4V3KC

Rnf38-ubch5b-ub complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
KADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
publication title Activation of a Primed Ring E3-E2-Ubiquitin Complex by Non-Covalent Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 75
sequence length 75
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4v3kC00
1WE9A 2L5UA 1BORA 4LADB 1MM2A 2RI7A 1V87A 2VJEA 3N9OA 4B7YC 4YATA 4LJNA 2VNFA 3ZPVE 2EA6A 5TDRA 5H1TA 1K2FA 2YREA 2ECJA 1DVPA 5J3XA 1HYIA 4V3KC 4AUQB 1X4JA 2VJFB 3GL6A 5I3LA 1JOCA 3PURA 4GB0A 3ZYQA 2M1RA 2CT2A 2I50A 3M63A 5FB0A 2YYRA 4S3OB 2KFTA 3HCSA 3O70A 3EB6A 3IHPA 2KWNA 2CSYA 2YQMA 2XB1A 1WEWA 1Z2QA 5DINA 4LLBA 4AP4A 2F42A 4QF2A 3O36A 2ECVA 2YURA 1VFYA 3U5OA 4FIPA 5B77A 2KYUA 2OXQC 4YBTA 1WEQA 5LKUA 3VK6A 1WEUA 1WEVA 4CA1A 5AIUA 3PUQA 4GNDA 1F62A 1LDJB 1CHCA 2CKLA 4AVXA 3ZVYA 1G25A 3M62A 2PNXA 4GNEA 2K17A 3KNVA 2F6JA 3O7AA 4L7XA 4UP0A 2YUCA 3GV4A 4IC3A 2MUMA 2CSZA 4UP5A 2JMIA 3L11A 2LN0A 2QICA 3SHBA 1WIMA 5TABA 4N4FA 2KWJA 3EB5A 3DPLR 5TDWA 2ECTA 4PTBA 4AYCA 2MIQA 4O64A 5G0FA 4XI1A 2G6QA 2VJEB 2YQLA 4GNFA 5EYAF 2C2LA 2H0DB 2MD7B 4YADA 5LCWB 3T6RA 2JMDA 3ASLA 3LQJA 4R7EA 2DX8A 4BHWA 3LQHA 4A4CA 2Y1MA 5TBNA 3SOWA 4FK5A 2VPBA 3RPGB 3KQIA 4WZ2A 2KU3A 5TRBA 3V43A 4C9ZA 1WEMA 1Z6UA 2LGKA 2ECGA 5C11A 2NAAA 2E6SA 1T1HA 4TKPB 4ZDTA 2PUYA 4YAXA 3PHDA 3N9QA 4YABA 3L1XA 2E6RA 5LKTA 3NG2A 4FJCA 3ZTGA 4WA6A 2JRJA 5B78A 2VJFA 4LK9A 2Y1NA 4ZQLA 5JG6A 3I2DA 4PPEA 2LGLA 2M6MA 3ZVZB 1ZBDB 2KIZA 5AITA 2LXHC 4I7BA 5H1UA 2KE1A 3FL2A 1VD4A 3N9NA 2YU4A 2F6NA 4YBSA 5FB1A 2EODA 2LRIC 4YC9A 3U5NA 2CKLB 4QF3A 2YW8A 4V3LC 1HYJA 1WEOA 2LQ6A 3N9LA 3ZNIA 2JMJA 2VPEA 2LV9A 1X4UA 3L1ZB 2YHNA 5G05B 4LKAA 2MA5A 5D1LB 3RTRB 5B76A 5D1MB 3MHSA 2K1JA 3HCUA 4AYCB 5B8DA 1JM7A 2VPDA 3LQIA 2MNYA 2VP7A 3C5KA 2K4DA 2KR4A 5G04B 4N3WA 4R2YA 3QZVA 1XWHA 4GNGA 2UZGA 2M85A 3T7LA 3SOUA 2VPGA 2MD8C 4WZ0A 2G45A 2LXPC 5B75A 4NN2A 1Z60A 2RSDA 2AN6A 4S3OC 4BBQA 5KH9A 5DKAA 2LDRA 1WENA 5FEYA 5FERA 5C13A 2HDPA 2L43A 1LDKC 2ZETC 2MA6A 2IDAA 3HTKC 5H9MA 2XEUA 3M99A 2H0DA 3O34A 2L0BA 4MVTA 1WEPA 3N9PA 2FSAA 4FO9A 3MHHA 4IC2A 3DQVR 2YSJA 2KWKA 4X3GA 3LRQA 4F52B 5B79A 2YSMA 2LGGA 3U5PA 2EGPA 3U5MA 4WZ3B 5LKXA 1X4IA 3KV5A 2L80A 2YT5A 2KGIA 1RMDA 1WILA 1N87A 1WFKA 2MNZA 4P5OB 2KWOA 1FP0A 1E4UA 5D1KB 2KGGA 4L58A 2KREA 2Y43A 1FBVA 5H1VA 4YBMA 5KH7A 2ECNA 1WGMA 1MM3A 4I7DA 2BAYA 5LKZA 3C6WA 3ZPV1 2FUUA 2C2VS 2K16A 3SOXA 1JM7B 3KV6A 3N9MA 2D8SA 2G43A 4I7CA 4CCGX 5KH3A 3HCTA 2ECIA 2HYED 1VYXA 2LGVA 3O37A 1U6GB 2MT5A 3RPGC 1WESA 4A0CD 4UI9B 2M3HA 4Q6FA 2ECWA 4ZUXU 4A49A 4R8PK 4MSXA 2YHOA 2QJ0A 2FUIA 4A4BA 1WEEA 4W4UA 2L75A 2QIZA 3O35A 3O33A 4B86C 1IYMA
