4AP4A

Rnf4 - ubch5a - ubiquitin heterotrimeric complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYIGSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Ring E3 Ligase and Ubiquitin-Loaded E2 Primed for Catalysis
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase/signalling protein
molecule keywords E3 UBIQUITIN LIGASE RNF4
total genus 30
structure length 129
sequence length 129
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ap4A00
4WA6A 5B76A 2Y1MA 1FBVA 3U5MA 4A0CD 2LRIC 4S3OC 3I2DA 4I7CA 2ZETC 4P5OB 5TBNA 4R7EA 5KH7A 3PUQA 2YREA 2M85A 2L5UA 3SOWA 5FB0A 1X4UA 4V3KC 3RPGC 4W4UA 2AN6A 2KWKA 4FJCA 3HCTA 4PPEA 4R2YA 1HYJA 4YBMA 4WZ2A 2F6JA 5AITA 4UP5A 3U5PA 2K17A 3LRQA 5H1TA 3M63A 1HYIA 2VPDA 1T1HA 5B79A 4YBTA 2CT2A 1WGMA 2ECVA 2KR4A 2PUYA 5TABA 4B86C 2L75A 4L58A 4I7BA 1BORA 2LGVA 2M6MA 2UZGA 2C2LA 5LKUA 5TDWA 1MM3A 2ECWA 5J3XA 5H1UA 1JOCA 2E6RA 2IDAA 3LQHA 2M3HA 1V87A 1VD4A 2QIZA 5C11A 4GNDA 2YSMA 3M62A 3HCUA 1X4JA 2CKLB 4B7YC 3LQJA 5C13A 1WEPA 5KH9A 3EB6A 1IYMA 2H0DB 2EGPA 4C9ZA 1WEEA 1Z2QA 1WEUA 3O33A 2KWOA 3ASLA 3ZPV1 2G45A 3VK6A 2BAYA 2ECNA 4MVTA 4NN2A 3N9LA 5DINA 5FEYA 4LLBA 2ECIA 3KNVA 2MUMA 5H9MA 3IHPA 1WIMA 3C5KA 3O34A 1CHCA 2YYRA 4BBQA 4GNFA 2L43A 4GNEA 5LCWB 4X3GA 5TRBA 2ECTA 2YSJA 2XEUA 5G0FA 2YUCA 2H0DA 4QF3A 3L11A 2KFTA 2CSZA 5B8DA 4AP4A 1VYXA 1K2FA 5LKXA 2KGGA 3DPLR 4GNGA 3ZYQA 3RPGB 2YU4A 1E4UA 2MIQA 2FUUA 2EA6A 2HDPA 3MHSA 4LADB 4AUQB 3SHBA 4AVXA 4IC3A 4UI9B 4I7DA 4S3OB 2LGGA 1WENA 1WEWA 1F62A 2FSAA 5KH3A 5LKZA 2LV9A 3KV5A 1WESA 4GB0A 2LN0A 1N87A 2F6NA 2YHOA 4MSXA 3U5NA 3RTRB 3O36A 1WFKA 2CSYA 1DVPA 2JMDA 4F52B 4ZUXU 2YQLA 2FUIA 4N3WA 4Q6FA 5D1MB 3ZVZB 2VPGA 2DX8A 4YATA 2G43A 5LKTA 1FP0A 2L0BA 4A4BA 2YW8A 2LQ6A 3V43A 1WEQA 4LJNA 2MD7B 4BHWA 3ZPVE 3T6RA 1U6GB 2EODA 3N9PA 3ZVYA 4FK5A 2KIZA 2OXQC 3KV6A 1Z60A 3T7LA 3ZTGA 2QJ0A 3NG2A 2LGLA 4FIPA 4PTBA 2KE1A 2KGIA 2YURA 2JRJA 5TDRA 5G04B 2VJFA 5EYAF 2K16A 2ECGA 2MA6A 2F42A 2QICA 2JMIA 5I3LA 2LDRA 2YT5A 1JM7A 4V3LC 2LXHC 2MA5A 3GV4A 2RSDA 3PURA 