2IDAA

Solution nmr structure of protein rpa1320 from rhodopseudomonas palustris. northeast structural genomics consortium target rpt3; ontario center for structural proteomics target rp1313.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
MTMGCRHVAGIRTVTPSALGCEECLKIGSPWVHLRICRTCGHVGCCDDSPHKHATRHFHATGHPIIEGYDPPEGWGWCYVDEVMFDLSDRMTPHNGPIPRYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
publication title Solution structure of RPA1320
rcsb
source organism Rhodopseudomonas palustris
total genus 24
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2idaA01
2CT2A 2K4DA 2UZGA 2FUUA 3RPGC 2ZETC 2YURA 3ZTGA 5TABA 4NN2A 4GNFA 2YYRA 2LGGA 3IHPA 3N9LA 2LGKA 2LRIC 5G0FA 5B79A 1WEQA 3KV5A 1VYXA 1X4UA 2MNYA 3O34A 4ZQLA 5H9MA 2ECNA 3U5PA 4W4UA 1MM2A 2VJEB 5LKXA 4F52B 1WEWA 2ECVA 4AYCB 2F6NA 4A4CA 4UP0A 2FUIA 1VD4A 5G04B 2JMJA 4FK5A 2PUYA 4CCGX 1X4IA 3ZNIA 5D1LB 5TDWA 3EB5A 4R8PK 4I7DA 5B8DA 5FB1A 2YHNA 3N9QA 1HYIA 5I3LA 2MNZA 2G45A 3LQIA 2JRJA 4AUQB 3LQJA 2VJEA 4FJCA 4V3KC 5JG6A 1CHCA 2KREA 3LRQA 4AYCA 1VFYA 5FERA 1Z6UA 2KWKA 4L7XA 5H1UA 3RPGB 3V43A 1K2FA 4LKAA 3RTRB 4N4FA 2MD7B 3HTKC 3O35A 4ZUXU 4L58A 2ECWA 4WZ2A 2D8SA 1G25A 2XEUA 2KU3A 4GNEA 2YHOA 4N3WA 4O64A 2M6MA 3N9OA 3HCSA 3ZPV1 4WZ0A 2M1RA 2YT5A 5DKAA 5FEYA 1WEVA 4WZ3B 4MSXA 4P5OB 5C13A 1WGMA 3U5OA 2LQ6A 1WEPA 2LXHC 2IDAA 5LKZA 4PTBA 3N9PA 1WEMA 2KGGA 4TKPB 4YBSA 5B75A 4V3LC 4AVXA 2FSAA 2YREA 3MHHA 2KGIA 3PUQA 1IYMA 2ECGA 3KV6A 2LXPC 1JM7A 2LDRA 2H0DB 2KR4A 2KYUA 1BORA 2I50A 3SHBA 2JMIA 2F42A 3DPLR 2YSJA 4B7YC 5B76A 1WEOA 1Z2QA 3EB6A 4BHWA 3GL6A 3KQIA 2KWJA 5LKTA 4GB0A 4GNGA 5C11A 2F6JA 4IC2A 5DINA 2JMDA 3C6WA 3SOUA 2MT5A 1WFKA 2MD8C 4I7CA 2YW8A 2C2VS 4A49A 2H0DA 1T1HA 3HCTA 2YU4A 1HYJA 3ZVYA 4AP4A 3ZVZB 4Q6FA 3N9NA 2L5UA 2PNXA 4IC3A 5B77A 5TDRA 2KWOA 2E6SA 2VNFA 3L11A 2K1JA 4X3GA 3C5KA 4I7BA 4LLBA 3KNVA 5AIUA 2VPBA 1ZBDB 2ECIA 5H1VA 2LGLA 2RI7A 5LKUA 2Y43A 4S3OC 4LJNA 4LADB 3ZPVE 3HCUA 2VJFA 4WA6A 3MHSA 1X4JA 3ZYQA 4YADA 1LDJB 2CKLB 1WESA 2G6QA 3O70A 2Y1NA 1JM7B 2YQMA 2QJ0A 2QICA 2YQLA 2BAYA 1U6GB 3QZVA 2ECJA 3U5NA 5LCWB 3U5MA 2VPEA 4BBQA 4YBTA 4A0CD 3O7AA 2CKLA 2YUCA 2VPGA 4GNDA 3ASLA 3VK6A 3L1ZB 1RMDA 4C9ZA 2KIZA 1F62A 1N87A 4UI9B 1WE9A 2EA6A 3GV4A 5D1KB 3T6RA 4PPEA 2DX8A 2KFTA 2MA6A 1WEEA 2EGPA 3DQVR 4ZDTA 1FP0A 2KWNA 4R2YA 4S3OB 4XI1A 2AN6A 2VPDA 2L80A 1WILA 5KH3A 5H1TA 1FBVA 3M63A 4CA1A 1DVPA 2QIZA 3T7LA 2C2LA 2ECTA 4QF2A 