chains in the Genus database with same CATH superfamily
1WE9A 2L5UA 3LVRE 1BORA 4LADB 1MM2A 2RI7A 1V87A 2VJEA 3N9OA 4B7YC 4YATA 4LJNA 2VNFA 3O47A 3ZPVE 2EA6A 5TDRA 5H1TA 1K2FA 2YREA 2ECJA 2XOYA 1DVPA 5J3XA 1HYIA 4V3KC 4AUQB 1X4JA 2VJFB 3GL6A 5I3LA 3FJUB 1JOCA 2JM3A 1MBMA 3PURA 4GB0A 5K3QA 3ZYQA 2M1RA 2CT2A 3PLWA 2I50A 3M63A 2CRWA 5FB0A 2YYRA 4S3OB 2KFTA 3HCSA 3O70A 3EB6A 3IHPA 2KWNA 2CSYA 2YQMA 2XB1A 1WEWA 2KKXA 1Z2QA 5DINA 4LLBA 4AP4A 2EXUA 2F42A 2CSVA 4QF2A 3O36A 2ECVA 2YURA 1VFYA 3U5OA 4FIPA 5B77A 2KYUA 2OXQC 4YBTA 1WEQA 5LKUA 2DJAA 3VK6A 1WEUA 1WEVA 4CA1A 5AIUA 3PUQA 4GNDA 1F62A 1LDJB 1CHCA 3SUBA 2CKLA 5SVIB 3FEHA 4AVXA 3ZVYA 1G25A 3M62A 2PNXA 4GNEA 2K17A 3KNVA 2F6JA 2RR4A 3O7AA 4L7XA 4UP0A 2YUCA 3GV4A 4IC3A 2MUMA 2CSZA 4UP5A 2JMIA 3L11A 2LN0A 3JUEA 2QICA 3SHBA 1WIMA 5TABA 4N4FA 3LDYA 2KWJA 3KDEC 3EB5A 3DPLR 5TDWA 2ECTA 4PTBA 2IQJA 5SVXA 4AYCA 2MIQA 4O64A 5G0FA 4XI1A 2G6QA 2VJEB 2YQLA 4GNFA 5EYAF 2C2LA 2H0DB 2MD7B 4YADA 5LCWB 3T6RA 2JMDA 3ASLA 3LQJA 4R7EA 2DX8A 3LVQE 4BHWA 3LQHA 4A4CA 2Y1MA 5TBNA 3Q1DA 3SOWA 4FK5A 2VPBA 3RPGB 3KQIA 2CRRA 4WZ2A 4Z0RA 2JUNA 2KU3A 5TRBA 3V43A 4C9ZA 1WEMA 1Z6UA 2LGKA 2ECGA 5C11A 2NAAA 2E6SA 3M7KA 1T1HA 4TKPB 4ZDTA 2PUYA 4YAXA 3PHDA 3N9QA 4YABA 3L1XA 2E6RA 4O62A 5LKTA 3NG2A 4FJCA 3ZTGA 4WA6A 2JRJA 5B78A 2VJFA 4LK9A 2Y1NA 4ZQLA 5JG6A 3I2DA 4PPEA 2LGLA 2M6MA 3ZVZB 3FAOA 1ZBDB 2KIZA 5AITA 2LXHC 4I7BA 4Z0OA 5H1UA 2KE1A 3FL2A 1VD4A 3N9NA 2YU4A 2F6NA 4YBSA 5FB1A 2EODA 2LRIC 4YC9A 3U5NA 2CKLB 2DSMA 4QF3A 2YW8A 4V3LC 1HYJA 1WEOA 2LQ6A 3N9LA 3ZNIA 2E61A 2JMJA 2VPEA 2LV9A 2CONA 2OWAA 1X4UA 1DCQA 3L1ZB 2YHNA 5G05B 4LKAA 2MA5A 5D1LB 3RTRB 5B76A 5SVYA 5D1MB 3MHSA 2K1JA 3HCUA 4AYCB 5B8DA 1JM7A 2VPDA 3LQIA 2MNYA 2VP7A 3C5KA 2K4DA 2KR4A 5G04B 4N3WA 4R2YA 3QZVA 2FD4A 1XWHA 4GNGA 2XP0A 2UZGA 2M85A 3T7LA 3SOUA 2KKYA 2VPGA 2MD8C 4WZ0A 2G45A 2LXPC 5B75A 4NN2A 1Z60A 2RSDA 2AN6A 4S3OC 4BBQA 3LJUX 5KH9A 4OGEA 2LDRA 5DKAA 1WENA 4F1PA 5FEYA 5FERA 5C13A 2HDPA 2L43A 1LDKC 2ZETC 3FANA 2MA6A 2IDAA 3HTKC 5H9MA 2XEUA 3M99A 2H0DA 3O34A 2L0BA 4MVTA 1WEPA 3N9PA 2L7PA 2P57A 