2IDAA

Solution nmr structure of protein rpa1320 from rhodopseudomonas palustris. northeast structural genomics consortium target rpt3; ontario center for structural proteomics target rp1313.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
MTMGCRHVAGIRTVTPSALGCEECLKIGSPWVHLRICRTCGHVGCCDDSPHKHATRHFHATGHPIIEGYDPPEGWGWCYVDEVMFDLSDRMTPHNGPIPRYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Solution structure of RPA1320
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 24
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2idaA01
3SOUA 4L58A 1RMDA 2MA6A 2MA5A 3MHSA 1DVPA 3KV5A 3MHHA 1N87A 2FUIA 2L0BA 1E4UA 5B75A 2I50A 5FEYA 5H1VA 2QICA 4BHWA 1WEVA 4LADB 5FB0A 4I7CA 3L11A 3GL6A 3ZNIA 3QZVA 2KR4A 1MM3A 1Z6UA 3O35A 3EB5A 1WESA 4AYCB 4LKAA 5DKAA 2YSMA 2CSYA 4MVTA 2KE1A 2LGKA 4UI9B 4PTBA 2KWOA 5FB1A 3FL2A 3O37A 4YADA 3ZVZB 2RSDA 3DQVR 2VJEA 2AN6A 3SOWA 2JMJA 2JMIA 4B86C 2MD8C 2CT2A 3KQIA 2L43A 2RI7A 2EGPA 2MNYA 2Y43A 3T7LA 4PPEA 2YYRA 4N4FA 4Q6FA 3U5NA 2G45A 1MM2A 1IYMA 5TBNA 2FUUA 3HTKC 5AITA 1WEQA 3N9OA 3ZYQA 4QF2A 1WE9A 2LN0A 3VK6A 4B7YC 4A49A 2VPEA 1JM7B 4R7EA 3N9NA 3U5PA 2PNXA 1F62A 1FP0A 4W4UA 5H1UA 2ECGA 2E6RA 2M3HA 5KH3A 3SOXA 5J3XA 3PURA 2KU3A 3PUQA 3M62A 2H0DA 2YHNA 4NN2A 2G43A 3C6WA 2XB1A 2YURA 2YQLA 4GNDA 2KREA 4FK5A 5TDWA 3DPLR 3N9LA 1VYXA 4UP0A 4YBSA 2LXPC 3RPGC 2K4DA 2YHOA 4O64A 2L75A 1K2FA 2KGGA 4XI1A 1Z2QA 2IDAA 4FJCA 4ZDTA 2VJFB 4QF3A 4AVXA 4A4BA 2VPGA 4YC9A 3V43A 4L7XA 3GV4A 2CKLB 1G25A 4UP5A 4ZUXU 2D8SA 2OXQC 3U5OA 2Y1MA 4AYCA 3KNVA 3ZPV1 2KFTA 2DX8A 4A0CD 1T1HA 2E6SA 4BBQA 4P5OB 2XEUA 5C11A 5D1KB 2NAAA 4YBMA 4YBTA 1HYJA 4ZQLA 4S3OC 4GNFA 5H9MA 2C2LA 4LJNA 1BORA 1WEOA 3ASLA 2HDPA 5TRBA 2M85A 4TKPB 4FIPA 5LKZA 2LDRA 4CCGX 4AUQB 2ECVA 5DINA 4IC2A 2MIQA 1WEWA 2MD7B 2VJEB 2PUYA 4CA1A 3SHBA 1WEMA 2ECJA 5JG6A 3N9QA 1WEEA 5KH9A 5I3LA 1WGMA 4WZ0A 5D1LB 1X4JA 2LGLA 2M1RA 3C5KA 4N3WA 2LRIC 1XWHA 2ZETC 5LKUA 4WA6A 2YT5A 5EYAF 3RPGB 1FBVA 2K17A 4YATA 2L80A 2KWKA 2ECIA 3ZTGA 2FSAA 3LRQA 2MUMA 2CSZA 3LQHA 1WFKA 4AP4A 3O70A 1WIMA 2M6MA 4GB0A 1WENA 2QJ0A 2EODA 2YUCA 4WZ3B 5D1MB 2QIZA 1X4UA 2F6JA 4F52B 2VPDA 5G04B 3HCTA 4V3LC 3NG2A 2KGIA 2YSJA 2H0DB 3ZVYA 1X4IA 2ECTA 3M99A 3M63A 3LQJA 2LGGA 4I7BA 4R2YA 4FO9A 3O33A 2K16A 4C9ZA 2LV9A 5LKXA 3N9MA 1VFYA 3I2DA 5G05B 4MSXA 5C13A 3IHPA 5B76A 4I7DA 3HCSA 2KWNA 3ZPVE 2KWJA 2G6QA 4YABA 5TABA 2F6NA 1LDJB 1LDKC 3LQIA 2VNFA 2K1JA 1WEUA 