2L0BA 4YAXA 2KE1A 3FL2A 2VJFB 2E6RA 3O36A 4QF3A 2MIQA 1WEUA 1WIMA 2G43A 2HYED 2NAAA 3NG2A 4YATA 2Y1MA 5EYAF 2M85A 5AITA 5TBNA 3M62A 3L1XA 2EODA 2OXQC 4YBMA 3N9MA 3LQHA 1LDKC 2L43A 5KH7A 4MVTA 4R7EA 1V87A 5B78A 1E4UA 2YSMA 1Z60A 1JOCA 2LN0A 4UP5A 3PURA 3SOXA 3O37A 5G05B 4FIPA 4YABA 2L75A 5FB0A 4A4BA 4FO9A 4LK9A 5D1MB 2K16A 2RSDA 2CSYA 2LGVA 3O33A 2K17A 3M99A 1MM3A 4YC9A 2VP7A 2LV9A 1XWHA 1WENA 3SOWA 5J3XA 5TRBA 3PHDA 2MA5A 5KH9A 3I2DA 2XB1A 2M3HA 2HDPA 2CSZA 2MUMA 4B86C
chains in the Genus database with same CATH superfamily
2CT2A 2IQJA 2K4DA 2UZGA 2FUUA 3RPGC 2ZETC 2YURA 3ZTGA 5TABA 4NN2A 4GNFA 2YYRA 2CRWA 2LGGA 3IHPA 2KKXA 3N9LA 2LGKA 2LRIC 5G0FA 5B79A 1WEQA 3KV5A 1VYXA 1X4UA 2MNYA 3O34A 4ZQLA 3LDYA 5H9MA 2ECNA 3U5PA 4W4UA 1MM2A 2VJEB 5LKXA 4F52B 1WEWA 2ECVA 4AYCB 2F6NA 4A4CA 4UP0A 2FUIA 1VD4A 3LJUX 5G04B 2JMJA 3LVQE 4FK5A 2PUYA 4CCGX 1X4IA 3ZNIA 5D1LB 5TDWA 3EB5A 4R8PK 3LVRE 4I7DA 5B8DA 5FB1A 2YHNA 3N9QA 1HYIA 5I3LA 2JM3A 2MNZA 4Z0RA 2G45A 3LQIA 2JRJA 4AUQB 3LQJA 2VJEA 4FJCA 4V3KC 5JG6A 1CHCA 2KREA 3LRQA 4AYCA 1VFYA 5FERA 1Z6UA 2KWKA 4L7XA 5H1UA 3RPGB 3V43A 1K2FA 4LKAA 3RTRB 2EXUA 4N4FA 2MD7B 2KKYA 3HTKC 3O35A 4ZUXU 4L58A 2ECWA 4WZ2A 2D8SA 1G25A 2XEUA 2KU3A 4GNEA 2YHOA 4N3WA 4O64A 2M6MA 3N9OA 3HCSA 3ZPV1 4WZ0A 2M1RA 4H9DA 2YT5A 5DKAA 5FEYA 1WEVA 3DWDA 4WZ3B 3SUBA 3PLWA 4MSXA 4P5OB 5C13A 1WGMA 3U5OA 2LQ6A 4OGCA 1WEPA 3E2DA 3DDTA 2LXHC 2IDAA 4Z0OA 4F1PA 5LKZA 4PTBA 3N9PA 1WEMA 2KGGA 4TKPB 4YBSA 5B75A 4V3LC 4AVXA 2OWAA 2FSAA 2YREA 3MHHA 2KGIA 3PUQA 1IYMA 2ECGA 3KV6A 2D8UA 2LXPC 1JM7A 2LDRA 2H0DB 2KR4A 2KYUA 1BORA 2I50A 3SHBA 2JMIA 2F42A 3DPLR 2YSJA 4B7YC 5B76A 1WEOA 1Z2QA 3EB6A 4BHWA 3GL6A 3KQIA 2KWJA 5LKTA 4GB0A 4GNGA 5C11A 2F6JA 4IC2A 5DINA 2JMDA 3C6WA 3SOUA 2MT5A 1WFKA 2MD8C 4I7CA 2YW8A 2C2VS 4A49A 2H0DA 1T1HA 3HCTA 3M7KA 2YU4A 1HYJA 3ZVYA 4AP4A 3FJUB 3ZVZB 2JUNA 4Q6FA 3N9NA 5SVIA 2L5UA 2PNXA 4IC3A 5B77A 5TDRA 2KWOA 2E61A 2E6SA 2LAUA 2VNFA 3L11A 2K1JA 4X3GA 3C5KA 4I7BA 4LLBA 3MDBC 2RR4A 2DJAA 3KNVA 5AIUA 2FD4A 3FM8C 2VPBA 1ZBDB 2ECIA 2FFWA 4O62A 3FEHA 5H1VA 2LGLA 2XOZA 2RI7A 5LKUA 2Y43A 4S3OC 4LJNA 5SVXA 4LADB 2YVRA 3ZPVE 2XP0A 3T9KA 3HCUA 2VJFA 4WA6A 2CRRA 3MHSA 1X4JA 3ZYQA 4YADA 1LDJB 5SVYA 3KDEC 2CKLB 2XOCA 1WESA 2G6QA 3O70A 2Y1NA 1JM7B 2YQMA 2QJ0A 5K3QA 2QICA 2YQLA 2BAYA 2DSMA 1U6GB 3QZVA 2ECJA 2M13A 3U5NA 5LCWB 3U5MA 2VPEA 4BBQA 4YBTA 4A0CD 3O7AA 2CKLA 2YUCA 3Q1DA 2VPGA 4GNDA 