2FSAA 4FO9A 4H9DA 3DWDA 2M13A 3MHHA 2LAUA 4IC2A 3DQVR 2YSJA 2KWKA 4X3GA 3LRQA 2MKEA 4F52B 5B79A 2YSMA 2LGGA 4QQ4A 3U5PA 2EGPA 3U5MA 4WZ3B 4OGCA 1X4IA 5LKXA 3KV5A 2L80A 2YT5A 2KGIA 1RMDA 1WILA 3MDBC 1N87A 1WFKA 2MNZA 4P5OB 3T9KA 2KWOA 1FP0A 1E4UA 5D1KB 2KGGA 4L58A 3DDTA 2KREA 2Y43A 1FBVA 5H1VA 4YBMA 5KH7A 2ECNA 1WGMA 3H7HA 1MM3A 4I7DA 3FM8C 2BAYA 2EGMA 5LKZA 3C6WA 3ZPV1 2FUUA 2C2VS 2K16A 3SOXA 1JM7B 3KV6A 3N9MA 2D8SA 2G43A 4I7CA 4CCGX 2FFWA 5KH3A 3HCTA 2ECIA 2HYED 1VYXA 2LGVA 3O37A 1U6GB 2XOCA 2MT5A 3RPGC 1WESA 4A0CD 2B0OE 4UI9B 5SVIA 2M3HA 4Q6FA 2ECWA 4ZUXU 4A49A 4R8PK 4MSXA 2YHOA 2QJ0A 2FUIA 4A4BA 1WEEA 4W4UA 2YVRA 2L75A 2D8UA 2QIZA 3O35A 2XOZA 3E2DA 3O33A 4B86C 1IYMA
chains in the Genus database with same CATH topology
1WE9A 2L5UA 1BORA 4LADB 1MM2A 2RI7A 1V87A 2VJEA 3N9OA 4B7YC 4YATA 4LJNA 2VNFA 3ZPVE 2EA6A 5TDRA 5H1TA 1K2FA 2YREA 2ECJA 1DVPA 5J3XA 1HYIA 4V3KC 4AUQB 1X4JA 2VJFB 3GL6A 5I3LA 1JOCA 3PURA 4GB0A 3ZYQA 2M1RA 2CT2A 2I50A 3M63A 5FB0A 2YYRA 4S3OB 2KFTA 3HCSA 3O70A 3EB6A 3IHPA 2KWNA 2CSYA 2YQMA 2XB1A 1WEWA 1Z2QA 5DINA 4LLBA 4AP4A 2F42A 4QF2A 3O36A 2ECVA 2YURA 1VFYA 3U5OA 4FIPA 5B77A 2KYUA 2OXQC 4YBTA 1WEQA 5LKUA 3VK6A 1WEUA 1WEVA 4CA1A 5AIUA 3PUQA 4GNDA 1F62A 1LDJB 1CHCA 2CKLA 4AVXA 3ZVYA 1G25A 3M62A 2PNXA 4GNEA 2K17A 3KNVA 2F6JA 3O7AA 4L7XA 4UP0A 2YUCA 3GV4A 4IC3A 2MUMA 2CSZA 4UP5A 2JMIA 3L11A 2LN0A 2QICA 3SHBA 1WIMA 5TABA 4N4FA 2KWJA 3EB5A 3DPLR 5TDWA 2ECTA 4PTBA 4AYCA 2MIQA 4O64A 5G0FA 4XI1A 2G6QA 2VJEB 2YQLA 4GNFA 5EYAF 2C2LA 2H0DB 2MD7B 4YADA 5LCWB 3T6RA 2JMDA 3ASLA 3LQJA 4R7EA 2DX8A 4BHWA 3LQHA 4A4CA 2Y1MA 5TBNA 3SOWA 4FK5A 2VPBA 3RPGB 3KQIA 4WZ2A 2KU3A 5TRBA 3V43A 4C9ZA 1WEMA 1Z6UA 2LGKA 2ECGA 5C11A 2NAAA 2E6SA 1T1HA 4TKPB 4ZDTA 2PUYA 4YAXA 3PHDA 3N9QA 4YABA 3L1XA 2E6RA 5LKTA 3NG2A 4FJCA 3ZTGA 4WA6A 2JRJA 5B78A 2VJFA 4LK9A 2Y1NA 4ZQLA 5JG6A 3I2DA 4PPEA 2LGLA 2M6MA 3ZVZB 1ZBDB 2KIZA 5AITA 2LXHC 4I7BA 5H1UA 2KE1A 3FL2A 1VD4A 3N9NA 2YU4A 2F6NA 4YBSA 5FB1A 2EODA 2LRIC 4YC9A 3U5NA 2CKLB 4QF3A 2YW8A 4V3LC 1HYJA 1WEOA 2LQ6A 3N9LA 3ZNIA 2JMJA 2VPEA 2LV9A 1X4UA 3L1ZB 2YHNA 5G05B 4LKAA 2MA5A 5D1LB 3RTRB 5B76A 5D1MB 3MHSA 2K1JA 3HCUA 4AYCB 5B8DA 1JM7A 2VPDA 3LQIA 2MNYA 2VP7A 3C5KA 2K4DA 2KR4A 5G04B 4N3WA 4R2YA 3QZVA 1XWHA 4GNGA 2UZGA 2M85A 3T7LA 3SOUA 2VPGA 2MD8C 4WZ0A 2G45A 2LXPC 5B75A 4NN2A 1Z60A 2RSDA 2AN6A 4S3OC 4BBQA 5KH9A 5DKAA 2LDRA 1WENA 5FEYA 