4A4CA 4LK9A 4YAXA 2MD8C 5G05B 2Y1NA 2MNYA 2D8SA 5B78A 5H1VA 2E6SA 1MM2A 3HTKC 5D1LB 2VNFA 2YHNA 3ZNIA 2NAAA 3O7AA 2KU3A 4AYCA 4AYCB 5B75A 2VJFB 1WEMA 2RI7A 3EB5A 3U5OA 2MT5A 2VPBA 4TKPB 2M1RA 2KREA 1JM7B 1Z6UA 4XI1A 2ECJA 4A49A 4ZQLA 2KYUA 3PHDA 4QF2A 5FERA 3L1ZB 3DQVR 2C2VS 3MHHA 2G6QA 2Y43A 4ZDTA 4CCGX 3N9NA 3L1XA 3LQIA 2KWNA 1ZBDB 3FL2A 2JMJA 3KQIA 1XWHA 2MNZA 2KWJA 3QZVA 2LXPC 1X4IA 4N4FA 5JG6A 2I50A 1LDKC 2CKLA 3HCSA 5D1KB 3SOUA 4YBSA 2VJEA 3O35A 3N9QA 2PNXA 4R8PK 3N9OA 4UP0A 4FO9A 4YADA 2K4DA 3O70A 2K1JA 2HYED 3GL6A 4O64A 2L80A 1G25A 5DKAA 5AIUA 4WZ0A 4L7XA 2YQMA 3SOXA 4YC9A 1VFYA 1WEOA 3M99A 1WILA 3N9MA 5FB1A 1WE9A 2LGKA 2XB1A 4CA1A 1RMDA 2VP7A 3C6WA 2VJEB 4LKAA 5B77A 4IC2A 2VPEA 4YABA 3O37A 1WEVA 4WZ3B 1LDJB
chains in the Genus database with same CATH superfamily
2XOYA 4WA6A 5B76A 2Y1MA 1FBVA 3U5MA 4A0CD 3T9KA 2LRIC 4S3OC 3I2DA 4I7CA 2ZETC 4P5OB 5TBNA 4R7EA 5KH7A 3PUQA 2YREA 2M85A 2L5UA 3SOWA 5FB0A 3FEHA 1X4UA 4V3KC 3RPGC 4W4UA 2AN6A 3KDEC 2KWKA 4FJCA 3HCTA 4PPEA 4R2YA 1HYJA 2XP0A 3LVQE 4YBMA 4WZ2A 2F6JA 5AITA 4UP5A 3U5PA 2K17A 3LRQA 5H1TA 3M63A 1HYIA 2VPDA 1T1HA 5B79A 4YBTA 2CT2A 1WGMA 2ECVA 5K3QA 2KR4A 2PUYA 5TABA 2L75A 4L58A 4B86C 4I7BA 1BORA 2LGVA 2M6MA 2UZGA 2C2LA 3LJUX 5LKUA 5TDWA 1MM3A 2ECWA 5J3XA 5H1UA 1JOCA 2E6RA 2IDAA 3LQHA 2M3HA 1V87A 1DCQA 1VD4A 2QIZA 5C11A 4GNDA 2YSMA 3M62A 3HCUA 1X4JA 2CKLB 4B7YC 3LQJA 5C13A 3DWDA 1WEPA 5KH9A 3EB6A 1IYMA 2H0DB 2EGPA 4C9ZA 2YVRA 1WEEA 4OGCA 1Z2QA 1WEUA 3O33A 3LDYA 2KWOA 3ASLA 3ZPV1 2G45A 3VK6A 2BAYA 2ECNA 4MVTA 2E61A 3N9LA 4NN2A 3FJUB 2LAUA 5DINA 5FEYA 4LLBA 2ECIA 3KNVA 2MUMA 5H9MA 3IHPA 1WIMA 3C5KA 3O34A 1CHCA 2YYRA 3DDTA 4BBQA 4GNFA 2M13A 2L43A 4GNEA 5LCWB 4X3GA 5TRBA 2ECTA 2YSJA 2XEUA 5G0FA 2YUCA 2H0DA 4QF3A 3L11A 4F1PA 2FFWA 2L7PA 2KFTA 2CSZA 5B8DA 2KKXA 4AP4A 2B0OE 1VYXA 1K2FA 5LKXA 2KGGA 3DPLR 4GNGA 3ZYQA 3RPGB 2YU4A 1E4UA 2MIQA 2FUUA 2EA6A 4Z0OA 2HDPA 3MHSA 4LADB 4AUQB 2DJAA 3SHBA 4AVXA 4IC3A 4UI9B 4I7DA 4S3OB 2LGGA 1WENA 1WEWA 1F62A 2FSAA 5KH3A 5LKZA 2LV9A 3SUBA 2D8UA 