3FANA 3ASLA 3VK6A 3L1ZB 1RMDA 4C9ZA 2KIZA 1F62A 1N87A 4UI9B 1WE9A 2EA6A 3GV4A 5D1KB 3T6RA 4PPEA 2DX8A 1MBMA 2KFTA 1WEEA 2MA6A 2EGPA 3DQVR 5SVIB 4ZDTA 1FP0A 2KWNA 4OGEA 4R2YA 4S3OB 4XI1A 2B0OE 3JUEA 2AN6A 2VPDA 2L80A 1WILA 5KH3A 5H1TA 1FBVA 3M63A 4CA1A 1DVPA 2QIZA 3T7LA 2C2LA 2ECTA 4QF2A 2L0BA 4YAXA 2KE1A 3FL2A 2VJFB 2E6RA 3O36A 4QF3A 2NAAA 2MIQA 1WEUA 1WIMA 3NG2A 2G43A 2CSVA 2HYED 4YATA 2Y1MA 5EYAF 2M85A 5AITA 5TBNA 3M62A 3L1XA 2EODA 2OXQC 4YBMA 3N9MA 3LQHA 1LDKC 2L43A 5KH7A 4MVTA 4R7EA 1DCQA 1V87A 5B78A 2EGMA 1E4UA 2CONA 3O47A 2YSMA 1Z60A 1JOCA 2LN0A 4UP5A 3PURA 3SOXA 3O37A 5G05B 4FIPA 4YABA 2L75A 5FB0A 4A4BA 2L7PA 4FO9A 4LK9A 5D1MB 2K16A 2RSDA 4QQ4A 2CSYA 2LGVA 3O33A 2K17A 3M99A 1MM3A 4YC9A 2XOYA 2VP7A 2P57A 2LV9A 1XWHA 1WENA 3SOWA 3H7HA 2MKEA 5J3XA 5TRBA 3PHDA 2MA5A 5KH9A 3I2DA 2XB1A 2M3HA 2HDPA 3FAOA 2CSZA 2MUMA 4B86C
chains in the Genus database with same CATH topology
2CT2A 2K4DA 2UZGA 2FUUA 3RPGC 2ZETC 2YURA 3ZTGA 5TABA 4NN2A 4GNFA 2YYRA 2LGGA 3IHPA 3N9LA 2LGKA 2LRIC 5G0FA 5B79A 1WEQA 3KV5A 1VYXA 1X4UA 2MNYA 3O34A 4ZQLA 5H9MA 2ECNA 3U5PA 4W4UA 1MM2A 2VJEB 5LKXA 4F52B 1WEWA 2ECVA 4AYCB 2F6NA 4A4CA 4UP0A 2FUIA 1VD4A 5G04B 2JMJA 4FK5A 2PUYA 4CCGX 1X4IA 3ZNIA 5D1LB 5TDWA 3EB5A 4R8PK 4I7DA 5B8DA 5FB1A 2YHNA 3N9QA 1HYIA 5I3LA 2MNZA 2G45A 3LQIA 2JRJA 4AUQB 3LQJA 2VJEA 4FJCA 4V3KC 5JG6A 1CHCA 2KREA 3LRQA 4AYCA 1VFYA 5FERA 1Z6UA 2KWKA 4L7XA 5H1UA 3RPGB 3V43A 1K2FA 4LKAA 3RTRB 4N4FA 2MD7B 3HTKC 3O35A 4ZUXU 4L58A 2ECWA 4WZ2A 2D8SA 1G25A 2XEUA 2KU3A 4GNEA 2YHOA 4N3WA 4O64A 2M6MA 3N9OA 3HCSA 3ZPV1 4WZ0A 2M1RA 2YT5A 5DKAA 5FEYA 1WEVA 4WZ3B 4MSXA 4P5OB 5C13A 1WGMA 3U5OA 2LQ6A 1WEPA 2LXHC 2IDAA 5LKZA 4PTBA 3N9PA 1WEMA 2KGGA 4TKPB 4YBSA 5B75A 4V3LC 4AVXA 2FSAA 2YREA 3MHHA 2KGIA 3PUQA 1IYMA 2ECGA 3KV6A 2LXPC 1JM7A 2LDRA 2H0DB 2KR4A 2KYUA 1BORA 2I50A 3SHBA 2JMIA 2F42A 3DPLR 2YSJA 4B7YC 5B76A 1WEOA 1Z2QA 3EB6A 4BHWA 3GL6A 3KQIA 2KWJA 5LKTA 4GB0A 4GNGA 5C11A 2F6JA 4IC2A 5DINA 2JMDA 3C6WA 3SOUA 2MT5A 1WFKA 2MD8C 4I7CA 2YW8A 2C2VS 4A49A 2H0DA 1T1HA 3HCTA 2YU4A 1HYJA 3ZVYA 4AP4A 3ZVZB 4Q6FA 3N9NA 2L5UA 2PNXA 4IC3A 5B77A 5TDRA 2KWOA 2E6SA 2VNFA 3L11A 2K1JA 4X3GA 3C5KA 4I7BA 4LLBA 3KNVA 5AIUA 2VPBA 1ZBDB 2ECIA 5H1VA 2LGLA 2RI7A 5LKUA 2Y43A 4S3OC 4LJNA 4LADB 3ZPVE 3HCUA 2VJFA 4WA6A 3MHSA 1X4JA 3ZYQA 4YADA 1LDJB 2CKLB 1WESA 2G6QA 3O70A 2Y1NA 1JM7B 2YQMA 2QJ0A 2QICA 2YQLA 2BAYA 1U6GB 3QZVA 2ECJA 3U5NA 5LCWB 