4V3KC

Rnf38-ubch5b-ub complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
KADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Activation of a Primed Ring E3-E2-Ubiquitin Complex by Non-Covalent Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
total genus 14
structure length 75
sequence length 75
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4v3kC00
4B7YC 4BHWA 4GNGA 2H0DA 2L0BA 3U5NA 3ASLA 4P5OB 2YYRA 2VJFB 1VFYA 2EODA 2Y1MA 2KE1A 4XI1A 1Z60A 3HCSA 2CKLA 5B79A 4LADB 2PUYA 3HCUA 4AVXA 4GNFA 2KR4A 5LKTA 3U5PA 1WEVA 2MNZA 5D1KB 2K17A 5C11A 2LRIC 3PHDA 4WZ0A 4YAXA 3I2DA 4A4BA 3NG2A 3T6RA 4UI9B 1IYMA 4FJCA 2G6QA 5B75A 1RMDA 1VD4A 4UP0A 2L75A 5FB1A 4ZDTA 5DKAA 5KH7A 3O34A 2ECJA 4YABA 3SHBA 4N3WA 1WEEA 4AP4A 2VP7A 2YQLA 4I7CA 4IC2A 1ZBDB 2YW8A 3ZPV1 2JRJA 5G0FA 4FIPA 5B77A 2VPEA 4MSXA 2BAYA 3DQVR 3EB6A 4FK5A 2LN0A 2ZETC 3LRQA 2LXHC 3SOWA 5KH3A 5LKXA 2OXQC 3MHSA 2JMJA 2KGIA 2CSZA 4CA1A 2KYUA 2F6NA 3L11A 2MD7B 3RPGB 1DVPA 4BBQA 2LDRA 3FL2A 2ECNA 4IC3A 5TDRA 4I7DA 5B8DA 3N9NA 5TBNA 3GV4A 5FERA 1CHCA 2LV9A 1JM7B 2KREA 3LQHA 3N9MA 4S3OB 2YU4A 4L58A 3PURA 1LDJB 2YSJA 2PNXA 2VJEB 2YUCA 4I7BA 5H9MA 2VJEA 5TABA 3DPLR 2HYED 5FEYA 3V43A 4NN2A 2KWOA 5D1MB 3LQJA 1WEOA 4B86C 3O35A 4GNDA 2CKLB 5AIUA 3KNVA 2L5UA 1V87A 1BORA 4LKAA 2D8SA 3O37A 2JMIA 3N9LA 3LQIA 2KIZA 2M6MA 3L1ZB 3ZVZB 1E4UA 3MHHA 5G04B 3SOUA 2YQMA 1WESA 4YATA 5H1VA 4X3GA 2ECIA 2G45A 5TDWA 3KV5A 4R8PK 3QZVA 2YURA 3M99A 4PPEA 1MM3A 1MM2A 1LDKC 2YHOA 4LLBA 5I3LA 4LJNA 4MVTA 3ZYQA 5B76A 3IHPA 2XB1A 2FUIA 1VYXA 2C2VS 5H1UA 1Z2QA 2LGGA 1WIMA 1WEMA 3PUQA 1F62A 2E6SA 3ZNIA 2MA6A 5B78A 1JM7A 2KGGA 2JMDA 4CCGX 5LKZA 2MD8C 3N9OA 5H1TA 1HYJA 2NAAA 2YSMA 4ZUXU 1WILA 2LGKA 3U5MA 2RI7A 4QF3A 2LGVA 3N9PA 2CSYA 2EGPA 2I50A 4FO9A 2M85A 3C6WA 4A0CD 5C13A 2QIZA 1WEPA 2MUMA 1X4IA 2L43A 4UP5A 3L1XA 3RTRB 2ECWA 3O33A 1WENA 2CT2A 4WA6A 3U5OA 4R7EA 1X4UA 1FBVA 3T7LA 4V3LC 2FUUA 3ZTGA 4YBMA 3SOXA 3VK6A 2FSAA 4C9ZA 4AYCA 2VPDA 2KU3A 2ECTA 2H0DB 4YC9A 1Z6UA 1K2FA 2EA6A 5FB0A 2YT5A 2K4DA 1WGMA 1N87A 1XWHA 5G05B 1X4JA 2M3HA 4YBTA 5JG6A 4V3KC 4AUQB 2QICA 5LKUA 1T1HA 1WFKA 2VPGA 4QF2A 5D1LB 2E6RA 4A4CA 2YREA 2L80A 2MA5A 4GB0A 2KWNA 4WZ2A 2G43A 2MT5A 2LQ6A 3KQIA 4N4FA 2KFTA 4AYCB 3ZPVE 2HDPA 5EYAF 2M1RA 5LCWB 1JOCA 5DINA 3M62A 4WZ3B 1WEWA 2ECGA 2LXPC 2XEUA 3O36A 2UZGA 4ZQLA 2C2LA 4PTBA 3GL6A 2Y1NA 2DX8A 4W4UA 2KWKA 2VJFA 4S3OC 2IDAA 2VNFA 3N9QA 3ZVYA 2RSDA 3O70A 4YADA 4GNEA 4O64A 2AN6A 3HCTA 4L7XA 1WEQA 3KV6A 4R2YA 3RPGC 5AITA 4Q6FA 2KWJA 2MNYA 3EB5A 5KH9A 2F42A 4YBSA 3HTKC 5TRBA 1WE9A 1HYIA 4A49A 2ECVA 2VPBA 2K1JA 4TKPB 3C5KA 2Y43A 2F6JA 4LK9A 4F52B 2LGLA 3O7AA 1FP0A 2K16A 2QJ0A 5J3XA 2MIQA 1G25A 1U6GB 1WEUA 2YHNA 3M63A