2JMDA 4GNGA 2KYUA 4LK9A 5B78A 5B79A 4IC3A 2F42A 2EA6A 2LXHC 5H1TA 2Y1NA 3EB6A 4V3KC 2YREA 2UZGA 4X3GA 2ECNA 1JOCA 2MNZA 3PHDA 3KV6A 1JM7A 3O7AA 1WILA 2ECWA 5KH7A 5TDRA 1WEPA 5AIUA 3N9PA 2BAYA 4WZ2A 2MT5A 5LCWB 3O36A 5B8DA 4YAXA 5G0FA 3HCUA 3O34A 4R8PK 2YQMA 3L1XA 4LLBA 2YW8A 2LQ6A 2HYED 2JRJA 3T6RA 1Z60A 5FERA 2L5UA 5LKTA 2VPBA 3U5MA 2LGVA 1VD4A 1CHCA 1HYIA 4A4CA 3RTRB 2KIZA 2VP7A 2VJFA 1V87A 2C2VS 3L1ZB 4GNEA 2CKLA 5B77A 1ZBDB 1U6GB 2YU4A 4S3OB
chains in the Genus database with same CATH superfamily
3SOUA 4L58A 1RMDA 2MA6A 2MA5A 3MHSA 1DVPA 3KV5A 3MHHA 1N87A 2FUIA 2L0BA 1E4UA 4O62A 5B75A 2I50A 5FEYA 3FJUB 5H1VA 2QICA 4BHWA 1WEVA 4LADB 3DWDA 1MBMA 5K3QA 5FB0A 2EGMA 4I7CA 3L11A 3GL6A 2IQJA 3ZNIA 3QZVA 2KR4A 1MM3A 1Z6UA 3O35A 3EB5A 1WESA 4AYCB 4LKAA 5DKAA 2YSMA 2CSYA 4MVTA 2KE1A 2LGKA 4UI9B 4PTBA 2KWOA 5FB1A 2E61A 3FL2A 3O37A 4YADA 3ZVZB 2RSDA 3DQVR 2VJEA 2AN6A 3SOWA 2JMJA 3SUBA 2JMIA 3Q1DA 4B86C 2MD8C 2CT2A 3KQIA 2L43A 2RI7A 2EGPA 2JUNA 2MNYA 2Y43A 3T7LA 3LJUX 4PPEA 2YYRA 4N4FA 4Q6FA 3U5NA 2G45A 1MM2A 1IYMA 5TBNA 2FUUA 3HTKC 5AITA 1WEQA 2XOYA 3N9OA 3ZYQA 4QF2A 1WE9A 2LN0A 3VK6A 4B7YC 4A49A 2VPEA 1JM7B 2DSMA 4R7EA 3N9NA 3U5PA 2PNXA 2JM3A 5SVIB 1F62A 1FP0A 4W4UA 5H1UA 2ECGA 2E6RA 2M3HA 5KH3A 3SOXA 5J3XA 3PURA 2KU3A 3PUQA 3M62A 2H0DA 2YHNA 4NN2A 2G43A 3C6WA 2XB1A 2M13A 2YURA 2L7PA 2YQLA 4GNDA 2KREA 2MKEA 4FK5A 5TDWA 3DPLR 3LVRE 3N9LA 1VYXA 4UP0A 4YBSA 2LXPC 3RPGC 2K4DA 2YHOA 4O64A 2L75A 1K2FA 2KGGA 4XI1A 3M7KA 1Z2QA 2IDAA 4FJCA 4ZDTA 2VJFB 4QF3A 4AVXA 4A4BA 2VPGA 3E2DA 4YC9A 3V43A 4L7XA 3GV4A 2CKLB 1G25A 4UP5A 4ZUXU 2D8SA 3DDTA 2OXQC 3U5OA 2EXUA 2Y1MA 4AYCA 3KNVA 3ZPV1 2KFTA 2D8UA 2DX8A 4A0CD 1T1HA 2E6SA 4BBQA 4P5OB 2XEUA 5C11A 5D1KB 2NAAA 4YBMA 4YBTA 1HYJA 4ZQLA 4S3OC 4GNFA 5H9MA 2C2LA 4LJNA 1BORA 1WEOA 2B0OE 3ASLA 2HDPA 5TRBA 2M85A 4TKPB 4FIPA 5LKZA 2LDRA 4CCGX 4AUQB 3FAOA 2ECVA 5DINA 4IC2A 2MIQA 1WEWA 2MD7B 2VJEB 2P57A 2PUYA 4CA1A 3SHBA 1WEMA 2ECJA 5JG6A 2CONA 3N9QA 1WEEA 5KH9A 5I3LA 2KKYA 1WGMA 4WZ0A 5D1LB 1X4JA 2LGLA 2M1RA 2OWAA 3C5KA 4N3WA 3JUEA 2LRIC 1XWHA 2ZETC 5LKUA 4WA6A 2YT5A 5EYAF 3PLWA 3RPGB 1FBVA 2K17A 4YATA 2KKXA 2L80A 2KWKA 3O47A 2ECIA 3ZTGA 2FSAA 3KDEC 3LRQA 2MUMA 2CSZA 3LQHA 1WFKA 4AP4A 3O70A 1WIMA 2M6MA 4GB0A 1WENA 2QJ0A 2EODA 2YUCA 4WZ3B 5D1MB 2QIZA 1X4UA 2F6JA 4F52B 3LVQE 2VPDA 5G04B 3HCTA 4V3LC 3NG2A 2KGIA 2YSJA 2H0DB 3ZVYA 2FFWA 1X4IA 2ECTA 3M99A 3M63A 3LQJA 