3U5MA 2VPEA 4BBQA 4YBTA 4A0CD 3O7AA 2CKLA 2YUCA 2VPGA 4GNDA 3ASLA 3VK6A 3L1ZB 1RMDA 4C9ZA 2KIZA 1F62A 1N87A 4UI9B 1WE9A 2EA6A 3GV4A 5D1KB 3T6RA 4PPEA 2DX8A 2KFTA 2MA6A 1WEEA 2EGPA 3DQVR 4ZDTA 1FP0A 2KWNA 4R2YA 4S3OB 4XI1A 2AN6A 2VPDA 2L80A 1WILA 5KH3A 5H1TA 1FBVA 3M63A 4CA1A 1DVPA 2QIZA 3T7LA 2C2LA 2ECTA 4QF2A 2L0BA 4YAXA 2KE1A 3FL2A 2VJFB 2E6RA 3O36A 4QF3A 2MIQA 1WEUA 1WIMA 2G43A 2HYED 2NAAA 3NG2A 4YATA 2Y1MA 5EYAF 2M85A 5AITA 5TBNA 3M62A 3L1XA 2EODA 2OXQC 4YBMA 3N9MA 3LQHA 1LDKC 2L43A 5KH7A 4MVTA 4R7EA 1V87A 5B78A 1E4UA 2YSMA 1Z60A 1JOCA 2LN0A 4UP5A 3PURA 3SOXA 3O37A 5G05B 4FIPA 4YABA 2L75A 5FB0A 4A4BA 4FO9A 4LK9A 5D1MB 2K16A 2RSDA 2CSYA 2LGVA 3O33A 2K17A 3M99A 1MM3A 4YC9A 2VP7A 2LV9A 1XWHA 1WENA 3SOWA 5J3XA 5TRBA 3PHDA 2MA5A 5KH9A 3I2DA 2XB1A 2M3HA 2HDPA 2CSZA 2MUMA 4B86C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT2 A;  2K4D A;  2UZG A;  2FUU A;  3RPG C;  2ZET C;  2YUR A;  3ZTG A;  5TAB A;  4NN2 A;  4GNF A;  2YYR A;  2LGG A;  3IHP A;  3N9L A;  2LGK A;  2LRI C;  5G0F A;  5B79 A;  1WEQ A;  3KV5 A;  1VYX A;  1X4U A;  2MNY A;  3O34 A;  4ZQL A;  5H9M A;  2ECN A;  3U5P A;  4W4U A;  1MM2 A;  2VJE B;  5LKX A;  4F52 B;  1WEW A;  2ECV A;  4AYC B;  2F6N A;  4A4C A;  4UP0 A;  2FUI A;  1VD4 A;  5G04 B;  2JMJ A;  4FK5 A;  2PUY A;  4CCG X;  1X4I A;  3ZNI A;  5D1L B;  5TDW A;  3EB5 A;  4R8P K;  4I7D A;  5B8D A;  5FB1 A;  2YHN A;  3N9Q A;  1HYI A;  5I3L A;  2MNZ A;  2G45 A;  3LQI A;  2JRJ A;  4AUQ B;  3LQJ A;  2VJE A;  4FJC A;  4V3K C;  5JG6 A;  1CHC A;  2KRE A;  3LRQ A;  4AYC A;  1VFY A;  5FER A;  1Z6U A;  2KWK A;  4L7X A;  5H1U A;  3RPG B;  3V43 A;  1K2F A;  4LKA A;  3RTR B;  4N4F A;  2MD7 B;  3HTK C;  3O35 A;  4ZUX U;  4L58 A;  2ECW A;  4WZ2 A;  2D8S A;  1G25 A;  2XEU A;  2KU3 A;  4GNE A;  2YHO A;  4N3W A;  4O64 A;  2M6M A;  3N9O A;  3HCS A;  3ZPV 1;  4WZ0 A;  2M1R A;  2YT5 A;  5DKA A;  5FEY A;  1WEV A;  4WZ3 B;  4MSX A;  4P5O B;  5C13 A;  1WGM A;  3U5O A;  2LQ6 A;  1WEP A;  2LXH C;  2IDA A;  5LKZ A;  4PTB A;  3N9P A;  1WEM A;  2KGG A;  4TKP B;  4YBS A;  5B75 A;  4V3L C;  4AVX A;  2FSA A;  2YRE A;  3MHH A;  2KGI A;  3PUQ A;  1IYM A;  2ECG A;  3KV6 A;  2LXP C;  1JM7 A;  2LDR A;  2H0D B;  2KR4 A;  2KYU A;  1BOR A;  2I50 A;  3SHB A;  2JMI A;  2F42 A;  3DPL R;  2YSJ A;  4B7Y C;  5B76 A;  1WEO A;  1Z2Q A;  3EB6 A;  4BHW A;  3GL6 A;  3KQI A;  2KWJ A;  5LKT A;  4GB0 A;  4GNG A;  5C11 A;  