3KV5A 1WESA 4GB0A 2KKYA 2LN0A 1N87A 2F6NA 4QQ4A 2OWAA 2YHOA 4MSXA 3U5NA 3RTRB 3O36A 1WFKA 2CSYA 2P57A 1DVPA 2MKEA 2JMDA 4F52B 4ZUXU 2YQLA 2FUIA 4Q6FA 4N3WA 4O62A 5D1MB 3ZVZB 2VPGA 2DX8A 4YATA 2G43A 5LKTA 1FP0A 2L0BA 4A4BA 2YW8A 2LQ6A 3V43A 1WEQA 4LJNA 2MD7B 3FANA 4BHWA 3ZPVE 3T6RA 1U6GB 2EODA 3N9PA 3ZVYA 4FK5A 2KIZA 2OXQC 3KV6A 2IQJA 1Z60A 3T7LA 3ZTGA 2QJ0A 3NG2A 2LGLA 4FIPA 4PTBA 5SVXA 2KE1A 2KGIA 2YURA 2JRJA 3JUEA 5TDRA 5G04B 2VJFA 5EYAF 2K16A 2ECGA 2EXUA 2MA6A 2F42A 2QICA 2JMIA 2CRRA 5I3LA 2LDRA 2YT5A 1JM7A 4V3LC 2LXHC 2MA5A 3GV4A 2RSDA 3FM8C 3PURA 4A4CA 4LK9A 4Z0RA 4YAXA 4H9DA 2MD8C 3M7KA 5G05B 2Y1NA 1MBMA 2MNYA 2D8SA 5B78A 5H1VA 2E6SA 1MM2A 2JM3A 3HTKC 5D1LB 2VNFA 2YHNA 3ZNIA 2NAAA 3O7AA 2KU3A 4AYCA 4AYCB 5B75A 2VJFB 1WEMA 2JUNA 2RI7A 3EB5A 3U5OA 2MT5A 2VPBA 2M1RA 4TKPB 2KREA 1JM7B 1Z6UA 2CRWA 4XI1A 2ECJA 4A49A 4ZQLA 2KYUA 3PHDA 4QF2A 5FERA 3L1ZB 5SVIB 3DQVR 3E2DA 2C2VS 3MHHA 2G6QA 2Y43A 4OGEA 4ZDTA 4CCGX 3N9NA 3L1XA 3LQIA 2KWNA 2FD4A 1ZBDB 3O47A 3FL2A 2JMJA 2RR4A 3KQIA 1XWHA 2MNZA 2KWJA 3QZVA 2LXPC 1X4IA 5SVIA 4N4FA 5JG6A 2I50A 1LDKC 2CKLA 3HCSA 5D1KB 3SOUA 3H7HA 4YBSA 2VJEA 3O35A 3N9QA 2PNXA 4R8PK 3N9OA 4UP0A 4FO9A 4YADA 2K4DA 3O70A 2K1JA 2HYED 3GL6A 2XOCA 4O64A 2EGMA 2L80A 1G25A 5DKAA 3Q1DA 3FAOA 3LVRE 5AIUA 4WZ0A 4L7XA 2YQMA 3SOXA 4YC9A 1VFYA 2CSVA 2CONA 1WEOA 3M99A 1WILA 3N9MA 5SVYA 5FB1A 1WE9A 3MDBC 2LGKA 2XB1A 4CA1A 1RMDA 2VP7A 3C6WA 2VJEB 4LKAA 5B77A 4IC2A 3PLWA 2VPEA 4YABA 2DSMA 3O37A 1WEVA 2XOZA 4WZ3B 1LDJB
chains in the Genus database with same CATH topology
4WA6A 5B76A 2Y1MA 1FBVA 3U5MA 4A0CD 2LRIC 4S3OC 3I2DA 4I7CA 2ZETC 4P5OB 5TBNA 4R7EA 5KH7A 3PUQA 2YREA 2M85A 2L5UA 3SOWA 5FB0A 1X4UA 4V3KC 3RPGC 4W4UA 2AN6A 2KWKA 4FJCA 3HCTA 4PPEA 4R2YA 1HYJA 4YBMA 4WZ2A 2F6JA 5AITA 4UP5A 3U5PA 2K17A 3LRQA 5H1TA 3M63A 1HYIA 2VPDA 1T1HA 5B79A 4YBTA 2CT2A 1WGMA 2ECVA 2KR4A 2PUYA 5TABA 4B86C 2L75A 4L58A 4I7BA 1BORA 2LGVA 2M6MA 2UZGA 2C2LA 5LKUA 5TDWA 1MM3A 2ECWA 5J3XA 5H1UA 1JOCA 2E6RA 2IDAA 3LQHA 2M3HA 1V87A 1VD4A 2QIZA 5C11A 