2LGGA 2FD4A 4I7BA 4OGCA 4R2YA 4FO9A 3O33A 2K16A 4C9ZA 2LV9A 5LKXA 3N9MA 1VFYA 3I2DA 5G05B 4MSXA 5C13A 3IHPA 5B76A 4I7DA 3HCSA 5SVYA 2KWNA 2XOZA 3H7HA 5SVXA 3ZPVE 2KWJA 2G6QA 4YABA 5TABA 2F6NA 1LDJB 2XP0A 1LDKC 3LQIA 2VNFA 2K1JA 1WEUA 2JMDA 4GNGA 2RR4A 2KYUA 4LK9A 4QQ4A 5B78A 5B79A 4IC3A 2F42A 2EA6A 2LXHC 4Z0RA 5H1TA 2Y1NA 3EB6A 4V3KC 2YREA 1DCQA 2UZGA 3MDBC 4X3GA 2ECNA 1JOCA 2MNZA 3PHDA 3KV6A 3FEHA 1JM7A 3O7AA 1WILA 2ECWA 5KH7A 3T9KA 4F1PA 5TDRA 1WEPA 2CSVA 2LAUA 5AIUA 4OGEA 3N9PA 2BAYA 5SVIA 4WZ2A 2MT5A 5LCWB 3O36A 5B8DA 4YAXA 5G0FA 3HCUA 3O34A 4R8PK 2YQMA 3FM8C 3L1XA 3LDYA 4LLBA 2CRRA 2YW8A 3FANA 2LQ6A 2HYED 2JRJA 3T6RA 2XOCA 1Z60A 5FERA 2L5UA 5LKTA 2VPBA 2YVRA 3U5MA 2LGVA 1VD4A 1CHCA 1HYIA 4A4CA 3RTRB 2KIZA 2VP7A 2CRWA 2VJFA 1V87A 2C2VS 3L1ZB 4GNEA 2DJAA 4Z0OA 2CKLA 5B77A 1ZBDB 4H9DA 1U6GB 2YU4A 4S3OB
chains in the Genus database with same CATH topology
3SOUA 4L58A 1RMDA 2MA6A 2MA5A 3MHSA 1DVPA 3KV5A 3MHHA 1N87A 2FUIA 2L0BA 1E4UA 5B75A 2I50A 5FEYA 5H1VA 2QICA 4BHWA 1WEVA 4LADB 5FB0A 4I7CA 3L11A 3GL6A 3ZNIA 3QZVA 2KR4A 1MM3A 1Z6UA 3O35A 3EB5A 1WESA 4AYCB 4LKAA 5DKAA 2YSMA 2CSYA 4MVTA 2KE1A 2LGKA 4UI9B 4PTBA 2KWOA 5FB1A 3FL2A 3O37A 4YADA 3ZVZB 2RSDA 3DQVR 2VJEA 2AN6A 3SOWA 2JMJA 2JMIA 4B86C 2MD8C 2CT2A 3KQIA 2L43A 2RI7A 2EGPA 2MNYA 2Y43A 3T7LA 4PPEA 2YYRA 4N4FA 4Q6FA 3U5NA 2G45A 1MM2A 1IYMA 5TBNA 2FUUA 3HTKC 5AITA 1WEQA 3N9OA 3ZYQA 4QF2A 1WE9A 2LN0A 3VK6A 4B7YC 4A49A 2VPEA 1JM7B 4R7EA 3N9NA 3U5PA 2PNXA 1F62A 1FP0A 4W4UA 5H1UA 2ECGA 2E6RA 2M3HA 5KH3A 3SOXA 5J3XA 3PURA 2KU3A 3PUQA 3M62A 2H0DA 2YHNA 4NN2A 2G43A 3C6WA 2XB1A 2YURA 2YQLA 4GNDA 2KREA 4FK5A 5TDWA 3DPLR 3N9LA 1VYXA 4UP0A 4YBSA 2LXPC 3RPGC 2K4DA 2YHOA 4O64A 2L75A 1K2FA 2KGGA 4XI1A 1Z2QA 2IDAA 4FJCA 4ZDTA 2VJFB 4QF3A 4AVXA 4A4BA 2VPGA 4YC9A 3V43A 4L7XA 3GV4A 2CKLB 1G25A 4UP5A 4ZUXU 2D8SA 2OXQC 3U5OA 2Y1MA 4AYCA 3KNVA 3ZPV1 2KFTA 2DX8A 4A0CD 1T1HA 2E6SA 4BBQA 4P5OB 2XEUA 5C11A 5D1KB 2NAAA 4YBMA 4YBTA 1HYJA 4ZQLA 4S3OC 4GNFA 5H9MA 2C2LA 4LJNA 1BORA 1WEOA 3ASLA 2HDPA 5TRBA 2M85A 4TKPB 4FIPA 5LKZA 2LDRA 4CCGX 4AUQB 2ECVA 5DINA 4IC2A 2MIQA 1WEWA 2MD7B 2VJEB 2PUYA 4CA1A 3SHBA 1WEMA 2ECJA 5JG6A 3N9QA 1WEEA 5KH9A 5I3LA 1WGMA 4WZ0A 5D1LB 1X4JA 2LGLA 2M1RA 3C5KA 4N3WA 2LRIC 1XWHA 2ZETC 5LKUA 4WA6A 2YT5A 5EYAF 3RPGB 1FBVA 2K17A 4YATA 2L80A 2KWKA 2ECIA 3ZTGA 2FSAA 3LRQA 2MUMA 2CSZA 3LQHA 1WFKA 4AP4A 3O70A 1WIMA 2M6MA 4GB0A 1WENA 2QJ0A 