 3U5OA 2JRJA 2VPBA 5D1MB 4LJNA 2MNYA 2RI7A 4V3LC 4WZ0A 3O34A 2XEUA 2ECIA 2CT2A 2YW8A 1WEWA 2HYED 3O35A 3N9MA 2YHOA 4C9ZA 5EYAF 1IYMA 2YSJA 2VPEA 3SOWA 4AUQB 2VP7A 2EODA 2PNXA 2ECTA 4I7DA 2MD8C 2CSYA 5LKUA 1WEEA 5C13A 4MVTA 3T6RA 2FUUA 4ZQLA 4R8PK 4YATA 2C2VS 4FIPA 1LDJB 2ECVA 3SOXA 4LKAA 4A49A 2H0DA 2LQ6A 4TKPB 5LCWB 2G45A 5LKXA 2JMDA 2UZGA 1MM3A 5TRBA 4N3WA 2CKLA 2YHNA 2C2LA 2KWJA 1WE9A 2JMIA 2Y1NA 3O37A 3N9OA 1RMDA 2FSAA 4MSXA 1WIMA 2VNFA 1WGMA 4QF2A 2I50A 3PUQA 1WEPA 4YADA 4FJCA 1WESA 1JM7B 4WZ2A 3EB6A 3MHHA 3VK6A 4AYCB 4GNDA 3HCTA 2KGIA 1WEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRE A;  3GL6 A;  2KU3 A;  2D8S A;  4UP5 A;  3QZV A;  1FP0 A;  2MNZ A;  2HDP A;  5G0F A;  4YBM A;  3ZVZ B;  5TBN A;  5D1L B;  3ZVY A;  4W4U A;  2L5U A;  3L1Z B;  2G6Q A;  3EB5 A;  1WEM A;  5B78 A;  2VPD A;  2L75 A;  3HCS A;  2LXP C;  4FK5 A;  1BOR A;  2M85 A;  2LGK A;  4A4C A;  3N9L A;  5B75 A;  4X3G A;  4LLB A;  1WEQ A;  5DIN A;  3MHS A;  3C5K A;  2NAA A;  1F62 A;  2KGG A;  2DX8 A;  4UP0 A;  4I7C A;  4AYC A;  3LQJ A;  2MT5 A;  4L58 A;  4R7E A;  5LKZ A;  2LDR A;  5AIU A;  3GV4 A;  4Q6F A;  3KQI A;  3HCU A;  1JM7 A;  2ZET C;  4PTB A;  4YAB A;  2MUM A;  2XB1 A;  1XWH A;  4WZ3 B;  4IC2 A;  4YAX A;  5TDW A;  2ECG A;  2KE1 A;  2MA6 A;  2F6J A;  4YC9 A;  3O70 A;  2E6S A;  4P5O B;  3U5M A;  3N9Q A;  3O36 A;  1VYX A;  3PUR A;  2YUR A;  3ZTG A;  4GNG A;  1HYI A;  5FB1 A;  4L7X A;  4NN2 A;  1VFY A;  3U5P A;  2YRE A;  3DPL R;  4B7Y C;  1MM2 A;  5G05 B;  2KR4 A;  2KWK A;  5JG6 A;  4WA6 A;  3ZYQ A;  5B76 A;  1HYJ A;  2H0D B;  5DKA A;  3NG2 A;  2LGL A;  5TDR A;  3RTR B;  3N9P A;  5LKT A;  2MIQ A;  2BAY A;  2LGV A;  5I3L A;  5KH7 A;  3FL2 A;  2YUC A;  1WEV A;  4A0C D;  4UI9 B;  2LXH C;  1X4I A;  3DQV R;  4LK9 A;  3M99 A;  3L11 A;  5KH3 A;  1V87 A;  3V43 A;  2EA6 A;  1X4J A;  2L80 A;  1LDK C;  1WIL A;  2YSM A;  4V3K C;  2ECJ A;  5B8D A;  3U5N A;  2FUI A;  4BBQ A;  2OXQ C;  1JOC A;  2KFT A;  2YU4 A;  3SOU A;  3O33 A;  2G43 A;  2VJF A;  2ECN A;  2LV9 A;  3SHB A;  4XI1 A;  3M62 A;  2QIC A;  2IDA A;  4I7B A;  2JMJ A;  4YBT A;  1Z2Q A;  3LQI A;  3T7L A;  4GB0 A;  3LQH A;  4GNF A;  3PHD A;  4CCG X;  1U6G B;  2KWO A;  2YQL A;  3I2D A;  4F52 B;  4ZUX U;  1N87 A;  1Z60 A;  2CSZ A;  1E4U A;  4CA1 A;  2F6N A;  2QIZ A;  1ZBD B;  2KIZ A;  2EGP A;  4S3O B;  2Y1M A;  5TAB A;  