chains in the Genus database with same CATH superfamily
4B7YC 4BHWA 3FM8C 4GNGA 2H0DA 2L0BA 3LVQE 3SUBA 3DDTA 3LDYA 3U5NA 3ASLA 4P5OB 2YYRA 3FAOA 2VJFB 1VFYA 2EODA 2Y1MA 2KE1A 4XI1A 1Z60A 3HCSA 2CKLA 5B79A 4LADB 2PUYA 3HCUA 4AVXA 4GNFA 2KR4A 5LKTA 3U5PA 1WEVA 2MNZA 2XOCA 5D1KB 2K17A 5C11A 2LRIC 3H7HA 3PHDA 4WZ0A 4YAXA 4F1PA 3I2DA 4A4BA 3NG2A 3T6RA 2KKXA 4UI9B 1IYMA 4FJCA 2G6QA 5B75A 1RMDA 1VD4A 4UP0A 2L75A 5FB1A 4ZDTA 5SVXA 5DKAA 5KH7A 4Z0RA 3O34A 2CRRA 2ECJA 4YABA 3SHBA 4N3WA 1WEEA 2LAUA 4AP4A 2VP7A 3LJUX 2YQLA 2EXUA 4O62A 4I7CA 4IC2A 1ZBDB 2YW8A 3FEHA 3ZPV1 2JRJA 5G0FA 4FIPA 5B77A 2VPEA 4MSXA 2BAYA 3DQVR 2JUNA 3EB6A 4FK5A 2LN0A 2ZETC 3LRQA 2LXHC 3SOWA 5KH3A 5LKXA 2OXQC 3MHSA 2JMJA 3E2DA 2KGIA 2CSZA 4CA1A 2KYUA 2F6NA 4OGCA 3T9KA 3L11A 2MD7B 3RPGB 1DVPA 4BBQA 2LDRA 3FL2A 2FFWA 2B0OE 2ECNA 2CSVA 4IC3A 5TDRA 4I7DA 5B8DA 3N9NA 5TBNA 3GV4A 5FERA 1CHCA 2LV9A 1JM7B 2KREA 3LQHA 3N9MA 4S3OB 2YU4A 4L58A 3PURA 1LDJB 3KDEC 2YSJA 2PNXA 5SVIB 2VJEB 2YUCA 4I7BA 5H9MA 2VJEA 5TABA 3DPLR 2HYED 5FEYA 3V43A 4NN2A 2KWOA 4Z0OA 5D1MB 3LQJA 4QQ4A 1WEOA 4B86C 3O35A 4GNDA 2CKLB 5AIUA 3KNVA 2L5UA 1V87A 1BORA 4LKAA 2D8SA 3O37A 2JMIA 3N9LA 3LQIA 2KIZA 2M6MA 5SVYA 3L1ZB 3ZVZB 1E4UA 3MHHA 5G04B 2CRWA 3SOUA 2YQMA 1WESA 4YATA 3Q1DA 5H1VA 4X3GA 2ECIA 2G45A 5TDWA 3KV5A 4R8PK 3QZVA 2YURA 3M99A 4PPEA 1MM3A 1MM2A 1LDKC 2YHOA 2RR4A 4LLBA 5I3LA 4LJNA 4MVTA 3ZYQA 5B76A 3IHPA 2XB1A 2FUIA 2YVRA 1VYXA 2MKEA 2C2VS 5H1UA 1Z2QA 2LGGA 1WIMA 1DCQA 1WEMA 3PUQA 1F62A 2E6SA 3ZNIA 2MA6A 5B78A 1JM7A 2KGGA 2P57A 2M13A 2JMDA 4CCGX 5LKZA 2MD8C 3N9OA 5H1TA 1HYJA 2NAAA 2YSMA 4ZUXU 1WILA 2JM3A 2LGKA 3JUEA 2RI7A 3U5MA 4QF3A 2LGVA 3FANA 3N9PA 2CSYA 2EGPA 2I50A 4FO9A 2M85A 4H9DA 3C6WA 4A0CD 5C13A 2QIZA 1WEPA 2MUMA 1X4IA 2L43A 4UP5A 3L1XA 3RTRB 2ECWA 3O33A 1WENA 2CT2A 4WA6A 3U5OA 4R7EA 1X4UA 1FBVA 2XOZA 3T7LA 4V3LC 2FUUA 3ZTGA 2EGMA 4YBMA 3SOXA 2E61A 3VK6A 2FSAA 4C9ZA 2DJAA 4AYCA 2VPDA 2KU3A 2ECTA 2H0DB 2IQJA 4YC9A 1Z6UA 3DWDA 1K2FA 2EA6A 5FB0A 2YT5A 2K4DA 1WGMA 1N87A 1XWHA 5G05B 1X4JA 2M3HA 4YBTA 5JG6A 4V3KC 4AUQB 2QICA 5LKUA 