2EODA 2YUCA 4WZ3B 5D1MB 2QIZA 1X4UA 2F6JA 4F52B 2VPDA 5G04B 3HCTA 4V3LC 3NG2A 2KGIA 2YSJA 2H0DB 3ZVYA 1X4IA 2ECTA 3M99A 3M63A 3LQJA 2LGGA 4I7BA 4R2YA 4FO9A 3O33A 2K16A 4C9ZA 2LV9A 5LKXA 3N9MA 1VFYA 3I2DA 5G05B 4MSXA 5C13A 3IHPA 5B76A 4I7DA 3HCSA 2KWNA 3ZPVE 2KWJA 2G6QA 4YABA 5TABA 2F6NA 1LDJB 1LDKC 3LQIA 2VNFA 2K1JA 1WEUA 2JMDA 4GNGA 2KYUA 4LK9A 5B78A 5B79A 4IC3A 2F42A 2EA6A 2LXHC 5H1TA 2Y1NA 3EB6A 4V3KC 2YREA 2UZGA 4X3GA 2ECNA 1JOCA 2MNZA 3PHDA 3KV6A 1JM7A 3O7AA 1WILA 2ECWA 5KH7A 5TDRA 1WEPA 5AIUA 3N9PA 2BAYA 4WZ2A 2MT5A 5LCWB 3O36A 5B8DA 4YAXA 5G0FA 3HCUA 3O34A 4R8PK 2YQMA 3L1XA 4LLBA 2YW8A 2LQ6A 2HYED 2JRJA 3T6RA 1Z60A 5FERA 2L5UA 5LKTA 2VPBA 3U5MA 2LGVA 1VD4A 1CHCA 1HYIA 4A4CA 3RTRB 2KIZA 2VP7A 2VJFA 1V87A 2C2VS 3L1ZB 4GNEA 2CKLA 5B77A 1ZBDB 1U6GB 2YU4A 4S3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOU A;  4L58 A;  1RMD A;  2MA6 A;  2MA5 A;  3MHS A;  1DVP A;  3KV5 A;  3MHH A;  1N87 A;  2FUI A;  2L0B A;  1E4U A;  5B75 A;  2I50 A;  5FEY A;  5H1V A;  2QIC A;  4BHW A;  1WEV A;  4LAD B;  5FB0 A;  4I7C A;  3L11 A;  3GL6 A;  3ZNI A;  3QZV A;  2KR4 A;  1MM3 A;  1Z6U A;  3O35 A;  3EB5 A;  1WES A;  4AYC B;  4LKA A;  5DKA A;  2YSM A;  2CSY A;  4MVT A;  2KE1 A;  2LGK A;  4UI9 B;  4PTB A;  2KWO A;  5FB1 A;  3FL2 A;  3O37 A;  4YAD A;  3ZVZ B;  2RSD A;  3DQV R;  2VJE A;  2AN6 A;  3SOW A;  2JMJ A;  2JMI A;  4B86 C;  2MD8 C;  2CT2 A;  3KQI A;  2L43 A;  2RI7 A;  2EGP A;  2MNY A;  2Y43 A;  3T7L A;  4PPE A;  2YYR A;  4N4F A;  4Q6F A;  3U5N A;  2G45 A;  1MM2 A;  1IYM A;  5TBN A;  2FUU A;  3HTK C;  5AIT A;  1WEQ A;  3N9O A;  3ZYQ A;  4QF2 A;  1WE9 A;  2LN0 A;  3VK6 A;  4B7Y C;  4A49 A;  2VPE A;  1JM7 B;  4R7E A;  3N9N A;  3U5P A;  2PNX A;  1F62 A;  1FP0 A;  4W4U A;  5H1U A;  2ECG A;  2E6R A;  2M3H A;  5KH3 A;  3SOX A;  5J3X A;  3PUR A;  2KU3 A;  3PUQ A;  3M62 A;  2H0D A;  2YHN A;  4NN2 A;  2G43 A;  3C6W A;  2XB1 A;  2YUR A;  2YQL A;  4GND A;  2KRE A;  4FK5 A;  5TDW A;  3DPL R;  3N9L A;  1VYX A;  4UP0 A;  4YBS A;  2LXP C;  3RPG C;  2K4D A;  2YHO A;  4O64 A;  2L75 A;  1K2F A;  2KGG A;  4XI1 A;  1Z2Q A;  2IDA A;  4FJC A;  4ZDT A;  2VJF B;  4QF3 A;  4AVX A;  4A4B A;  2VPG A;  4YC9 A;  3V43 A;  4L7X A;  3GV4 A;  2CKL B;  1G25 A;  4UP5 A;  4ZUX U;  2D8S A;  2OXQ C;  3U5O A;  2Y1M A;  4AYC A;  3KNV A;  3ZPV 1;  2KFT A;  2DX8 A;  4A0C D;  1T1H A;  2E6S A;  4BBQ A;  4P5O B;  2XEU A;  5C11 A;  5D1K