4GNDA 2YSMA 3M62A 3HCUA 1X4JA 2CKLB 4B7YC 3LQJA 5C13A 1WEPA 5KH9A 3EB6A 1IYMA 2H0DB 2EGPA 4C9ZA 1WEEA 1Z2QA 1WEUA 3O33A 2KWOA 3ASLA 3ZPV1 2G45A 3VK6A 2BAYA 2ECNA 4MVTA 4NN2A 3N9LA 5DINA 5FEYA 4LLBA 2ECIA 3KNVA 2MUMA 5H9MA 3IHPA 1WIMA 3C5KA 3O34A 1CHCA 2YYRA 4BBQA 4GNFA 2L43A 4GNEA 5LCWB 4X3GA 5TRBA 2ECTA 2YSJA 2XEUA 5G0FA 2YUCA 2H0DA 4QF3A 3L11A 2KFTA 2CSZA 5B8DA 4AP4A 1VYXA 1K2FA 5LKXA 2KGGA 3DPLR 4GNGA 3ZYQA 3RPGB 2YU4A 1E4UA 2MIQA 2FUUA 2EA6A 2HDPA 3MHSA 4LADB 4AUQB 3SHBA 4AVXA 4IC3A 4UI9B 4I7DA 4S3OB 2LGGA 1WENA 1WEWA 1F62A 2FSAA 5KH3A 5LKZA 2LV9A 3KV5A 1WESA 4GB0A 2LN0A 1N87A 2F6NA 2YHOA 4MSXA 3U5NA 3RTRB 3O36A 1WFKA 2CSYA 1DVPA 2JMDA 4F52B 4ZUXU 2YQLA 2FUIA 4N3WA 4Q6FA 5D1MB 3ZVZB 2VPGA 2DX8A 4YATA 2G43A 5LKTA 1FP0A 2L0BA 4A4BA 2YW8A 2LQ6A 3V43A 1WEQA 4LJNA 2MD7B 4BHWA 3ZPVE 3T6RA 1U6GB 2EODA 3N9PA 3ZVYA 4FK5A 2KIZA 2OXQC 3KV6A 1Z60A 3T7LA 3ZTGA 2QJ0A 3NG2A 2LGLA 4FIPA 4PTBA 2KE1A 2KGIA 2YURA 2JRJA 5TDRA 5G04B 2VJFA 5EYAF 2K16A 2ECGA 2MA6A 2F42A 2QICA 2JMIA 5I3LA 2LDRA 2YT5A 1JM7A 4V3LC 2LXHC 2MA5A 3GV4A 2RSDA 3PURA 4A4CA 4LK9A 4YAXA 2MD8C 5G05B 2Y1NA 2MNYA 2D8SA 5B78A 5H1VA 2E6SA 1MM2A 3HTKC 5D1LB 2VNFA 2YHNA 3ZNIA 2NAAA 3O7AA 2KU3A 4AYCA 4AYCB 5B75A 2VJFB 1WEMA 2RI7A 3EB5A 3U5OA 2MT5A 2VPBA 4TKPB 2M1RA 2KREA 1JM7B 1Z6UA 4XI1A 2ECJA 4A49A 4ZQLA 2KYUA 3PHDA 4QF2A 5FERA 3L1ZB 3DQVR 2C2VS 3MHHA 2G6QA 2Y43A 4ZDTA 4CCGX 3N9NA 3L1XA 3LQIA 2KWNA 1ZBDB 3FL2A 2JMJA 3KQIA 1XWHA 2MNZA 2KWJA 3QZVA 2LXPC 1X4IA 4N4FA 5JG6A 2I50A 1LDKC 2CKLA 3HCSA 5D1KB 3SOUA 4YBSA 2VJEA 3O35A 3N9QA 2PNXA 4R8PK 3N9OA 4UP0A 4FO9A 4YADA 2K4DA 3O70A 2K1JA 2HYED 3GL6A 4O64A 2L80A 1G25A 5DKAA 5AIUA 4WZ0A 4L7XA 2YQMA 3SOXA 4YC9A 1VFYA 1WEOA 3M99A 1WILA 3N9MA 5FB1A 1WE9A 2LGKA 2XB1A 4CA1A 1RMDA 2VP7A 3C6WA 2VJEB 4LKAA 5B77A 4IC2A 2VPEA 4YABA 3O37A 1WEVA 4WZ3B 1LDJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WA6 A;  5B76 A;  2Y1M A;  1FBV A;  3U5M A;  4A0C D;  2LRI C;  4S3O C;  3I2D A;  4I7C A;  2ZET C;  4P5O B;  5TBN A;  4R7E A;  5KH7 A;  3PUQ A;  