2OWAA 1T1HA 2CONA 2FD4A 1WFKA 2VPGA 5SVIA 3FJUB 3LVRE 4QF2A 5K3QA 5D1LB 2E6RA 4A4CA 2YREA 2L80A 2MA5A 4GB0A 2KWNA 4WZ2A 3MDBC 2G43A 2MT5A 2LQ6A 3KQIA 1MBMA 4N4FA 2KFTA 4AYCB 3ZPVE 2HDPA 5EYAF 2M1RA 5LCWB 1JOCA 3PLWA 2L7PA 5DINA 3M62A 4WZ3B 1WEWA 2ECGA 2LXPC 2XEUA 3O36A 2UZGA 4ZQLA 2C2LA 2DSMA 4PTBA 3GL6A 2Y1NA 2DX8A 4W4UA 2KWKA 2VJFA 4S3OC 2IDAA 2VNFA 3N9QA 3ZVYA 2RSDA 3O70A 4YADA 4GNEA 4O64A 2AN6A 2XP0A 3HCTA 4L7XA 2KKYA 1WEQA 3KV6A 4R2YA 3RPGC 5AITA 4Q6FA 2KWJA 2MNYA 3EB5A 5KH9A 2F42A 4YBSA 2XOYA 2D8UA 3HTKC 5TRBA 1WE9A 1HYIA 2VPBA 2ECVA 4A49A 2K1JA 3M7KA 4TKPB 3C5KA 2Y43A 2F6JA 4LK9A 4F52B 3O47A 2LGLA 3O7AA 1FP0A 2K16A 2QJ0A 5J3XA 2MIQA 1G25A 4OGEA 1U6GB 1WEUA 2YHNA 3M63A
chains in the Genus database with same CATH topology
4B7YC 4BHWA 4GNGA 2H0DA 2L0BA 3U5NA 3ASLA 4P5OB 2YYRA 2VJFB 1VFYA 2EODA 2Y1MA 2KE1A 4XI1A 1Z60A 3HCSA 2CKLA 5B79A 4LADB 2PUYA 3HCUA 4AVXA 4GNFA 2KR4A 5LKTA 3U5PA 1WEVA 2MNZA 5D1KB 2K17A 5C11A 2LRIC 3PHDA 4WZ0A 4YAXA 3I2DA 4A4BA 3NG2A 3T6RA 4UI9B 1IYMA 4FJCA 2G6QA 5B75A 1RMDA 1VD4A 4UP0A 2L75A 5FB1A 4ZDTA 5DKAA 5KH7A 3O34A 2ECJA 4YABA 3SHBA 4N3WA 1WEEA 4AP4A 2VP7A 2YQLA 4I7CA 4IC2A 1ZBDB 2YW8A 3ZPV1 2JRJA 5G0FA 4FIPA 5B77A 2VPEA 4MSXA 2BAYA 3DQVR 3EB6A 4FK5A 2LN0A 2ZETC 3LRQA 2LXHC 3SOWA 5KH3A 5LKXA 2OXQC 3MHSA 2JMJA 2KGIA 2CSZA 4CA1A 2KYUA 2F6NA 3L11A 2MD7B 3RPGB 1DVPA 4BBQA 2LDRA 3FL2A 2ECNA 4IC3A 5TDRA 4I7DA 5B8DA 3N9NA 5TBNA 3GV4A 5FERA 1CHCA 2LV9A 1JM7B 2KREA 3LQHA 3N9MA 4S3OB 2YU4A 4L58A 3PURA 1LDJB 2YSJA 2PNXA 2VJEB 2YUCA 4I7BA 5H9MA 2VJEA 5TABA 3DPLR 2HYED 5FEYA 3V43A 4NN2A 2KWOA 5D1MB 3LQJA 1WEOA 4B86C 3O35A 4GNDA 2CKLB 5AIUA 3KNVA 2L5UA 1V87A 1BORA 4LKAA 2D8SA 3O37A 2JMIA 3N9LA 3LQIA 2KIZA 2M6MA 3L1ZB 3ZVZB 1E4UA 3MHHA 5G04B 3SOUA 2YQMA 1WESA 4YATA 5H1VA 4X3GA 2ECIA 2G45A 5TDWA 3KV5A 4R8PK 3QZVA 2YURA 3M99A 4PPEA 1MM3A 1MM2A 1LDKC 2YHOA 4LLBA 5I3LA 4LJNA 4MVTA 3ZYQA 5B76A 3IHPA 2XB1A 2FUIA 1VYXA 2C2VS 5H1UA 1Z2QA 2LGGA 1WIMA 1WEMA 3PUQA 1F62A 2E6SA 3ZNIA 2MA6A 5B78A 1JM7A 2KGGA 2JMDA 4CCGX 5LKZA 2MD8C 3N9OA 5H1TA 1HYJA 2NAAA 2YSMA 4ZUXU 1WILA 2LGKA 3U5MA 2RI7A 4QF3A 2LGVA 3N9PA 2CSYA 2EGPA 2I50A 4FO9A 2M85A 3C6WA 4A0CD 5C13A 2QIZA 1WEPA 2MUMA 1X4IA 2L43A 4UP5A 3L1XA 3RTRB 2ECWA 3O33A 1WENA 2CT2A 4WA6A 3U5OA 4R7EA 1X4UA 1FBVA 3T7LA 4V3LC 2FUUA 3ZTGA 4YBMA 3SOXA 3VK6A 2FSAA 4C9ZA 4AYCA 2VPDA 2KU3A 2ECTA 2H0DB 4YC9A 1Z6UA 1K2FA 