B;  2NAA A;  4YBM A;  4YBT A;  1HYJ A;  4ZQL A;  4S3O C;  4GNF A;  5H9M A;  2C2L A;  4LJN A;  1BOR A;  1WEO A;  3ASL A;  2HDP A;  5TRB A;  2M85 A;  4TKP B;  4FIP A;  5LKZ A;  2LDR A;  4CCG X;  4AUQ B;  2ECV A;  5DIN A;  4IC2 A;  2MIQ A;  1WEW A;  2MD7 B;  2VJE B;  2PUY A;  4CA1 A;  3SHB A;  1WEM A;  2ECJ A;  5JG6 A;  3N9Q A;  1WEE A;  5KH9 A;  5I3L A;  1WGM A;  4WZ0 A;  5D1L B;  1X4J A;  2LGL A;  2M1R A;  3C5K A;  4N3W A;  2LRI C;  1XWH A;  2ZET C;  5LKU A;  4WA6 A;  2YT5 A;  5EYA F;  3RPG B;  1FBV A;  2K17 A;  4YAT A;  2L80 A;  2KWK A;  2ECI A;  3ZTG A;  2FSA A;  3LRQ A;  2MUM A;  2CSZ A;  3LQH A;  1WFK A;  4AP4 A;  3O70 A;  1WIM A;  2M6M A;  4GB0 A;  1WEN A;  2QJ0 A;  2EOD A;  2YUC A;  4WZ3 B;  5D1M B;  2QIZ A;  1X4U A;  2F6J A;  4F52 B;  2VPD A;  5G04 B;  3HCT A;  4V3L C;  3NG2 A;  2KGI A;  2YSJ A;  2H0D B;  3ZVY A;  1X4I A;  2ECT A;  3M99 A;  3M63 A;  3LQJ A;  2LGG A;  4I7B A;  4R2Y A;  4FO9 A;  3O33 A;  2K16 A;  4C9Z A;  2LV9 A;  5LKX A;  3N9M A;  1VFY A;  3I2D A;  5G05 B;  4MSX A;  5C13 A;  3IHP A;  5B76 A;  4I7D A;  3HCS A;  2KWN A;  3ZPV E;  2KWJ A;  2G6Q A;  4YAB A;  5TAB A;  2F6N A;  1LDJ B;  1LDK C;  3LQI A;  2VNF A;  2K1J A;  1WEU A;  2JMD A;  4GNG A;  2KYU A;  4LK9 A;  5B78 A;  5B79 A;  4IC3 A;  2F42 A;  2EA6 A;  2LXH C;  5H1T A;  2Y1N A;  3EB6 A;  4V3K C;  2YRE A;  2UZG A;  4X3G A;  2ECN A;  1JOC A;  2MNZ A;  3PHD A;  3KV6 A;  1JM7 A;  3O7A A;  1WIL A;  2ECW A;  5KH7 A;  5TDR A;  1WEP A;  5AIU A;  3N9P A;  2BAY A;  4WZ2 A;  2MT5 A;  5LCW B;  3O36 A;  5B8D A;  4YAX A;  5G0F A;  3HCU A;  3O34 A;  4R8P K;  2YQM A;  3L1X A;  4LLB A;  2YW8 A;  2LQ6 A;  2HYE D;  2JRJ A;  3T6R A;  1Z60 A;  5FER A;  2L5U A;  5LKT A;  2VPB A;  3U5M A;  2LGV A;  1VD4 A;  1CHC A;  1HYI A;  4A4C A;  3RTR B;  2KIZ A;  2VP7 A;  2VJF A;  1V87 A;  2C2V S;  3L1Z B;  4GNE A;  2CKL A;  5B77 A;  1ZBD B;  1U6G B;  2YU4 A;  4S3O B; 
#chains in the Genus database with same CATH topology
 3SOU A;  4L58 A;  1RMD A;  2MA6 A;  2MA5 A;  3MHS A;  1DVP A;  3KV5 A;  3MHH A;  1N87 A;  2FUI A;  2L0B A;  1E4U A;  4O62 A;  5B75 A;  2I50 A;  5FEY A;  3FJU B;  5H1V A;  2QIC A;  4BHW A;  1WEV A;  4LAD B;  3DWD A;  1MBM A;  5K3Q A;  5FB0 A;  2EGM A;  4I7C A;  3L11 A;  3GL6 A;  2IQJ A;  3ZNI A;  3QZV A;  2KR4 A;  1MM3 A;  1Z6U A;  3O35 A;  3EB5 A;  1WES A;  4AYC B;  4LKA A;  5DKA A;  2YSM A;  2CSY A;  4MVT A;  2KE1 A;  