5FERA 5C13A 2HDPA 2L43A 1LDKC 2ZETC 2MA6A 2IDAA 3HTKC 5H9MA 2XEUA 3M99A 2H0DA 3O34A 2L0BA 4MVTA 1WEPA 3N9PA 2FSAA 4FO9A 3MHHA 4IC2A 3DQVR 2YSJA 2KWKA 4X3GA 3LRQA 4F52B 5B79A 2YSMA 2LGGA 3U5PA 2EGPA 3U5MA 4WZ3B 5LKXA 1X4IA 3KV5A 2L80A 2YT5A 2KGIA 1RMDA 1WILA 1N87A 1WFKA 2MNZA 4P5OB 2KWOA 1FP0A 1E4UA 5D1KB 2KGGA 4L58A 2KREA 2Y43A 1FBVA 5H1VA 4YBMA 5KH7A 2ECNA 1WGMA 1MM3A 4I7DA 2BAYA 5LKZA 3C6WA 3ZPV1 2FUUA 2C2VS 2K16A 3SOXA 1JM7B 3KV6A 3N9MA 2D8SA 2G43A 4I7CA 4CCGX 5KH3A 3HCTA 2ECIA 2HYED 1VYXA 2LGVA 3O37A 1U6GB 2MT5A 3RPGC 1WESA 4A0CD 4UI9B 2M3HA 4Q6FA 2ECWA 4ZUXU 4A49A 4R8PK 4MSXA 2YHOA 2QJ0A 2FUIA 4A4BA 1WEEA 4W4UA 2L75A 2QIZA 3O35A 3O33A 4B86C 1IYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE9 A;  2L5U A;  1BOR A;  4LAD B;  1MM2 A;  2RI7 A;  1V87 A;  2VJE A;  3N9O A;  4B7Y C;  4YAT A;  4LJN A;  2VNF A;  3ZPV E;  2EA6 A;  5TDR A;  5H1T A;  1K2F A;  2YRE A;  2ECJ A;  1DVP A;  5J3X A;  1HYI A;  4V3K C;  4AUQ B;  1X4J A;  2VJF B;  3GL6 A;  5I3L A;  1JOC A;  3PUR A;  4GB0 A;  3ZYQ A;  2M1R A;  2CT2 A;  2I50 A;  3M63 A;  5FB0 A;  2YYR A;  4S3O B;  2KFT A;  3HCS A;  3O70 A;  3EB6 A;  3IHP A;  2KWN A;  2CSY A;  2YQM A;  2XB1 A;  1WEW A;  1Z2Q A;  5DIN A;  4LLB A;  4AP4 A;  2F42 A;  4QF2 A;  3O36 A;  2ECV A;  2YUR A;  1VFY A;  3U5O A;  4FIP A;  5B77 A;  2KYU A;  2OXQ C;  4YBT A;  1WEQ A;  5LKU A;  3VK6 A;  1WEU A;  1WEV A;  4CA1 A;  5AIU A;  3PUQ A;  4GND A;  1F62 A;  1LDJ B;  1CHC A;  2CKL A;  4AVX A;  3ZVY A;  1G25 A;  3M62 A;  2PNX A;  4GNE A;  2K17 A;  3KNV A;  2F6J A;  3O7A A;  4L7X A;  4UP0 A;  2YUC A;  3GV4 A;  4IC3 A;  2MUM A;  2CSZ A;  4UP5 A;  2JMI A;  3L11 A;  2LN0 A;  2QIC A;  3SHB A;  1WIM A;  5TAB A;  4N4F A;  2KWJ A;  3EB5 A;  3DPL R;  5TDW A;  2ECT A;  4PTB A;  4AYC A;  2MIQ A;  4O64 A;  5G0F A;  4XI1 A;  2G6Q A;  2VJE B;  2YQL A;  4GNF A;  5EYA F;  2C2L A;  2H0D B;  2MD7 B;  4YAD A;  5LCW B;  3T6R A;  2JMD A;  3ASL A;  3LQJ A;  4R7E A;  2DX8 A;  4BHW A;  3LQH A;  4A4C A;  2Y1M A;  5TBN A;  3SOW A;  4FK5 A;  2VPB A;  3RPG B;  3KQI A;  4WZ2 A;  2KU3 A;  5TRB A;  3V43 A;  4C9Z A;  1WEM A;  1Z6U A;  2LGK A;  2ECG A;  5C11 A;  2NAA A;  2E6S A;  1T1H A;  4TKP B;  4ZDT A;  2PUY A;  4YAX A;  3PHD A;  3N9Q A;  4YAB A;  3L1X A;  2E6R A;  5LKT A;  3NG2 A;  4FJC A;  3ZTG A;  4WA6 A;  2JRJ A;  5B78 A;  2VJF A;  4LK9 A;  2Y1N A;  4ZQL A;  5JG6 A;  3I2D