2EA6A 5FB0A 2YT5A 2K4DA 1WGMA 1N87A 1XWHA 5G05B 1X4JA 2M3HA 4YBTA 5JG6A 4V3KC 4AUQB 2QICA 5LKUA 1T1HA 1WFKA 2VPGA 4QF2A 5D1LB 2E6RA 4A4CA 2YREA 2L80A 2MA5A 4GB0A 2KWNA 4WZ2A 2G43A 2MT5A 2LQ6A 3KQIA 4N4FA 2KFTA 4AYCB 3ZPVE 2HDPA 5EYAF 2M1RA 5LCWB 1JOCA 5DINA 3M62A 4WZ3B 1WEWA 2ECGA 2LXPC 2XEUA 3O36A 2UZGA 4ZQLA 2C2LA 4PTBA 3GL6A 2Y1NA 2DX8A 4W4UA 2KWKA 2VJFA 4S3OC 2IDAA 2VNFA 3N9QA 3ZVYA 2RSDA 3O70A 4YADA 4GNEA 4O64A 2AN6A 3HCTA 4L7XA 1WEQA 3KV6A 4R2YA 3RPGC 5AITA 4Q6FA 2KWJA 2MNYA 3EB5A 5KH9A 2F42A 4YBSA 3HTKC 5TRBA 1WE9A 1HYIA 4A49A 2ECVA 2VPBA 2K1JA 4TKPB 3C5KA 2Y43A 2F6JA 4LK9A 4F52B 2LGLA 3O7AA 1FP0A 2K16A 2QJ0A 5J3XA 2MIQA 1G25A 1U6GB 1WEUA 2YHNA 3M63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B7Y C;  4BHW A;  4GNG A;  2H0D A;  2L0B A;  3U5N A;  3ASL A;  4P5O B;  2YYR A;  2VJF B;  1VFY A;  2EOD A;  2Y1M A;  2KE1 A;  4XI1 A;  1Z60 A;  3HCS A;  2CKL A;  5B79 A;  4LAD B;  2PUY A;  3HCU A;  4AVX A;  4GNF A;  2KR4 A;  5LKT A;  3U5P A;  1WEV A;  2MNZ A;  5D1K B;  2K17 A;  5C11 A;  2LRI C;  3PHD A;  4WZ0 A;  4YAX A;  3I2D A;  4A4B A;  3NG2 A;  3T6R A;  4UI9 B;  1IYM A;  4FJC A;  2G6Q A;  5B75 A;  1RMD A;  1VD4 A;  4UP0 A;  2L75 A;  5FB1 A;  4ZDT A;  5DKA A;  5KH7 A;  3O34 A;  2ECJ A;  4YAB A;  3SHB A;  4N3W A;  1WEE A;  4AP4 A;  2VP7 A;  2YQL A;  4I7C A;  4IC2 A;  1ZBD B;  2YW8 A;  3ZPV 1;  2JRJ A;  5G0F A;  4FIP A;  5B77 A;  2VPE A;  4MSX A;  2BAY A;  3DQV R;  3EB6 A;  4FK5 A;  2LN0 A;  2ZET C;  3LRQ A;  2LXH C;  3SOW A;  5KH3 A;  5LKX A;  2OXQ C;  3MHS A;  2JMJ A;  2KGI A;  2CSZ A;  4CA1 A;  2KYU A;  2F6N A;  3L11 A;  2MD7 B;  3RPG B;  1DVP A;  4BBQ A;  2LDR A;  3FL2 A;  2ECN A;  4IC3 A;  5TDR A;  4I7D A;  5B8D A;  3N9N A;  5TBN A;  3GV4 A;  5FER A;  1CHC A;  2LV9 A;  1JM7 B;  2KRE A;  3LQH A;  3N9M A;  4S3O B;  2YU4 A;  4L58 A;  3PUR A;  1LDJ B;  2YSJ A;  2PNX A;  2VJE B;  2YUC A;  4I7B A;  5H9M A;  2VJE A;  5TAB A;  3DPL R;  2HYE D;  5FEY A;  3V43 A;  4NN2 A;  2KWO A;  5D1M B;  3LQJ A;  1WEO A;  4B86 C;  3O35 A;  4GND A;  2CKL B;  5AIU A;  3KNV A;  2L5U A;  1V87 A;  1BOR A;  4LKA A;  2D8S A;  3O37 A;  2JMI A;  3N9L A;  3LQI A;  2KIZ A;  2M6M A;  3L1Z B;  3ZVZ B;  1E4U A;  3MHH A;  5G04 B;  3SOU A;  2YQM A;  1WES A;  4YAT A;  5H1V A;  4X3G A;  2ECI A;  2G45 A;  5TDW A;  3KV5 A;  4R8P K;  3QZV A;  2YUR A;  3M99 A;  4PPE A;  1MM3 A;  1MM2 A;  1LDK C;  