2LGK A;  4UI9 B;  4PTB A;  2KWO A;  5FB1 A;  2E61 A;  3FL2 A;  3O37 A;  4YAD A;  3ZVZ B;  2RSD A;  3DQV R;  2VJE A;  2AN6 A;  3SOW A;  2JMJ A;  3SUB A;  2JMI A;  3Q1D A;  4B86 C;  2MD8 C;  2CT2 A;  3KQI A;  2L43 A;  2RI7 A;  2EGP A;  2JUN A;  2MNY A;  2Y43 A;  3T7L A;  3LJU X;  4PPE A;  2YYR A;  4N4F A;  4Q6F A;  3U5N A;  2G45 A;  1MM2 A;  1IYM A;  5TBN A;  2FUU A;  3HTK C;  5AIT A;  1WEQ A;  2XOY A;  3N9O A;  3ZYQ A;  4QF2 A;  1WE9 A;  2LN0 A;  3VK6 A;  4B7Y C;  4A49 A;  2VPE A;  1JM7 B;  2DSM A;  4R7E A;  3N9N A;  3U5P A;  2PNX A;  2JM3 A;  5SVI B;  1F62 A;  1FP0 A;  4W4U A;  5H1U A;  2ECG A;  2E6R A;  2M3H A;  5KH3 A;  3SOX A;  5J3X A;  3PUR A;  2KU3 A;  3PUQ A;  3M62 A;  2H0D A;  2YHN A;  4NN2 A;  2G43 A;  3C6W A;  2XB1 A;  2M13 A;  2YUR A;  2L7P A;  2YQL A;  4GND A;  2KRE A;  2MKE A;  4FK5 A;  5TDW A;  3DPL R;  3LVR E;  3N9L A;  1VYX A;  4UP0 A;  4YBS A;  2LXP C;  3RPG C;  2K4D A;  2YHO A;  4O64 A;  2L75 A;  1K2F A;  2KGG A;  4XI1 A;  3M7K A;  1Z2Q A;  2IDA A;  4FJC A;  4ZDT A;  2VJF B;  4QF3 A;  4AVX A;  4A4B A;  2VPG A;  3E2D A;  4YC9 A;  3V43 A;  4L7X A;  3GV4 A;  2CKL B;  1G25 A;  4UP5 A;  4ZUX U;  2D8S A;  3DDT A;  2OXQ C;  3U5O A;  2EXU A;  2Y1M A;  4AYC A;  3KNV A;  3ZPV 1;  2KFT A;  2D8U A;  2DX8 A;  4A0C D;  1T1H A;  2E6S A;  4BBQ A;  4P5O B;  2XEU A;  5C11 A;  5D1K B;  2NAA A;  4YBM A;  4YBT A;  1HYJ A;  4ZQL A;  4S3O C;  4GNF A;  5H9M A;  2C2L A;  4LJN A;  1BOR A;  1WEO A;  2B0O E;  3ASL A;  2HDP A;  5TRB A;  2M85 A;  4TKP B;  4FIP A;  5LKZ A;  2LDR A;  4CCG X;  4AUQ B;  3FAO A;  2ECV A;  5DIN A;  4IC2 A;  2MIQ A;  1WEW A;  2MD7 B;  2VJE B;  2P57 A;  2PUY A;  4CA1 A;  3SHB A;  1WEM A;  2ECJ A;  5JG6 A;  2CON A;  3N9Q A;  1WEE A;  5KH9 A;  5I3L A;  2KKY A;  1WGM A;  4WZ0 A;  5D1L B;  1X4J A;  2LGL A;  2M1R A;  2OWA A;  3C5K A;  4N3W A;  3JUE A;  2LRI C;  1XWH A;  2ZET C;  5LKU A;  4WA6 A;  2YT5 A;  5EYA F;  3PLW A;  3RPG B;  1FBV A;  2K17 A;  4YAT A;  2KKX A;  2L80 A;  2KWK A;  3O47 A;  2ECI A;  3ZTG A;  2FSA A;  3KDE C;  3LRQ A;  2MUM A;  2CSZ A;  3LQH A;  1WFK A;  4AP4 A;  3O70 A;  1WIM A;  2M6M A;  4GB0 A;  1WEN A;  2QJ0 A;  2EOD A;  2YUC A;  4WZ3 B;  5D1M B;  2QIZ A;  1X4U A;  2F6J A;  4F52 B;  3LVQ E;  2VPD A;  5G04 B;  3HCT A;  4V3L C;  3NG2 A;  2KGI A;  2YSJ A;  2H0D B;  3ZVY A;  2FFW A;  1X4I A;  2ECT A;  3M99 A;  3M63 A;  3LQJ A;  2LGG A;  2FD4 A;  4I7B A;  