2F6J A;  4IC2 A;  5DIN A;  2JMD A;  3C6W A;  3SOU A;  2MT5 A;  1WFK A;  2MD8 C;  4I7C A;  2YW8 A;  2C2V S;  4A49 A;  2H0D A;  1T1H A;  3HCT A;  2YU4 A;  1HYJ A;  3ZVY A;  4AP4 A;  3ZVZ B;  4Q6F A;  3N9N A;  2L5U A;  2PNX A;  4IC3 A;  5B77 A;  5TDR A;  2KWO A;  2E6S A;  2VNF A;  3L11 A;  2K1J A;  4X3G A;  3C5K A;  4I7B A;  4LLB A;  3KNV A;  5AIU A;  2VPB A;  1ZBD B;  2ECI A;  5H1V A;  2LGL A;  2RI7 A;  5LKU A;  2Y43 A;  4S3O C;  4LJN A;  4LAD B;  3ZPV E;  3HCU A;  2VJF A;  4WA6 A;  3MHS A;  1X4J A;  3ZYQ A;  4YAD A;  1LDJ B;  2CKL B;  1WES A;  2G6Q A;  3O70 A;  2Y1N A;  1JM7 B;  2YQM A;  2QJ0 A;  2QIC A;  2YQL A;  2BAY A;  1U6G B;  3QZV A;  2ECJ A;  3U5N A;  5LCW B;  3U5M A;  2VPE A;  4BBQ A;  4YBT A;  4A0C D;  3O7A A;  2CKL A;  2YUC A;  2VPG A;  4GND A;  3ASL A;  3VK6 A;  3L1Z B;  1RMD A;  4C9Z A;  2KIZ A;  1F62 A;  1N87 A;  4UI9 B;  1WE9 A;  2EA6 A;  3GV4 A;  5D1K B;  3T6R A;  4PPE A;  2DX8 A;  2KFT A;  2MA6 A;  1WEE A;  2EGP A;  3DQV R;  4ZDT A;  1FP0 A;  2KWN A;  4R2Y A;  4S3O B;  4XI1 A;  2AN6 A;  2VPD A;  2L80 A;  1WIL A;  5KH3 A;  5H1T A;  1FBV A;  3M63 A;  4CA1 A;  1DVP A;  2QIZ A;  3T7L A;  2C2L A;  2ECT A;  4QF2 A;  2L0B A;  4YAX A;  2KE1 A;  3FL2 A;  2VJF B;  2E6R A;  3O36 A;  4QF3 A;  2MIQ A;  1WEU A;  1WIM A;  2G43 A;  2HYE D;  2NAA A;  3NG2 A;  4YAT A;  2Y1M A;  5EYA F;  2M85 A;  5AIT A;  5TBN A;  3M62 A;  3L1X A;  2EOD A;  2OXQ C;  4YBM A;  3N9M A;  3LQH A;  1LDK C;  2L43 A;  5KH7 A;  4MVT A;  4R7E A;  1V87 A;  5B78 A;  1E4U A;  2YSM A;  1Z60 A;  1JOC A;  2LN0 A;  4UP5 A;  3PUR A;  3SOX A;  3O37 A;  5G05 B;  4FIP A;  4YAB A;  2L75 A;  5FB0 A;  4A4B A;  4FO9 A;  4LK9 A;  5D1M B;  2K16 A;  2RSD A;  2CSY A;  2LGV A;  3O33 A;  2K17 A;  3M99 A;  1MM3 A;  4YC9 A;  2VP7 A;  2LV9 A;  1XWH A;  1WEN A;  3SOW A;  5J3X A;  5TRB A;  3PHD A;  2MA5 A;  5KH9 A;  3I2D A;  2XB1 A;  2M3H A;  2HDP A;  2CSZ A;  2MUM A;  4B86 C; 
#chains in the Genus database with same CATH topology
 2CT2 A;  2IQJ A;  2K4D A;  2UZG A;  2FUU A;  3RPG C;  2ZET C;  2YUR A;  3ZTG A;  5TAB A;  4NN2 A;  4GNF A;  2YYR A;  2CRW A;  2LGG A;  3IHP A;  2KKX A;  3N9L A;  2LGK A;  2LRI C;  5G0F A;  5B79 A;  1WEQ A;  3KV5 A;  1VYX A;  1X4U A;  2MNY A;  3O34 A;  4ZQL A;  3LDY A;  5H9M A;  2ECN A;  3U5P A;  4W4U A;  1MM2 A;  2VJE B;  5LKX A;  4F52 B;  1WEW A;  2ECV A;  4AYC B;  2F6N A;  4A4C A;  4UP0 A;  2FUI A;  1VD4 A;  