2YHO A;  4LLB A;  5I3L A;  4LJN A;  4MVT A;  3ZYQ A;  5B76 A;  3IHP A;  2XB1 A;  2FUI A;  1VYX A;  2C2V S;  5H1U A;  1Z2Q A;  2LGG A;  1WIM A;  1WEM A;  3PUQ A;  1F62 A;  2E6S A;  3ZNI A;  2MA6 A;  5B78 A;  1JM7 A;  2KGG A;  2JMD A;  4CCG X;  5LKZ A;  2MD8 C;  3N9O A;  5H1T A;  1HYJ A;  2NAA A;  2YSM A;  4ZUX U;  1WIL A;  2LGK A;  3U5M A;  2RI7 A;  4QF3 A;  2LGV A;  3N9P A;  2CSY A;  2EGP A;  2I50 A;  4FO9 A;  2M85 A;  3C6W A;  4A0C D;  5C13 A;  2QIZ A;  1WEP A;  2MUM A;  1X4I A;  2L43 A;  4UP5 A;  3L1X A;  3RTR B;  2ECW A;  3O33 A;  1WEN A;  2CT2 A;  4WA6 A;  3U5O A;  4R7E A;  1X4U A;  1FBV A;  3T7L A;  4V3L C;  2FUU A;  3ZTG A;  4YBM A;  3SOX A;  3VK6 A;  2FSA A;  4C9Z A;  4AYC A;  2VPD A;  2KU3 A;  2ECT A;  2H0D B;  4YC9 A;  1Z6U A;  1K2F A;  2EA6 A;  5FB0 A;  2YT5 A;  2K4D A;  1WGM A;  1N87 A;  1XWH A;  5G05 B;  1X4J A;  2M3H A;  4YBT A;  5JG6 A;  4V3K C;  4AUQ B;  2QIC A;  5LKU A;  1T1H A;  1WFK A;  2VPG A;  4QF2 A;  5D1L B;  2E6R A;  4A4C A;  2YRE A;  2L80 A;  2MA5 A;  4GB0 A;  2KWN A;  4WZ2 A;  2G43 A;  2MT5 A;  2LQ6 A;  3KQI A;  4N4F A;  2KFT A;  4AYC B;  3ZPV E;  2HDP A;  5EYA F;  2M1R A;  5LCW B;  1JOC A;  5DIN A;  3M62 A;  4WZ3 B;  1WEW A;  2ECG A;  2LXP C;  2XEU A;  3O36 A;  2UZG A;  4ZQL A;  2C2L A;  4PTB A;  3GL6 A;  2Y1N A;  2DX8 A;  4W4U A;  2KWK A;  2VJF A;  4S3O C;  2IDA A;  2VNF A;  3N9Q A;  3ZVY A;  2RSD A;  3O70 A;  4YAD A;  4GNE A;  4O64 A;  2AN6 A;  3HCT A;  4L7X A;  1WEQ A;  3KV6 A;  4R2Y A;  3RPG C;  5AIT A;  4Q6F A;  2KWJ A;  2MNY A;  3EB5 A;  5KH9 A;  2F42 A;  4YBS A;  3HTK C;  5TRB A;  1WE9 A;  1HYI A;  4A49 A;  2ECV A;  2VPB A;  2K1J A;  4TKP B;  3C5K A;  2Y43 A;  2F6J A;  4LK9 A;  4F52 B;  2LGL A;  3O7A A;  1FP0 A;  2K16 A;  2QJ0 A;  5J3X A;  2MIQ A;  1G25 A;  1U6G B;  1WEU A;  2YHN A;  3M63 A; 
#chains in the Genus database with same CATH topology
 4B7Y C;  4BHW A;  3FM8 C;  4GNG A;  2H0D A;  2L0B A;  3LVQ E;  3SUB A;  3DDT A;  3LDY A;  3U5N A;  3ASL A;  4P5O B;  2YYR A;  3FAO A;  2VJF B;  1VFY A;  2EOD A;  2Y1M A;  2KE1 A;  4XI1 A;  1Z60 A;  3HCS A;  2CKL A;  5B79 A;  4LAD B;  2PUY A;  3HCU A;  4AVX A;  4GNF A;  2KR4 A;  5LKT A;  3U5P A;  1WEV A;  2MNZ A;  2XOC A;  5D1K B;  2K17 A;  5C11 A;  2LRI C;  3H7H A;  3PHD A;  4WZ0 A;  4YAX A;  4F1P A;  3I2D A;  4A4B A;  3NG2 A;  3T6R A;  2KKX A;  4UI9 B;  1IYM A;  4FJC A;  2G6Q A;  5B75 