4LAD B;  2PUY A;  3C6W A;  2VJE A;  1Z6U A;  3IHP A;  3RPG C;  2YQM A;  2YYR A;  5H1V A;  2E6R A;  2LN0 A;  1CHC A;  2K17 A;  5FER A;  2K16 A;  4AVX A;  5B77 A;  1X4U A;  5C11 A;  3ZPV 1;  5B79 A;  2K4D A;  1FBV A;  5AIT A;  2LRI C;  4A4B A;  4BHW A;  3ZNI A;  2M3H A;  2YT5 A;  1G25 A;  3KV6 A;  4N4F A;  1T1H A;  4ZDT A;  4O64 A;  4GNE A;  2L43 A;  5H1U A;  1VD4 A;  3O7A A;  2KYU A;  5D1K B;  4R2Y A;  2RSD A;  2M1R A;  4B86 C;  2M6M A;  2L0B A;  4IC3 A;  2KWN A;  2Y43 A;  5J3X A;  3L1X A;  3N9N A;  2QJ0 A;  1WEN A;  3HTK C;  2F42 A;  2AN6 A;  2CKL B;  2MA5 A;  2ECW A;  1WFK A;  2VPG A;  5FEY A;  5H9M A;  3KV5 A;  4AP4 A;  2LGG A;  1K2F A;  4QF3 A;  3KNV A;  2K1J A;  1DVP A;  1WEO A;  5KH9 A;  2MD7 B;  3RPG B;  2VJF B;  3ASL A;  5FB0 A;  4S3O C;  4YBS A;  2VJE B;  5G04 B;  3LRQ A;  4FO9 A;  3ZPV E;  3M63 A;  4PPE A;  5H1T A;  3U5O A;  2JRJ A;  2VPB A;  5D1M B;  4LJN A;  2MNY A;  2RI7 A;  4V3L C;  4WZ0 A;  3O34 A;  2XEU A;  2ECI A;  2CT2 A;  2YW8 A;  1WEW A;  2HYE D;  3O35 A;  3N9M A;  2YHO A;  4C9Z A;  5EYA F;  1IYM A;  2YSJ A;  2VPE A;  3SOW A;  4AUQ B;  2VP7 A;  2EOD A;  2PNX A;  2ECT A;  4I7D A;  2MD8 C;  2CSY A;  5LKU A;  1WEE A;  5C13 A;  4MVT A;  3T6R A;  2FUU A;  4ZQL A;  4R8P K;  4YAT A;  2C2V S;  4FIP A;  1LDJ B;  2ECV A;  3SOX A;  4LKA A;  4A49 A;  2H0D A;  2LQ6 A;  4TKP B;  5LCW B;  2G45 A;  5LKX A;  2JMD A;  2UZG A;  1MM3 A;  5TRB A;  4N3W A;  2CKL A;  2YHN A;  2C2L A;  2KWJ A;  1WE9 A;  2JMI A;  2Y1N A;  3O37 A;  3N9O A;  1RMD A;  2FSA A;  4MSX A;  1WIM A;  2VNF A;  1WGM A;  4QF2 A;  2I50 A;  3PUQ A;  1WEP A;  4YAD A;  4FJC A;  1WES A;  1JM7 B;  4WZ2 A;  3EB6 A;  3MHH A;  3VK6 A;  4AYC B;  4GND A;  3HCT A;  2KGI A;  1WEU A; 
#chains in the Genus database with same CATH topology
 2KRE A;  3GL6 A;  2KU3 A;  2D8S A;  4UP5 A;  3QZV A;  3LJU X;  1FP0 A;  2MNZ A;  2HDP A;  5G0F A;  4YBM A;  3ZVZ B;  5TBN A;  5D1L B;  3ZVY A;  4W4U A;  2LAU A;  2L5U A;  3L1Z B;  2G6Q A;  3EB5 A;  1WEM A;  1MBM A;  5B78 A;  2VPD A;  2L75 A;  3HCS A;  2LXP C;  4FK5 A;  1BOR A;  2M85 A;  2E61 A;  2LGK A;  4A4C A;  3N9L A;  5B75 A;  4X3G A;  4LLB A;  1WEQ A;  5DIN A;  3MHS A;  3C5K A;  2NAA A;  1F62 A;  2KGG A;  2DX8 A;  4UP0 A;  4I7C A;  4AYC A;  3LQJ A;  2MT5 A;  4L58 A;  4R7E A;  5LKZ A;  2LDR A;  5AIU A;  3GV4 A;  4Q6F A;  3FAN A;  3KQI A;  3HCU A;  