3LJU X;  5G04 B;  2JMJ A;  3LVQ E;  4FK5 A;  2PUY A;  4CCG X;  1X4I A;  3ZNI A;  5D1L B;  5TDW A;  3EB5 A;  4R8P K;  3LVR E;  4I7D A;  5B8D A;  5FB1 A;  2YHN A;  3N9Q A;  1HYI A;  5I3L A;  2JM3 A;  2MNZ A;  4Z0R A;  2G45 A;  3LQI A;  2JRJ A;  4AUQ B;  3LQJ A;  2VJE A;  4FJC A;  4V3K C;  5JG6 A;  1CHC A;  2KRE A;  3LRQ A;  4AYC A;  1VFY A;  5FER A;  1Z6U A;  2KWK A;  4L7X A;  5H1U A;  3RPG B;  3V43 A;  1K2F A;  4LKA A;  3RTR B;  2EXU A;  4N4F A;  2MD7 B;  2KKY A;  3HTK C;  3O35 A;  4ZUX U;  4L58 A;  2ECW A;  4WZ2 A;  2D8S A;  1G25 A;  2XEU A;  2KU3 A;  4GNE A;  2YHO A;  4N3W A;  4O64 A;  2M6M A;  3N9O A;  3HCS A;  3ZPV 1;  4WZ0 A;  2M1R A;  4H9D A;  2YT5 A;  5DKA A;  5FEY A;  1WEV A;  3DWD A;  4WZ3 B;  3SUB A;  3PLW A;  4MSX A;  4P5O B;  5C13 A;  1WGM A;  3U5O A;  2LQ6 A;  4OGC A;  1WEP A;  3E2D A;  3DDT A;  2LXH C;  2IDA A;  4Z0O A;  4F1P A;  5LKZ A;  4PTB A;  3N9P A;  1WEM A;  2KGG A;  4TKP B;  4YBS A;  5B75 A;  4V3L C;  4AVX A;  2OWA A;  2FSA A;  2YRE A;  3MHH A;  2KGI A;  3PUQ A;  1IYM A;  2ECG A;  3KV6 A;  2D8U A;  2LXP C;  1JM7 A;  2LDR A;  2H0D B;  2KR4 A;  2KYU A;  1BOR A;  2I50 A;  3SHB A;  2JMI A;  2F42 A;  3DPL R;  2YSJ A;  4B7Y C;  5B76 A;  1WEO A;  1Z2Q A;  3EB6 A;  4BHW A;  3GL6 A;  3KQI A;  2KWJ A;  5LKT A;  4GB0 A;  4GNG A;  5C11 A;  2F6J A;  4IC2 A;  5DIN A;  2JMD A;  3C6W A;  3SOU A;  2MT5 A;  1WFK A;  2MD8 C;  4I7C A;  2YW8 A;  2C2V S;  4A49 A;  2H0D A;  1T1H A;  3HCT A;  3M7K A;  2YU4 A;  1HYJ A;  3ZVY A;  4AP4 A;  3FJU B;  3ZVZ B;  2JUN A;  4Q6F A;  3N9N A;  5SVI A;  2L5U A;  2PNX A;  4IC3 A;  5B77 A;  5TDR A;  2KWO A;  2E61 A;  2E6S A;  2LAU A;  2VNF A;  3L11 A;  2K1J A;  4X3G A;  3C5K A;  4I7B A;  4LLB A;  3MDB C;  2RR4 A;  2DJA A;  3KNV A;  5AIU A;  2FD4 A;  3FM8 C;  2VPB A;  1ZBD B;  2ECI A;  2FFW A;  4O62 A;  3FEH A;  5H1V A;  2LGL A;  2XOZ A;  2RI7 A;  5LKU A;  2Y43 A;  4S3O C;  4LJN A;  5SVX A;  4LAD B;  2YVR A;  3ZPV E;  2XP0 A;  3T9K A;  3HCU A;  2VJF A;  4WA6 A;  2CRR A;  3MHS A;  1X4J A;  3ZYQ A;  4YAD A;  1LDJ B;  5SVY A;  3KDE C;  2CKL B;  2XOC A;  1WES A;  2G6Q A;  3O70 A;  2Y1N A;  1JM7 B;  2YQM A;  2QJ0 A;  5K3Q A;  2QIC A;  2YQL A;  2BAY A;  2DSM A;  1U6G B;  3QZV A;  2ECJ A;  2M13 A;  3U5N A;  5LCW B;  3U5M A;  2VPE A;  4BBQ A;  4YBT A;  4A0C D;  3O7A A;  2CKL A;  2YUC A;  3Q1D A;  2VPG A;  4GND A;  3FAN A;  3ASL A;  3VK6 A;  3L1Z B;  1RMD A;  4C9Z