A;  4PPE A;  2LGL A;  2M6M A;  3ZVZ B;  1ZBD B;  2KIZ A;  5AIT A;  2LXH C;  4I7B A;  5H1U A;  2KE1 A;  3FL2 A;  1VD4 A;  3N9N A;  2YU4 A;  2F6N A;  4YBS A;  5FB1 A;  2EOD A;  2LRI C;  4YC9 A;  3U5N A;  2CKL B;  4QF3 A;  2YW8 A;  4V3L C;  1HYJ A;  1WEO A;  2LQ6 A;  3N9L A;  3ZNI A;  2JMJ A;  2VPE A;  2LV9 A;  1X4U A;  3L1Z B;  2YHN A;  5G05 B;  4LKA A;  2MA5 A;  5D1L B;  3RTR B;  5B76 A;  5D1M B;  3MHS A;  2K1J A;  3HCU A;  4AYC B;  5B8D A;  1JM7 A;  2VPD A;  3LQI A;  2MNY A;  2VP7 A;  3C5K A;  2K4D A;  2KR4 A;  5G04 B;  4N3W A;  4R2Y A;  3QZV A;  1XWH A;  4GNG A;  2UZG A;  2M85 A;  3T7L A;  3SOU A;  2VPG A;  2MD8 C;  4WZ0 A;  2G45 A;  2LXP C;  5B75 A;  4NN2 A;  1Z60 A;  2RSD A;  2AN6 A;  4S3O C;  4BBQ A;  5KH9 A;  5DKA A;  2LDR A;  1WEN A;  5FEY A;  5FER A;  5C13 A;  2HDP A;  2L43 A;  1LDK C;  2ZET C;  2MA6 A;  2IDA A;  3HTK C;  5H9M A;  2XEU A;  3M99 A;  2H0D A;  3O34 A;  2L0B A;  4MVT A;  1WEP A;  3N9P A;  2FSA A;  4FO9 A;  3MHH A;  4IC2 A;  3DQV R;  2YSJ A;  2KWK A;  4X3G A;  3LRQ A;  4F52 B;  5B79 A;  2YSM A;  2LGG A;  3U5P A;  2EGP A;  3U5M A;  4WZ3 B;  5LKX A;  1X4I A;  3KV5 A;  2L80 A;  2YT5 A;  2KGI A;  1RMD A;  1WIL A;  1N87 A;  1WFK A;  2MNZ A;  4P5O B;  2KWO A;  1FP0 A;  1E4U A;  5D1K B;  2KGG A;  4L58 A;  2KRE A;  2Y43 A;  1FBV A;  5H1V A;  4YBM A;  5KH7 A;  2ECN A;  1WGM A;  1MM3 A;  4I7D A;  2BAY A;  5LKZ A;  3C6W A;  3ZPV 1;  2FUU A;  2C2V S;  2K16 A;  3SOX A;  1JM7 B;  3KV6 A;  3N9M A;  2D8S A;  2G43 A;  4I7C A;  4CCG X;  5KH3 A;  3HCT A;  2ECI A;  2HYE D;  1VYX A;  2LGV A;  3O37 A;  1U6G B;  2MT5 A;  3RPG C;  1WES A;  4A0C D;  4UI9 B;  2M3H A;  4Q6F A;  2ECW A;  4ZUX U;  4A49 A;  4R8P K;  4MSX A;  2YHO A;  2QJ0 A;  2FUI A;  4A4B A;  1WEE A;  4W4U A;  2L75 A;  2QIZ A;  3O35 A;  3O33 A;  4B86 C;  1IYM A; 
#chains in the Genus database with same CATH topology
 1WE9 A;  2L5U A;  3LVR E;  1BOR A;  4LAD B;  1MM2 A;  2RI7 A;  1V87 A;  2VJE A;  3N9O A;  4B7Y C;  4YAT A;  4LJN A;  2VNF A;  3O47 A;  3ZPV E;  2EA6 A;  5TDR A;  5H1T A;  1K2F A;  2YRE A;  2ECJ A;  2XOY A;  1DVP A;  5J3X A;  1HYI A;  4V3K C;  4AUQ B;  1X4J A;  2VJF B;  3GL6 A;  5I3L A;  3FJU B;  1JOC A;  2JM3 A;  1MBM A;  3PUR A;  4GB0 A;  5K3Q A;  3ZYQ A;  2M1R A;  2CT2 A;  3PLW A;  2I50 A;  3M63 A;  2CRW A;  5FB0 A;  2YYR A;  4S3O B;  2KFT A;  3HCS A;  3O70 A;  3EB6 A;  3IHP A;  2KWN A;  