2YRE A;  2M85 A;  2L5U A;  3SOW A;  5FB0 A;  1X4U A;  4V3K C;  3RPG C;  4W4U A;  2AN6 A;  2KWK A;  4FJC A;  3HCT A;  4PPE A;  4R2Y A;  1HYJ A;  4YBM A;  4WZ2 A;  2F6J A;  5AIT A;  4UP5 A;  3U5P A;  2K17 A;  3LRQ A;  5H1T A;  3M63 A;  1HYI A;  2VPD A;  1T1H A;  5B79 A;  4YBT A;  2CT2 A;  1WGM A;  2ECV A;  2KR4 A;  2PUY A;  5TAB A;  4B86 C;  2L75 A;  4L58 A;  4I7B A;  1BOR A;  2LGV A;  2M6M A;  2UZG A;  2C2L A;  5LKU A;  5TDW A;  1MM3 A;  2ECW A;  5J3X A;  5H1U A;  1JOC A;  2E6R A;  2IDA A;  3LQH A;  2M3H A;  1V87 A;  1VD4 A;  2QIZ A;  5C11 A;  4GND A;  2YSM A;  3M62 A;  3HCU A;  1X4J A;  2CKL B;  4B7Y C;  3LQJ A;  5C13 A;  1WEP A;  5KH9 A;  3EB6 A;  1IYM A;  2H0D B;  2EGP A;  4C9Z A;  1WEE A;  1Z2Q A;  1WEU A;  3O33 A;  2KWO A;  3ASL A;  3ZPV 1;  2G45 A;  3VK6 A;  2BAY A;  2ECN A;  4MVT A;  4NN2 A;  3N9L A;  5DIN A;  5FEY A;  4LLB A;  2ECI A;  3KNV A;  2MUM A;  5H9M A;  3IHP A;  1WIM A;  3C5K A;  3O34 A;  1CHC A;  2YYR A;  4BBQ A;  4GNF A;  2L43 A;  4GNE A;  5LCW B;  4X3G A;  5TRB A;  2ECT A;  2YSJ A;  2XEU A;  5G0F A;  2YUC A;  2H0D A;  4QF3 A;  3L11 A;  2KFT A;  2CSZ A;  5B8D A;  4AP4 A;  1VYX A;  1K2F A;  5LKX A;  2KGG A;  3DPL R;  4GNG A;  3ZYQ A;  3RPG B;  2YU4 A;  1E4U A;  2MIQ A;  2FUU A;  2EA6 A;  2HDP A;  3MHS A;  4LAD B;  4AUQ B;  3SHB A;  4AVX A;  4IC3 A;  4UI9 B;  4I7D A;  4S3O B;  2LGG A;  1WEN A;  1WEW A;  1F62 A;  2FSA A;  5KH3 A;  5LKZ A;  2LV9 A;  3KV5 A;  1WES A;  4GB0 A;  2LN0 A;  1N87 A;  2F6N A;  2YHO A;  4MSX A;  3U5N A;  3RTR B;  3O36 A;  1WFK A;  2CSY A;  1DVP A;  2JMD A;  4F52 B;  4ZUX U;  2YQL A;  2FUI A;  4N3W A;  4Q6F A;  5D1M B;  3ZVZ B;  2VPG A;  2DX8 A;  4YAT A;  2G43 A;  5LKT A;  1FP0 A;  2L0B A;  4A4B A;  2YW8 A;  2LQ6 A;  3V43 A;  1WEQ A;  4LJN A;  2MD7 B;  4BHW A;  3ZPV E;  3T6R A;  1U6G B;  2EOD A;  3N9P A;  3ZVY A;  4FK5 A;  2KIZ A;  2OXQ C;  3KV6 A;  1Z60 A;  3T7L A;  3ZTG A;  2QJ0 A;  3NG2 A;  2LGL A;  4FIP A;  4PTB A;  2KE1 A;  2KGI A;  2YUR A;  2JRJ A;  5TDR A;  5G04 B;  2VJF A;  5EYA F;  