A;  2KIZ A;  1F62 A;  1N87 A;  4UI9 B;  1WE9 A;  2EA6 A;  3GV4 A;  5D1K B;  3T6R A;  4PPE A;  2DX8 A;  1MBM A;  2KFT A;  1WEE A;  2MA6 A;  2EGP A;  3DQV R;  5SVI B;  4ZDT A;  1FP0 A;  2KWN A;  4OGE A;  4R2Y A;  4S3O B;  4XI1 A;  2B0O E;  3JUE A;  2AN6 A;  2VPD A;  2L80 A;  1WIL A;  5KH3 A;  5H1T A;  1FBV A;  3M63 A;  4CA1 A;  1DVP A;  2QIZ A;  3T7L A;  2C2L A;  2ECT A;  4QF2 A;  2L0B A;  4YAX A;  2KE1 A;  3FL2 A;  2VJF B;  2E6R A;  3O36 A;  4QF3 A;  2NAA A;  2MIQ A;  1WEU A;  1WIM A;  3NG2 A;  2G43 A;  2CSV A;  2HYE D;  4YAT A;  2Y1M A;  5EYA F;  2M85 A;  5AIT A;  5TBN A;  3M62 A;  3L1X A;  2EOD A;  2OXQ C;  4YBM A;  3N9M A;  3LQH A;  1LDK C;  2L43 A;  5KH7 A;  4MVT A;  4R7E A;  1DCQ A;  1V87 A;  5B78 A;  2EGM A;  1E4U A;  2CON A;  3O47 A;  2YSM A;  1Z60 A;  1JOC A;  2LN0 A;  4UP5 A;  3PUR A;  3SOX A;  3O37 A;  5G05 B;  4FIP A;  4YAB A;  2L75 A;  5FB0 A;  4A4B A;  2L7P A;  4FO9 A;  4LK9 A;  5D1M B;  2K16 A;  2RSD A;  4QQ4 A;  2CSY A;  2LGV A;  3O33 A;  2K17 A;  3M99 A;  1MM3 A;  4YC9 A;  2XOY A;  2VP7 A;  2P57 A;  2LV9 A;  1XWH A;  1WEN A;  3SOW A;  3H7H A;  2MKE A;  5J3X A;  5TRB A;  3PHD A;  2MA5 A;  5KH9 A;  3I2D A;  2XB1 A;  2M3H A;  2HDP A;  3FAO A;  2CSZ A;  2MUM A;  4B86 C; 
#chains in the Genus database with same CATH homology
 2CT2 A;  2K4D A;  2UZG A;  2FUU A;  3RPG C;  2ZET C;  2YUR A;  3ZTG A;  5TAB A;  4NN2 A;  4GNF A;  2YYR A;  2LGG A;  3IHP A;  3N9L A;  2LGK A;  2LRI C;  5G0F A;  5B79 A;  1WEQ A;  3KV5 A;  1VYX A;  1X4U A;  2MNY A;  3O34 A;  4ZQL A;  5H9M A;  2ECN A;  3U5P A;  4W4U A;  1MM2 A;  2VJE B;  5LKX A;  4F52 B;  1WEW A;  2ECV A;  4AYC B;  2F6N A;  4A4C A;  4UP0 A;  2FUI A;  1VD4 A;  5G04 B;  2JMJ A;  4FK5 A;  2PUY A;  4CCG X;  1X4I A;  3ZNI A;  5D1L B;  5TDW A;  3EB5 A;  4R8P K;  4I7D A;  5B8D A;  5FB1 A;  2YHN A;  3N9Q A;  1HYI A;  5I3L A;  2MNZ A;  2G45 A;  3LQI A;  2JRJ A;  4AUQ B;  3LQJ A;  2VJE A;  4FJC A;  4V3K C;  5JG6 A;  1CHC A;  2KRE A;  3LRQ A;  4AYC A;  1VFY A;  5FER A;  1Z6U A;  2KWK A;  4L7X A;  5H1U A;  3RPG B;  3V43 A;  1K2F A;  4LKA A;  3RTR B;  4N4F A;  2MD7 B;  3HTK C;  3O35 A;  4ZUX U;  4L58 A;  2ECW A;  4WZ2 A;  2D8S A;  1G25 A;  2XEU A;  2KU3 A;  4GNE A;  2YHO A;  4N3W A;  4O64 A;  2M6M A;  3N9O A;  3HCS A;  3ZPV 1;  4WZ0 A;  2M1R A;  2YT5 A;  5DKA A;  5FEY A;  1WEV A;  4WZ3 B;  4MSX A;  4P5O B;  5C13 A;  1WGM A;  3U5O A;  2LQ6 A;  1WEP