2CSY A;  2YQM A;  2XB1 A;  1WEW A;  2KKX A;  1Z2Q A;  5DIN A;  4LLB A;  4AP4 A;  2EXU A;  2F42 A;  2CSV A;  4QF2 A;  3O36 A;  2ECV A;  2YUR A;  1VFY A;  3U5O A;  4FIP A;  5B77 A;  2KYU A;  2OXQ C;  4YBT A;  1WEQ A;  5LKU A;  2DJA A;  3VK6 A;  1WEU A;  1WEV A;  4CA1 A;  5AIU A;  3PUQ A;  4GND A;  1F62 A;  1LDJ B;  1CHC A;  3SUB A;  2CKL A;  5SVI B;  3FEH A;  4AVX A;  3ZVY A;  1G25 A;  3M62 A;  2PNX A;  4GNE A;  2K17 A;  3KNV A;  2F6J A;  2RR4 A;  3O7A A;  4L7X A;  4UP0 A;  2YUC A;  3GV4 A;  4IC3 A;  2MUM A;  2CSZ A;  4UP5 A;  2JMI A;  3L11 A;  2LN0 A;  3JUE A;  2QIC A;  3SHB A;  1WIM A;  5TAB A;  4N4F A;  3LDY A;  2KWJ A;  3KDE C;  3EB5 A;  3DPL R;  5TDW A;  2ECT A;  4PTB A;  2IQJ A;  5SVX A;  4AYC A;  2MIQ A;  4O64 A;  5G0F A;  4XI1 A;  2G6Q A;  2VJE B;  2YQL A;  4GNF A;  5EYA F;  2C2L A;  2H0D B;  2MD7 B;  4YAD A;  5LCW B;  3T6R A;  2JMD A;  3ASL A;  3LQJ A;  4R7E A;  2DX8 A;  3LVQ E;  4BHW A;  3LQH A;  4A4C A;  2Y1M A;  5TBN A;  3Q1D A;  3SOW A;  4FK5 A;  2VPB A;  3RPG B;  3KQI A;  2CRR A;  4WZ2 A;  4Z0R A;  2JUN A;  2KU3 A;  5TRB A;  3V43 A;  4C9Z A;  1WEM A;  1Z6U A;  2LGK A;  2ECG A;  5C11 A;  2NAA A;  2E6S A;  3M7K A;  1T1H A;  4TKP B;  4ZDT A;  2PUY A;  4YAX A;  3PHD A;  3N9Q A;  4YAB A;  3L1X A;  2E6R A;  4O62 A;  5LKT A;  3NG2 A;  4FJC A;  3ZTG A;  4WA6 A;  2JRJ A;  5B78 A;  2VJF A;  4LK9 A;  2Y1N A;  4ZQL A;  5JG6 A;  3I2D A;  4PPE A;  2LGL A;  2M6M A;  3ZVZ B;  3FAO A;  1ZBD B;  2KIZ A;  5AIT A;  2LXH C;  4I7B A;  4Z0O A;  5H1U A;  2KE1 A;  3FL2 A;  1VD4 A;  3N9N A;  2YU4 A;  2F6N A;  4YBS A;  5FB1 A;  2EOD A;  2LRI C;  4YC9 A;  3U5N A;  2CKL B;  2DSM A;  4QF3 A;  2YW8 A;  4V3L C;  1HYJ A;  1WEO A;  2LQ6 A;  3N9L A;  3ZNI A;  2E61 A;  2JMJ A;  2VPE A;  2LV9 A;  2CON A;  2OWA A;  1X4U A;  1DCQ A;  3L1Z B;  2YHN A;  5G05 B;  4LKA A;  2MA5 A;  5D1L B;  3RTR B;  5B76 A;  5SVY A;  5D1M B;  3MHS A;  2K1J A;  3HCU A;  4AYC B;  5B8D A;  1JM7 A;  2VPD A;  3LQI A;  2MNY A;  2VP7 A;  3C5K A;  2K4D A;  2KR4 A;  5G04 B;  4N3W A;  4R2Y A;  3QZV A;  2FD4 A;  1XWH A;  4GNG A;  2XP0 A;  2UZG A;  2M85 A;  3T7L A;  3SOU A;  2KKY A;  2VPG A;  2MD8 C;  4WZ0 A;  2G45 A;  2LXP C;  5B75 A;  4NN2 A;  1Z60 A;  2RSD A;  2AN6 A;  4S3O C;  4BBQ A;  3LJU X;  5KH9 A;  4OGE A;  2LDR A;  5DKA A;  1WEN A;  4F1P A;  5FEY A;  5FER A;  5C13 A;  2HDP A;  2L43 A;  1LDK C;  2ZET C;  