4OGC A;  4R2Y A;  4FO9 A;  3O33 A;  2K16 A;  4C9Z A;  2LV9 A;  5LKX A;  3N9M A;  1VFY A;  3I2D A;  5G05 B;  4MSX A;  5C13 A;  3IHP A;  5B76 A;  4I7D A;  3HCS A;  5SVY A;  2KWN A;  2XOZ A;  3H7H A;  5SVX A;  3ZPV E;  2KWJ A;  2G6Q A;  4YAB A;  5TAB A;  2F6N A;  1LDJ B;  2XP0 A;  1LDK C;  3LQI A;  2VNF A;  2K1J A;  1WEU A;  2JMD A;  4GNG A;  2RR4 A;  2KYU A;  4LK9 A;  4QQ4 A;  5B78 A;  5B79 A;  4IC3 A;  2F42 A;  2EA6 A;  2LXH C;  4Z0R A;  5H1T A;  2Y1N A;  3EB6 A;  4V3K C;  2YRE A;  1DCQ A;  2UZG A;  3MDB C;  4X3G A;  2ECN A;  1JOC A;  2MNZ A;  3PHD A;  3KV6 A;  3FEH A;  1JM7 A;  3O7A A;  1WIL A;  2ECW A;  5KH7 A;  3T9K A;  4F1P A;  5TDR A;  1WEP A;  2CSV A;  2LAU A;  5AIU A;  4OGE A;  3N9P A;  2BAY A;  5SVI A;  4WZ2 A;  2MT5 A;  5LCW B;  3O36 A;  5B8D A;  4YAX A;  5G0F A;  3HCU A;  3O34 A;  4R8P K;  2YQM A;  3FM8 C;  3L1X A;  3LDY A;  4LLB A;  2CRR A;  2YW8 A;  3FAN A;  2LQ6 A;  2HYE D;  2JRJ A;  3T6R A;  2XOC A;  1Z60 A;  5FER A;  2L5U A;  5LKT A;  2VPB A;  2YVR A;  3U5M A;  2LGV A;  1VD4 A;  1CHC A;  1HYI A;  4A4C A;  3RTR B;  2KIZ A;  2VP7 A;  2CRW A;  2VJF A;  1V87 A;  2C2V S;  3L1Z B;  4GNE A;  2DJA A;  4Z0O A;  2CKL A;  5B77 A;  1ZBD B;  4H9D A;  1U6G B;  2YU4 A;  4S3O B; 
#chains in the Genus database with same CATH homology
 3SOU A;  4L58 A;  1RMD A;  2MA6 A;  2MA5 A;  3MHS A;  1DVP A;  3KV5 A;  3MHH A;  1N87 A;  2FUI A;  2L0B A;  1E4U A;  5B75 A;  2I50 A;  5FEY A;  5H1V A;  2QIC A;  4BHW A;  1WEV A;  4LAD B;  5FB0 A;  4I7C A;  3L11 A;  3GL6 A;  3ZNI A;  3QZV A;  2KR4 A;  1MM3 A;  1Z6U A;  3O35 A;  3EB5 A;  1WES A;  4AYC B;  4LKA A;  5DKA A;  2YSM A;  2CSY A;  4MVT A;  2KE1 A;  2LGK A;  4UI9 B;  4PTB A;  2KWO A;  5FB1 A;  3FL2 A;  3O37 A;  4YAD A;  3ZVZ B;  2RSD A;  3DQV R;  2VJE A;  2AN6 A;  3SOW A;  2JMJ A;  2JMI A;  4B86 C;  2MD8 C;  2CT2 A;  3KQI A;  2L43 A;  2RI7 A;  2EGP A;  2MNY A;  2Y43 A;  3T7L A;  4PPE A;  2YYR A;  4N4F A;  4Q6F A;  3U5N A;  2G45 A;  1MM2 A;  1IYM A;  5TBN A;  2FUU A;  3HTK C;  5AIT A;  1WEQ A;  3N9O A;  3ZYQ A;  4QF2 A;  1WE9 A;  2LN0 A;  3VK6 A;  4B7Y C;  4A49 A;  2VPE A;  1JM7 B;  4R7E A;  3N9N A;  3U5P A;  2PNX A;  1F62 A;  1FP0 A;  4W4U A;  5H1U A;  2ECG A;  2E6R A;  2M3H A;  5KH3 A;  3SOX A;  5J3X A;  3PUR A;  2KU3 A;  3PUQ A;  3M62 A;  2H0D A;  2YHN A;  4NN2 A;  2G43 A;  3C6W A;  2XB1 A;  2YUR A;  2YQL A;  4GND A;  2KRE A;  4FK5 A;  5TDW