1JM7 A;  2ZET C;  4PTB A;  4YAB A;  2MUM A;  2XOC A;  2XB1 A;  1XWH A;  4WZ3 B;  4IC2 A;  4YAX A;  5TDW A;  2ECG A;  2KE1 A;  2MA6 A;  2F6J A;  4YC9 A;  3O70 A;  2E6S A;  4P5O B;  3U5M A;  3N9Q A;  3O36 A;  1VYX A;  3PUR A;  2YUR A;  3ZTG A;  4GNG A;  2OWA A;  2CRR A;  1HYI A;  5FB1 A;  4L7X A;  4NN2 A;  1VFY A;  3U5P A;  2YRE A;  4Z0O A;  3DPL R;  4B7Y C;  1MM2 A;  5G05 B;  2KR4 A;  3LDY A;  3FAO A;  2KWK A;  2M13 A;  5JG6 A;  4WA6 A;  3ZYQ A;  5B76 A;  2XOZ A;  2DSM A;  1HYJ A;  2H0D B;  5SVI A;  5DKA A;  3NG2 A;  2LGL A;  5TDR A;  3RTR B;  3N9P A;  2YVR A;  5LKT A;  2L7P A;  2MIQ A;  2BAY A;  2LGV A;  5I3L A;  5KH7 A;  3FL2 A;  2YUC A;  1WEV A;  4A0C D;  4UI9 B;  2LXH C;  2DJA A;  1X4I A;  3DQV R;  4LK9 A;  3M99 A;  3L11 A;  5KH3 A;  1V87 A;  3V43 A;  2EA6 A;  1X4J A;  3JUE A;  2IQJ A;  2L80 A;  1LDK C;  2CRW A;  1WIL A;  3T9K A;  2YSM A;  4V3K C;  2ECJ A;  5B8D A;  3U5N A;  2RR4 A;  2FUI A;  4BBQ A;  2OXQ C;  1JOC A;  2KFT A;  2YU4 A;  3SOU A;  3O33 A;  2G43 A;  2VJF A;  3PLW A;  2ECN A;  2LV9 A;  3SHB A;  4XI1 A;  3M62 A;  2QIC A;  2IDA A;  4O62 A;  2JM3 A;  4I7B A;  2JMJ A;  4YBT A;  1Z2Q A;  3LQI A;  3T7L A;  4GB0 A;  2EGM A;  3LQH A;  4GNF A;  3PHD A;  4CCG X;  1U6G B;  2XP0 A;  2MKE A;  2KWO A;  2YQL A;  3I2D A;  3DWD A;  4F52 B;  4ZUX U;  1N87 A;  1Z60 A;  2CSZ A;  1E4U A;  4CA1 A;  2F6N A;  2QIZ A;  1ZBD B;  2KIZ A;  2EGP A;  4S3O B;  2Y1M A;  5TAB A;  4LAD B;  2PUY A;  3C6W A;  3KDE C;  2VJE A;  3DDT A;  1Z6U A;  3IHP A;  3RPG C;  2YQM A;  2YYR A;  5H1V A;  2E6R A;  2LN0 A;  1CHC A;  2K17 A;  5FER A;  2K16 A;  4AVX A;  5B77 A;  1X4U A;  5C11 A;  3ZPV 1;  5B79 A;  2K4D A;  2D8U A;  1FBV A;  5AIT A;  2FD4 A;  2LRI C;  4A4B A;  4BHW A;  2JUN A;  3ZNI A;  2M3H A;  2YT5 A;  1G25 A;  3KV6 A;  4N4F A;  1T1H A;  4ZDT A;  4O64 A;  3Q1D A;  4GNE A;  2L43 A;  5H1U A;  1VD4 A;  3O7A A;  2KYU A;  5D1K B;  4R2Y A;  3E2D A;  2RSD A;  2M1R A;  4B86 C;  2M6M A;  2L0B A;  4IC3 A;  2KWN A;  2Y43 A;  5J3X A;  3L1X A;  3N9N A;  2QJ0 A;  1WEN A;  4OGC A;  3HTK C;  2F42 A;  2AN6 A;  2CKL B;  2MA5 A;  2ECW A;  1WFK A;  2VPG A;  5FEY A;  2XOY A;  5H9M A;  3KV5 A;  4AP4 A;  2LGG A;  1K2F A;  4QF3 A;  3KNV A;  2K1J A;  1DVP A;  1WEO A;  5SVX A;  5KH9 A;  3FM8 C;  4H9D A;  2MD7 B;  3RPG B;  2VJF B;  2KKY A;  3ASL A;  5FB0 A;  4S3O C;  4YBS A;  1DCQ A;  