A;  1RMD A;  1VD4 A;  4UP0 A;  2L75 A;  5FB1 A;  4ZDT A;  5SVX A;  5DKA A;  5KH7 A;  4Z0R A;  3O34 A;  2CRR A;  2ECJ A;  4YAB A;  3SHB A;  4N3W A;  1WEE A;  2LAU A;  4AP4 A;  2VP7 A;  3LJU X;  2YQL A;  2EXU A;  4O62 A;  4I7C A;  4IC2 A;  1ZBD B;  2YW8 A;  3FEH A;  3ZPV 1;  2JRJ A;  5G0F A;  4FIP A;  5B77 A;  2VPE A;  4MSX A;  2BAY A;  3DQV R;  2JUN A;  3EB6 A;  4FK5 A;  2LN0 A;  2ZET C;  3LRQ A;  2LXH C;  3SOW A;  5KH3 A;  5LKX A;  2OXQ C;  3MHS A;  2JMJ A;  3E2D A;  2KGI A;  2CSZ A;  4CA1 A;  2KYU A;  2F6N A;  4OGC A;  3T9K A;  3L11 A;  2MD7 B;  3RPG B;  1DVP A;  4BBQ A;  2LDR A;  3FL2 A;  2FFW A;  2B0O E;  2ECN A;  2CSV A;  4IC3 A;  5TDR A;  4I7D A;  5B8D A;  3N9N A;  5TBN A;  3GV4 A;  5FER A;  1CHC A;  2LV9 A;  1JM7 B;  2KRE A;  3LQH A;  3N9M A;  4S3O B;  2YU4 A;  4L58 A;  3PUR A;  1LDJ B;  3KDE C;  2YSJ A;  2PNX A;  5SVI B;  2VJE B;  2YUC A;  4I7B A;  5H9M A;  2VJE A;  5TAB A;  3DPL R;  2HYE D;  5FEY A;  3V43 A;  4NN2 A;  2KWO A;  4Z0O A;  5D1M B;  3LQJ A;  4QQ4 A;  1WEO A;  4B86 C;  3O35 A;  4GND A;  2CKL B;  5AIU A;  3KNV A;  2L5U A;  1V87 A;  1BOR A;  4LKA A;  2D8S A;  3O37 A;  2JMI A;  3N9L A;  3LQI A;  2KIZ A;  2M6M A;  5SVY A;  3L1Z B;  3ZVZ B;  1E4U A;  3MHH A;  5G04 B;  2CRW A;  3SOU A;  2YQM A;  1WES A;  4YAT A;  3Q1D A;  5H1V A;  4X3G A;  2ECI A;  2G45 A;  5TDW A;  3KV5 A;  4R8P K;  3QZV A;  2YUR A;  3M99 A;  4PPE A;  1MM3 A;  1MM2 A;  1LDK C;  2YHO A;  2RR4 A;  4LLB A;  5I3L A;  4LJN A;  4MVT A;  3ZYQ A;  5B76 A;  3IHP A;  2XB1 A;  2FUI A;  2YVR A;  1VYX A;  2MKE A;  2C2V S;  5H1U A;  1Z2Q A;  2LGG A;  1WIM A;  1DCQ A;  1WEM A;  3PUQ A;  1F62 A;  2E6S A;  3ZNI A;  2MA6 A;  5B78 A;  1JM7 A;  2KGG A;  2P57 A;  2M13 A;  2JMD A;  4CCG X;  5LKZ A;  2MD8 C;  3N9O A;  5H1T A;  1HYJ A;  2NAA A;  2YSM A;  4ZUX U;  1WIL A;  2JM3 A;  2LGK A;  3JUE A;  2RI7 A;  3U5M A;  4QF3 A;  2LGV A;  3FAN A;  3N9P A;  2CSY A;  2EGP A;  2I50 A;  4FO9 A;  2M85 A;  4H9D A;  3C6W A;  4A0C D;  5C13 A;  2QIZ A;  1WEP A;  2MUM A;  1X4I A;  2L43 A;  4UP5 A;  3L1X A;  3RTR B;  2ECW A;  3O33 A;  1WEN A;  2CT2 A;  4WA6 A;  3U5O A;  4R7E A;  1X4U A;  1FBV A;  2XOZ A;  3T7L A;  4V3L C;  2FUU A;  3ZTG A;  2EGM A;  4YBM A;  3SOX A;  2E61 A;  3VK6 A;  2FSA A;  4C9Z A;  2DJA A;  4AYC A;  2VPD A;  2KU3 A;  2ECT A;  2H0D B;  2IQJ A;  4YC9 A;  1Z6U A;  3DWD A;  1K2F A;  2EA6 A;  5FB0 A;  