A;  3DPL R;  3N9L A;  1VYX A;  4UP0 A;  4YBS A;  2LXP C;  3RPG C;  2K4D A;  2YHO A;  4O64 A;  2L75 A;  1K2F A;  2KGG A;  4XI1 A;  1Z2Q A;  2IDA A;  4FJC A;  4ZDT A;  2VJF B;  4QF3 A;  4AVX A;  4A4B A;  2VPG A;  4YC9 A;  3V43 A;  4L7X A;  3GV4 A;  2CKL B;  1G25 A;  4UP5 A;  4ZUX U;  2D8S A;  2OXQ C;  3U5O A;  2Y1M A;  4AYC A;  3KNV A;  3ZPV 1;  2KFT A;  2DX8 A;  4A0C D;  1T1H A;  2E6S A;  4BBQ A;  4P5O B;  2XEU A;  5C11 A;  5D1K B;  2NAA A;  4YBM A;  4YBT A;  1HYJ A;  4ZQL A;  4S3O C;  4GNF A;  5H9M A;  2C2L A;  4LJN A;  1BOR A;  1WEO A;  3ASL A;  2HDP A;  5TRB A;  2M85 A;  4TKP B;  4FIP A;  5LKZ A;  2LDR A;  4CCG X;  4AUQ B;  2ECV A;  5DIN A;  4IC2 A;  2MIQ A;  1WEW A;  2MD7 B;  2VJE B;  2PUY A;  4CA1 A;  3SHB A;  1WEM A;  2ECJ A;  5JG6 A;  3N9Q A;  1WEE A;  5KH9 A;  5I3L A;  1WGM A;  4WZ0 A;  5D1L B;  1X4J A;  2LGL A;  2M1R A;  3C5K A;  4N3W A;  2LRI C;  1XWH A;  2ZET C;  5LKU A;  4WA6 A;  2YT5 A;  5EYA F;  3RPG B;  1FBV A;  2K17 A;  4YAT A;  2L80 A;  2KWK A;  2ECI A;  3ZTG A;  2FSA A;  3LRQ A;  2MUM A;  2CSZ A;  3LQH A;  1WFK A;  4AP4 A;  3O70 A;  1WIM A;  2M6M A;  4GB0 A;  1WEN A;  2QJ0 A;  2EOD A;  2YUC A;  4WZ3 B;  5D1M B;  2QIZ A;  1X4U A;  2F6J A;  4F52 B;  2VPD A;  5G04 B;  3HCT A;  4V3L C;  3NG2 A;  2KGI A;  2YSJ A;  2H0D B;  3ZVY A;  1X4I A;  2ECT A;  3M99 A;  3M63 A;  3LQJ A;  2LGG A;  4I7B A;  4R2Y A;  4FO9 A;  3O33 A;  2K16 A;  4C9Z A;  2LV9 A;  5LKX A;  3N9M A;  1VFY A;  3I2D A;  5G05 B;  4MSX A;  5C13 A;  3IHP A;  5B76 A;  4I7D A;  3HCS A;  2KWN A;  3ZPV E;  2KWJ A;  2G6Q A;  4YAB A;  5TAB A;  2F6N A;  1LDJ B;  1LDK C;  3LQI A;  2VNF A;  2K1J A;  1WEU A;  2JMD A;  4GNG A;  2KYU A;  4LK9 A;  5B78 A;  5B79 A;  4IC3 A;  2F42 A;  2EA6 A;  2LXH C;  5H1T A;  2Y1N A;  3EB6 A;  4V3K C;  2YRE A;  2UZG A;  4X3G A;  2ECN A;  1JOC A;  2MNZ A;  3PHD A;  3KV6 A;  1JM7 A;  3O7A A;  1WIL A;  2ECW A;  5KH7 A;  5TDR A;  1WEP A;  5AIU A;  3N9P A;  2BAY A;  4WZ2 A;  2MT5 A;  5LCW B;  3O36 A;  5B8D A;  4YAX A;  5G0F A;  3HCU A;  3O34 A;  4R8P K;  2YQM A;  3L1X A;  4LLB A;  2YW8 A;  2LQ6 A;  2HYE D;  2JRJ A;  3T6R A;  1Z60 A;  5FER A;  2L5U A;  5LKT A;  2VPB A;  3U5M A;  2LGV A;  1VD4 A;  1CHC A;  1HYI A;  4A4C A;  3RTR B;  2KIZ A;  2VP7 A;  2VJF A;  1V87 A;  2C2V S;  3L1Z B;  4GNE A;  2CKL A;  5B77 A;  1ZBD B;  1U6G B;  2YU4 A;  4S3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...