2VJE B;  5G04 B;  3LRQ A;  4FO9 A;  3M63 A;  4PPE A;  3ZPV E;  5H1T A;  3U5O A;  2JRJ A;  2VPB A;  5D1M B;  4LJN A;  3O47 A;  2MNY A;  2RI7 A;  4V3L C;  4WZ0 A;  3O34 A;  2XEU A;  2ECI A;  2CT2 A;  2YW8 A;  1WEW A;  2HYE D;  3O35 A;  2B0O E;  3N9M A;  2YHO A;  4C9Z A;  5EYA F;  1IYM A;  2YSJ A;  2VPE A;  3SOW A;  4AUQ B;  2VP7 A;  2EOD A;  2PNX A;  2ECT A;  4I7D A;  2MD8 C;  2CSY A;  5LKU A;  1WEE A;  5C13 A;  4MVT A;  3T6R A;  2FUU A;  4OGE A;  2CSV A;  4ZQL A;  4R8P K;  4YAT A;  2C2V S;  4FIP A;  4QQ4 A;  1LDJ B;  4F1P A;  2ECV A;  3SOX A;  3H7H A;  4LKA A;  2P57 A;  4A49 A;  2H0D A;  5SVI B;  3FEH A;  2LQ6 A;  4TKP B;  5LCW B;  2G45 A;  5LKX A;  2JMD A;  2UZG A;  4Z0R A;  1MM3 A;  5TRB A;  3FJU B;  5K3Q A;  4N3W A;  2CKL A;  3LVR E;  2KKX A;  3M7K A;  2YHN A;  2C2L A;  2EXU A;  2KWJ A;  1WE9 A;  2JMI A;  2Y1N A;  3O37 A;  3N9O A;  1RMD A;  2FSA A;  3SUB A;  3MDB C;  4MSX A;  1WIM A;  2VNF A;  1WGM A;  4QF2 A;  2I50 A;  3PUQ A;  1WEP A;  4YAD A;  4FJC A;  5SVY A;  1WES A;  3LVQ E;  1JM7 B;  4WZ2 A;  3EB6 A;  2CON A;  2FFW A;  3MHH A;  3VK6 A;  4AYC B;  4GND A;  3HCT A;  2KGI A;  1WEU A; 
#chains in the Genus database with same CATH homology
 2KRE A;  3GL6 A;  2KU3 A;  2D8S A;  4UP5 A;  3QZV A;  1FP0 A;  2MNZ A;  2HDP A;  5G0F A;  4YBM A;  3ZVZ B;  5TBN A;  5D1L B;  3ZVY A;  4W4U A;  2L5U A;  3L1Z B;  2G6Q A;  3EB5 A;  1WEM A;  5B78 A;  2VPD A;  2L75 A;  3HCS A;  2LXP C;  4FK5 A;  1BOR A;  2M85 A;  2LGK A;  4A4C A;  3N9L A;  5B75 A;  4X3G A;  4LLB A;  1WEQ A;  5DIN A;  3MHS A;  3C5K A;  2NAA A;  1F62 A;  2KGG A;  2DX8 A;  4UP0 A;  4I7C A;  4AYC A;  3LQJ A;  2MT5 A;  4L58 A;  4R7E A;  5LKZ A;  2LDR A;  5AIU A;  3GV4 A;  4Q6F A;  3KQI A;  3HCU A;  1JM7 A;  2ZET C;  4PTB A;  4YAB A;  2MUM A;  2XB1 A;  1XWH A;  4WZ3 B;  4IC2 A;  4YAX A;  5TDW A;  2ECG A;  2KE1 A;  2MA6 A;  2F6J A;  4YC9 A;  3O70 A;  2E6S A;  4P5O B;  3U5M A;  3N9Q A;  3O36 A;  1VYX A;  3PUR A;  2YUR A;  3ZTG A;  4GNG A;  1HYI A;  5FB1 A;  4L7X A;  4NN2 A;  1VFY A;  3U5P A;  2YRE A;  3DPL R;  4B7Y C;  1MM2 A;  5G05 B;  2KR4 A;  2KWK A;  5JG6 A;  4WA6 A;  3ZYQ A;  5B76 A;  1HYJ A;  2H0D B;  5DKA A;  3NG2 A;  2LGL A;  5TDR A;  3RTR B;  3N9P A;  5LKT A;  2MIQ A;  2BAY A;  2LGV A;  5I3L A;  5KH7 A;  3FL2 A;  2YUC A;  1WEV A;  4A0C D;  4UI9 B;  2LXH C;  1X4I A;  3DQV R;  4LK9 