3FAN A;  2MA6 A;  2IDA A;  3HTK C;  5H9M A;  2XEU A;  3M99 A;  2H0D A;  3O34 A;  2L0B A;  4MVT A;  1WEP A;  3N9P A;  2L7P A;  2P57 A;  2FSA A;  4FO9 A;  4H9D A;  3DWD A;  2M13 A;  3MHH A;  2LAU A;  4IC2 A;  3DQV R;  2YSJ A;  2KWK A;  4X3G A;  3LRQ A;  2MKE A;  4F52 B;  5B79 A;  2YSM A;  2LGG A;  4QQ4 A;  3U5P A;  2EGP A;  3U5M A;  4WZ3 B;  4OGC A;  1X4I A;  5LKX A;  3KV5 A;  2L80 A;  2YT5 A;  2KGI A;  1RMD A;  1WIL A;  3MDB C;  1N87 A;  1WFK A;  2MNZ A;  4P5O B;  3T9K A;  2KWO A;  1FP0 A;  1E4U A;  5D1K B;  2KGG A;  4L58 A;  3DDT A;  2KRE A;  2Y43 A;  1FBV A;  5H1V A;  4YBM A;  5KH7 A;  2ECN A;  1WGM A;  3H7H A;  1MM3 A;  4I7D A;  3FM8 C;  2BAY A;  2EGM A;  5LKZ A;  3C6W A;  3ZPV 1;  2FUU A;  2C2V S;  2K16 A;  3SOX A;  1JM7 B;  3KV6 A;  3N9M A;  2D8S A;  2G43 A;  4I7C A;  4CCG X;  2FFW A;  5KH3 A;  3HCT A;  2ECI A;  2HYE D;  1VYX A;  2LGV A;  3O37 A;  1U6G B;  2XOC A;  2MT5 A;  3RPG C;  1WES A;  4A0C D;  2B0O E;  4UI9 B;  5SVI A;  2M3H A;  4Q6F A;  2ECW A;  4ZUX U;  4A49 A;  4R8P K;  4MSX A;  2YHO A;  2QJ0 A;  2FUI A;  4A4B A;  1WEE A;  4W4U A;  2YVR A;  2L75 A;  2D8U A;  2QIZ A;  3O35 A;  2XOZ A;  3E2D A;  3O33 A;  4B86 C;  1IYM A; 
#chains in the Genus database with same CATH homology
 1WE9 A;  2L5U A;  1BOR A;  4LAD B;  1MM2 A;  2RI7 A;  1V87 A;  2VJE A;  3N9O A;  4B7Y C;  4YAT A;  4LJN A;  2VNF A;  3ZPV E;  2EA6 A;  5TDR A;  5H1T A;  1K2F A;  2YRE A;  2ECJ A;  1DVP A;  5J3X A;  1HYI A;  4V3K C;  4AUQ B;  1X4J A;  2VJF B;  3GL6 A;  5I3L A;  1JOC A;  3PUR A;  4GB0 A;  3ZYQ A;  2M1R A;  2CT2 A;  2I50 A;  3M63 A;  5FB0 A;  2YYR A;  4S3O B;  2KFT A;  3HCS A;  3O70 A;  3EB6 A;  3IHP A;  2KWN A;  2CSY A;  2YQM A;  2XB1 A;  1WEW A;  1Z2Q A;  5DIN A;  4LLB A;  4AP4 A;  2F42 A;  4QF2 A;  3O36 A;  2ECV A;  2YUR A;  1VFY A;  3U5O A;  4FIP A;  5B77 A;  2KYU A;  2OXQ C;  4YBT A;  1WEQ A;  5LKU A;  3VK6 A;  1WEU A;  1WEV A;  4CA1 A;  5AIU A;  3PUQ A;  4GND A;  1F62 A;  1LDJ B;  1CHC A;  2CKL A;  4AVX A;  3ZVY A;  1G25 A;  3M62 A;  2PNX A;  4GNE A;  2K17 A;  3KNV A;  2F6J A;  3O7A A;  4L7X A;  4UP0 A;  2YUC A;  3GV4 A;  4IC3 A;  2MUM A;  2CSZ A;  4UP5 A;  2JMI A;  3L11 A;  2LN0 A;  2QIC A;  3SHB A;  1WIM A;  5TAB A;  4N4F A;  2KWJ A;  3EB5 A;  3DPL R;  5TDW A;  2ECT A;  4PTB A;  4AYC A;  2MIQ A;  4O64 A;  5G0F A;  4XI1 A;  2G6Q A;  2VJE B;  2YQL A;  4GNF A;  5EYA F;  2C2L