A;  2LXH C;  2IDA A;  5LKZ A;  4PTB A;  3N9P A;  1WEM A;  2KGG A;  4TKP B;  4YBS A;  5B75 A;  4V3L C;  4AVX A;  2FSA A;  2YRE A;  3MHH A;  2KGI A;  3PUQ A;  1IYM A;  2ECG A;  3KV6 A;  2LXP C;  1JM7 A;  2LDR A;  2H0D B;  2KR4 A;  2KYU A;  1BOR A;  2I50 A;  3SHB A;  2JMI A;  2F42 A;  3DPL R;  2YSJ A;  4B7Y C;  5B76 A;  1WEO A;  1Z2Q A;  3EB6 A;  4BHW A;  3GL6 A;  3KQI A;  2KWJ A;  5LKT A;  4GB0 A;  4GNG A;  5C11 A;  2F6J A;  4IC2 A;  5DIN A;  2JMD A;  3C6W A;  3SOU A;  2MT5 A;  1WFK A;  2MD8 C;  4I7C A;  2YW8 A;  2C2V S;  4A49 A;  2H0D A;  1T1H A;  3HCT A;  2YU4 A;  1HYJ A;  3ZVY A;  4AP4 A;  3ZVZ B;  4Q6F A;  3N9N A;  2L5U A;  2PNX A;  4IC3 A;  5B77 A;  5TDR A;  2KWO A;  2E6S A;  2VNF A;  3L11 A;  2K1J A;  4X3G A;  3C5K A;  4I7B A;  4LLB A;  3KNV A;  5AIU A;  2VPB A;  1ZBD B;  2ECI A;  5H1V A;  2LGL A;  2RI7 A;  5LKU A;  2Y43 A;  4S3O C;  4LJN A;  4LAD B;  3ZPV E;  3HCU A;  2VJF A;  4WA6 A;  3MHS A;  1X4J A;  3ZYQ A;  4YAD A;  1LDJ B;  2CKL B;  1WES A;  2G6Q A;  3O70 A;  2Y1N A;  1JM7 B;  2YQM A;  2QJ0 A;  2QIC A;  2YQL A;  2BAY A;  1U6G B;  3QZV A;  2ECJ A;  3U5N A;  5LCW B;  3U5M A;  2VPE A;  4BBQ A;  4YBT A;  4A0C D;  3O7A A;  2CKL A;  2YUC A;  2VPG A;  4GND A;  3ASL A;  3VK6 A;  3L1Z B;  1RMD A;  4C9Z A;  2KIZ A;  1F62 A;  1N87 A;  4UI9 B;  1WE9 A;  2EA6 A;  3GV4 A;  5D1K B;  3T6R A;  4PPE A;  2DX8 A;  2KFT A;  2MA6 A;  1WEE A;  2EGP A;  3DQV R;  4ZDT A;  1FP0 A;  2KWN A;  4R2Y A;  4S3O B;  4XI1 A;  2AN6 A;  2VPD A;  2L80 A;  1WIL A;  5KH3 A;  5H1T A;  1FBV A;  3M63 A;  4CA1 A;  1DVP A;  2QIZ A;  3T7L A;  2C2L A;  2ECT A;  4QF2 A;  2L0B A;  4YAX A;  2KE1 A;  3FL2 A;  2VJF B;  2E6R A;  3O36 A;  4QF3 A;  2MIQ A;  1WEU A;  1WIM A;  2G43 A;  2HYE D;  2NAA A;  3NG2 A;  4YAT A;  2Y1M A;  5EYA F;  2M85 A;  5AIT A;  5TBN A;  3M62 A;  3L1X A;  2EOD A;  2OXQ C;  4YBM A;  3N9M A;  3LQH A;  1LDK C;  2L43 A;  5KH7 A;  4MVT A;  4R7E A;  1V87 A;  5B78 A;  1E4U A;  2YSM A;  1Z60 A;  1JOC A;  2LN0 A;  4UP5 A;  3PUR A;  3SOX A;  3O37 A;  5G05 B;  4FIP A;  4YAB A;  2L75 A;  5FB0 A;  4A4B A;  4FO9 A;  4LK9 A;  5D1M B;  2K16 A;  2RSD A;  2CSY A;  2LGV A;  3O33 A;  2K17 A;  3M99 A;  1MM3 A;  4YC9 A;  2VP7 A;  2LV9 A;  1XWH A;  1WEN A;  3SOW A;  5J3X A;  5TRB A;  3PHD A;  2MA5 A;  5KH9 A;  3I2D A;  2XB1 A;  2M3H A;  2HDP A;  2CSZ A;  2MUM A;  4B86 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...