A;  3M99 A;  3L11 A;  5KH3 A;  1V87 A;  3V43 A;  2EA6 A;  1X4J A;  2L80 A;  1LDK C;  1WIL A;  2YSM A;  4V3K C;  2ECJ A;  5B8D A;  3U5N A;  2FUI A;  4BBQ A;  2OXQ C;  1JOC A;  2KFT A;  2YU4 A;  3SOU A;  3O33 A;  2G43 A;  2VJF A;  2ECN A;  2LV9 A;  3SHB A;  4XI1 A;  3M62 A;  2QIC A;  2IDA A;  4I7B A;  2JMJ A;  4YBT A;  1Z2Q A;  3LQI A;  3T7L A;  4GB0 A;  3LQH A;  4GNF A;  3PHD A;  4CCG X;  1U6G B;  2KWO A;  2YQL A;  3I2D A;  4F52 B;  4ZUX U;  1N87 A;  1Z60 A;  2CSZ A;  1E4U A;  4CA1 A;  2F6N A;  2QIZ A;  1ZBD B;  2KIZ A;  2EGP A;  4S3O B;  2Y1M A;  5TAB A;  4LAD B;  2PUY A;  3C6W A;  2VJE A;  1Z6U A;  3IHP A;  3RPG C;  2YQM A;  2YYR A;  5H1V A;  2E6R A;  2LN0 A;  1CHC A;  2K17 A;  5FER A;  2K16 A;  4AVX A;  5B77 A;  1X4U A;  5C11 A;  3ZPV 1;  5B79 A;  2K4D A;  1FBV A;  5AIT A;  2LRI C;  4A4B A;  4BHW A;  3ZNI A;  2M3H A;  2YT5 A;  1G25 A;  3KV6 A;  4N4F A;  1T1H A;  4ZDT A;  4O64 A;  4GNE A;  2L43 A;  5H1U A;  1VD4 A;  3O7A A;  2KYU A;  5D1K B;  4R2Y A;  2RSD A;  2M1R A;  4B86 C;  2M6M A;  2L0B A;  4IC3 A;  2KWN A;  2Y43 A;  5J3X A;  3L1X A;  3N9N A;  2QJ0 A;  1WEN A;  3HTK C;  2F42 A;  2AN6 A;  2CKL B;  2MA5 A;  2ECW A;  1WFK A;  2VPG A;  5FEY A;  5H9M A;  3KV5 A;  4AP4 A;  2LGG A;  1K2F A;  4QF3 A;  3KNV A;  2K1J A;  1DVP A;  1WEO A;  5KH9 A;  2MD7 B;  3RPG B;  2VJF B;  3ASL A;  5FB0 A;  4S3O C;  4YBS A;  2VJE B;  5G04 B;  3LRQ A;  4FO9 A;  3ZPV E;  3M63 A;  4PPE A;  5H1T A;  3U5O A;  2JRJ A;  2VPB A;  5D1M B;  4LJN A;  2MNY A;  2RI7 A;  4V3L C;  4WZ0 A;  3O34 A;  2XEU A;  2ECI A;  2CT2 A;  2YW8 A;  1WEW A;  2HYE D;  3O35 A;  3N9M A;  2YHO A;  4C9Z A;  5EYA F;  1IYM A;  2YSJ A;  2VPE A;  3SOW A;  4AUQ B;  2VP7 A;  2EOD A;  2PNX A;  2ECT A;  4I7D A;  2MD8 C;  2CSY A;  5LKU A;  1WEE A;  5C13 A;  4MVT A;  3T6R A;  2FUU A;  4ZQL A;  4R8P K;  4YAT A;  2C2V S;  4FIP A;  1LDJ B;  2ECV A;  3SOX A;  4LKA A;  4A49 A;  2H0D A;  2LQ6 A;  4TKP B;  5LCW B;  2G45 A;  5LKX A;  2JMD A;  2UZG A;  1MM3 A;  5TRB A;  4N3W A;  2CKL A;  2YHN A;  2C2L A;  2KWJ A;  1WE9 A;  2JMI A;  2Y1N A;  3O37 A;  3N9O A;  1RMD A;  2FSA A;  4MSX A;  1WIM A;  2VNF A;  1WGM A;  4QF2 A;  2I50 A;  3PUQ A;  1WEP A;  4YAD A;  4FJC A;  1WES A;  1JM7 B;  4WZ2 A;  3EB6 A;  3MHH A;  3VK6 A;  4AYC B;  4GND A;  3HCT A;  2KGI A;  1WEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...