A;  2H0D B;  2MD7 B;  4YAD A;  5LCW B;  3T6R A;  2JMD A;  3ASL A;  3LQJ A;  4R7E A;  2DX8 A;  4BHW A;  3LQH A;  4A4C A;  2Y1M A;  5TBN A;  3SOW A;  4FK5 A;  2VPB A;  3RPG B;  3KQI A;  4WZ2 A;  2KU3 A;  5TRB A;  3V43 A;  4C9Z A;  1WEM A;  1Z6U A;  2LGK A;  2ECG A;  5C11 A;  2NAA A;  2E6S A;  1T1H A;  4TKP B;  4ZDT A;  2PUY A;  4YAX A;  3PHD A;  3N9Q A;  4YAB A;  3L1X A;  2E6R A;  5LKT A;  3NG2 A;  4FJC A;  3ZTG A;  4WA6 A;  2JRJ A;  5B78 A;  2VJF A;  4LK9 A;  2Y1N A;  4ZQL A;  5JG6 A;  3I2D A;  4PPE A;  2LGL A;  2M6M A;  3ZVZ B;  1ZBD B;  2KIZ A;  5AIT A;  2LXH C;  4I7B A;  5H1U A;  2KE1 A;  3FL2 A;  1VD4 A;  3N9N A;  2YU4 A;  2F6N A;  4YBS A;  5FB1 A;  2EOD A;  2LRI C;  4YC9 A;  3U5N A;  2CKL B;  4QF3 A;  2YW8 A;  4V3L C;  1HYJ A;  1WEO A;  2LQ6 A;  3N9L A;  3ZNI A;  2JMJ A;  2VPE A;  2LV9 A;  1X4U A;  3L1Z B;  2YHN A;  5G05 B;  4LKA A;  2MA5 A;  5D1L B;  3RTR B;  5B76 A;  5D1M B;  3MHS A;  2K1J A;  3HCU A;  4AYC B;  5B8D A;  1JM7 A;  2VPD A;  3LQI A;  2MNY A;  2VP7 A;  3C5K A;  2K4D A;  2KR4 A;  5G04 B;  4N3W A;  4R2Y A;  3QZV A;  1XWH A;  4GNG A;  2UZG A;  2M85 A;  3T7L A;  3SOU A;  2VPG A;  2MD8 C;  4WZ0 A;  2G45 A;  2LXP C;  5B75 A;  4NN2 A;  1Z60 A;  2RSD A;  2AN6 A;  4S3O C;  4BBQ A;  5KH9 A;  5DKA A;  2LDR A;  1WEN A;  5FEY A;  5FER A;  5C13 A;  2HDP A;  2L43 A;  1LDK C;  2ZET C;  2MA6 A;  2IDA A;  3HTK C;  5H9M A;  2XEU A;  3M99 A;  2H0D A;  3O34 A;  2L0B A;  4MVT A;  1WEP A;  3N9P A;  2FSA A;  4FO9 A;  3MHH A;  4IC2 A;  3DQV R;  2YSJ A;  2KWK A;  4X3G A;  3LRQ A;  4F52 B;  5B79 A;  2YSM A;  2LGG A;  3U5P A;  2EGP A;  3U5M A;  4WZ3 B;  5LKX A;  1X4I A;  3KV5 A;  2L80 A;  2YT5 A;  2KGI A;  1RMD A;  1WIL A;  1N87 A;  1WFK A;  2MNZ A;  4P5O B;  2KWO A;  1FP0 A;  1E4U A;  5D1K B;  2KGG A;  4L58 A;  2KRE A;  2Y43 A;  1FBV A;  5H1V A;  4YBM A;  5KH7 A;  2ECN A;  1WGM A;  1MM3 A;  4I7D A;  2BAY A;  5LKZ A;  3C6W A;  3ZPV 1;  2FUU A;  2C2V S;  2K16 A;  3SOX A;  1JM7 B;  3KV6 A;  3N9M A;  2D8S A;  2G43 A;  4I7C A;  4CCG X;  5KH3 A;  3HCT A;  2ECI A;  2HYE D;  1VYX A;  2LGV A;  3O37 A;  1U6G B;  2MT5 A;  3RPG C;  1WES A;  4A0C D;  4UI9 B;  2M3H A;  4Q6F A;  2ECW A;  4ZUX U;  4A49 A;  4R8P K;  4MSX A;  2YHO A;  2QJ0 A;  2FUI A;  4A4B A;  1WEE A;  4W4U A;  2L75 A;  2QIZ A;  3O35 A;  3O33 A;  4B86 C;  1IYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...