2YT5 A;  2K4D A;  1WGM A;  1N87 A;  1XWH A;  5G05 B;  1X4J A;  2M3H A;  4YBT A;  5JG6 A;  4V3K C;  4AUQ B;  2QIC A;  5LKU A;  2OWA A;  1T1H A;  2CON A;  2FD4 A;  1WFK A;  2VPG A;  5SVI A;  3FJU B;  3LVR E;  4QF2 A;  5K3Q A;  5D1L B;  2E6R A;  4A4C A;  2YRE A;  2L80 A;  2MA5 A;  4GB0 A;  2KWN A;  4WZ2 A;  3MDB C;  2G43 A;  2MT5 A;  2LQ6 A;  3KQI A;  1MBM A;  4N4F A;  2KFT A;  4AYC B;  3ZPV E;  2HDP A;  5EYA F;  2M1R A;  5LCW B;  1JOC A;  3PLW A;  2L7P A;  5DIN A;  3M62 A;  4WZ3 B;  1WEW A;  2ECG A;  2LXP C;  2XEU A;  3O36 A;  2UZG A;  4ZQL A;  2C2L A;  2DSM A;  4PTB A;  3GL6 A;  2Y1N A;  2DX8 A;  4W4U A;  2KWK A;  2VJF A;  4S3O C;  2IDA A;  2VNF A;  3N9Q A;  3ZVY A;  2RSD A;  3O70 A;  4YAD A;  4GNE A;  4O64 A;  2AN6 A;  2XP0 A;  3HCT A;  4L7X A;  2KKY A;  1WEQ A;  3KV6 A;  4R2Y A;  3RPG C;  5AIT A;  4Q6F A;  2KWJ A;  2MNY A;  3EB5 A;  5KH9 A;  2F42 A;  4YBS A;  2XOY A;  2D8U A;  3HTK C;  5TRB A;  1WE9 A;  1HYI A;  2VPB A;  2ECV A;  4A49 A;  2K1J A;  3M7K A;  4TKP B;  3C5K A;  2Y43 A;  2F6J A;  4LK9 A;  4F52 B;  3O47 A;  2LGL A;  3O7A A;  1FP0 A;  2K16 A;  2QJ0 A;  5J3X A;  2MIQ A;  1G25 A;  4OGE A;  1U6G B;  1WEU A;  2YHN A;  3M63 A; 
#chains in the Genus database with same CATH homology
 4B7Y C;  4BHW A;  4GNG A;  2H0D A;  2L0B A;  3U5N A;  3ASL A;  4P5O B;  2YYR A;  2VJF B;  1VFY A;  2EOD A;  2Y1M A;  2KE1 A;  4XI1 A;  1Z60 A;  3HCS A;  2CKL A;  5B79 A;  4LAD B;  2PUY A;  3HCU A;  4AVX A;  4GNF A;  2KR4 A;  5LKT A;  3U5P A;  1WEV A;  2MNZ A;  5D1K B;  2K17 A;  5C11 A;  2LRI C;  3PHD A;  4WZ0 A;  4YAX A;  3I2D A;  4A4B A;  3NG2 A;  3T6R A;  4UI9 B;  1IYM A;  4FJC A;  2G6Q A;  5B75 A;  1RMD A;  1VD4 A;  4UP0 A;  2L75 A;  5FB1 A;  4ZDT A;  5DKA A;  5KH7 A;  3O34 A;  2ECJ A;  4YAB A;  3SHB A;  4N3W A;  1WEE A;  4AP4 A;  2VP7 A;  2YQL A;  4I7C A;  4IC2 A;  1ZBD B;  2YW8 A;  3ZPV 1;  2JRJ A;  5G0F A;  4FIP A;  5B77 A;  2VPE A;  4MSX A;  2BAY A;  3DQV R;  3EB6 A;  4FK5 A;  2LN0 A;  2ZET C;  3LRQ A;  2LXH C;  3SOW A;  5KH3 A;  5LKX A;  2OXQ C;  3MHS A;  2JMJ A;  2KGI A;  2CSZ A;  4CA1 A;  2KYU A;  2F6N A;  3L11 A;  2MD7 B;  3RPG B;  1DVP A;  4BBQ A;  2LDR A;  3FL2 A;  2ECN A;  4IC3 A;  5TDR A;  4I7D A;  5B8D A;  3N9N A;  5TBN A;  3GV4 A;  5FER A;  1CHC A;  2LV9 A;  1JM7 B;  2KRE A;  3LQH A;  3N9M A;  4S3O B;  2YU4 A;  4L58 A;  3PUR A;  1LDJ B;  2YSJ A;  2PNX A;  2VJE B;  2YUC A;  4I7B A;  5H9M A;  2VJE A;  5TAB A;  3DPL R;  2HYE D;  5FEY A;  3V43 A;  4NN2 A;  2KWO A;  5D1M B;  3LQJ A;  1WEO A;  4B86 C;  3O35 A;  4GND A;  2CKL B;  5AIU A;  3KNV A;  2L5U A;  1V87 A;  1BOR A;  4LKA A;  2D8S A;  3O37 A;  2JMI A;  3N9L A;  3LQI A;  2KIZ A;  2M6M A;  3L1Z B;  3ZVZ B;  1E4U A;  3MHH A;  5G04 B;  3SOU A;  2YQM A;  1WES A;  4YAT A;  5H1V A;  4X3G A;  2ECI A;  2G45 A;  5TDW A;  3KV5 A;  4R8P K;  3QZV A;  2YUR A;  3M99 A;  4PPE A;  1MM3 A;  1MM2 A;  1LDK C;  2YHO A;  4LLB A;  5I3L A;  4LJN A;  4MVT A;  3ZYQ A;  5B76 A;  3IHP A;  2XB1 A;  2FUI A;  1VYX A;  2C2V S;  5H1U A;  1Z2Q A;  2LGG A;  1WIM A;  1WEM A;  3PUQ A;  1F62 A;  2E6S A;  3ZNI A;  2MA6 A;  5B78 A;  1JM7 A;  2KGG A;  2JMD A;  4CCG X;  5LKZ A;  2MD8 C;  3N9O A;  5H1T A;  1HYJ A;  2NAA A;  2YSM A;  4ZUX U;  1WIL A;  2LGK A;  3U5M A;  2RI7 A;  4QF3 A;  2LGV A;  3N9P A;  2CSY A;  2EGP A;  2I50 A;  4FO9 A;  2M85 A;  3C6W A;  4A0C D;  5C13 A;  2QIZ A;  1WEP A;  2MUM A;  1X4I A;  2L43 A;  4UP5 A;  3L1X A;  3RTR B;  2ECW A;  3O33 A;  1WEN A;  2CT2 A;  4WA6 A;  3U5O A;  4R7E A;  1X4U A;  1FBV A;  3T7L A;  4V3L C;  2FUU A;  3ZTG A;  4YBM A;  3SOX A;  3VK6 A;  2FSA A;  4C9Z A;  4AYC A;  2VPD A;  2KU3 A;  2ECT A;  2H0D B;  4YC9 A;  1Z6U A;  1K2F A;  2EA6 A;  5FB0 A;  2YT5 A;  2K4D A;  1WGM A;  1N87 A;  1XWH A;  5G05 B;  1X4J A;  2M3H A;  4YBT A;  5JG6 A;  4V3K C;  4AUQ B;  2QIC A;  5LKU A;  1T1H A;  1WFK A;  2VPG A;  4QF2 A;  5D1L B;  2E6R A;  4A4C A;  2YRE A;  2L80 A;  2MA5 A;  4GB0 A;  2KWN A;  4WZ2 A;  2G43 A;  2MT5 A;  2LQ6 A;  3KQI A;  4N4F A;  2KFT A;  4AYC B;  3ZPV E;  2HDP A;  5EYA F;  2M1R A;  5LCW B;  1JOC A;  5DIN A;  3M62 A;  4WZ3 B;  1WEW A;  2ECG A;  2LXP C;  2XEU A;  3O36 A;  2UZG A;  4ZQL A;  2C2L A;  4PTB A;  3GL6 A;  2Y1N A;  2DX8 A;  4W4U A;  2KWK A;  2VJF A;  4S3O C;  2IDA A;  2VNF A;  3N9Q A;  3ZVY A;  2RSD A;  3O70 A;  4YAD A;  4GNE A;  4O64 A;  2AN6 A;  3HCT A;  4L7X A;  1WEQ A;  3KV6 A;  4R2Y A;  3RPG C;  5AIT A;  4Q6F A;  2KWJ A;  2MNY A;  3EB5 A;  5KH9 A;  2F42 A;  4YBS A;  3HTK C;  5TRB A;  1WE9 A;  1HYI A;  4A49 A;  2ECV A;  2VPB A;  2K1J A;  4TKP B;  3C5K A;  2Y43 A;  2F6J A;  4LK9 A;  4F52 B;  2LGL A;  3O7A A;  1FP0 A;  2K16 A;  2QJ0 A;  5J3X A;  2MIQ A;  1G25 A;  1U6G B;  1WEU A;  2YHN A;  3M63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...