2K16 A;  2ECG A;  2MA6 A;  2F42 A;  2QIC A;  2JMI A;  5I3L A;  2LDR A;  2YT5 A;  1JM7 A;  4V3L C;  2LXH C;  2MA5 A;  3GV4 A;  2RSD A;  3PUR A;  4A4C A;  4LK9 A;  4YAX A;  2MD8 C;  5G05 B;  2Y1N A;  2MNY A;  2D8S A;  5B78 A;  5H1V A;  2E6S A;  1MM2 A;  3HTK C;  5D1L B;  2VNF A;  2YHN A;  3ZNI A;  2NAA A;  3O7A A;  2KU3 A;  4AYC A;  4AYC B;  5B75 A;  2VJF B;  1WEM A;  2RI7 A;  3EB5 A;  3U5O A;  2MT5 A;  2VPB A;  4TKP B;  2M1R A;  2KRE A;  1JM7 B;  1Z6U A;  4XI1 A;  2ECJ A;  4A49 A;  4ZQL A;  2KYU A;  3PHD A;  4QF2 A;  5FER A;  3L1Z B;  3DQV R;  2C2V S;  3MHH A;  2G6Q A;  2Y43 A;  4ZDT A;  4CCG X;  3N9N A;  3L1X A;  3LQI A;  2KWN A;  1ZBD B;  3FL2 A;  2JMJ A;  3KQI A;  1XWH A;  2MNZ A;  2KWJ A;  3QZV A;  2LXP C;  1X4I A;  4N4F A;  5JG6 A;  2I50 A;  1LDK C;  2CKL A;  3HCS A;  5D1K B;  3SOU A;  4YBS A;  2VJE A;  3O35 A;  3N9Q A;  2PNX A;  4R8P K;  3N9O A;  4UP0 A;  4FO9 A;  4YAD A;  2K4D A;  3O70 A;  2K1J A;  2HYE D;  3GL6 A;  4O64 A;  2L80 A;  1G25 A;  5DKA A;  5AIU A;  4WZ0 A;  4L7X A;  2YQM A;  3SOX A;  4YC9 A;  1VFY A;  1WEO A;  3M99 A;  1WIL A;  3N9M A;  5FB1 A;  1WE9 A;  2LGK A;  2XB1 A;  4CA1 A;  1RMD A;  2VP7 A;  3C6W A;  2VJE B;  4LKA A;  5B77 A;  4IC2 A;  2VPE A;  4YAB A;  3O37 A;  1WEV A;  4WZ3 B;  1LDJ B; 
#chains in the Genus database with same CATH topology
 2XOY A;  4WA6 A;  5B76 A;  2Y1M A;  1FBV A;  3U5M A;  4A0C D;  3T9K A;  2LRI C;  4S3O C;  3I2D A;  4I7C A;  2ZET C;  4P5O B;  5TBN A;  4R7E A;  5KH7 A;  3PUQ A;  2YRE A;  2M85 A;  2L5U A;  3SOW A;  5FB0 A;  3FEH A;  1X4U A;  4V3K C;  3RPG C;  4W4U A;  2AN6 A;  3KDE C;  2KWK A;  4FJC A;  3HCT A;  4PPE A;  4R2Y A;  1HYJ A;  2XP0 A;  3LVQ E;  4YBM A;  4WZ2 A;  2F6J A;  5AIT A;  4UP5 A;  3U5P A;  2K17 A;  3LRQ A;  5H1T A;  3M63 A;  1HYI A;  2VPD A;  1T1H A;  5B79 A;  4YBT A;  2CT2 A;  1WGM A;  2ECV A;  5K3Q A;  2KR4 A;  2PUY A;  5TAB A;  2L75 A;  4L58 A;  4B86 C;  4I7B A;  1BOR A;  2LGV A;  2M6M A;  2UZG A;  2C2L A;  3LJU X;  5LKU A;  5TDW A;  1MM3 A;  2ECW A;  5J3X A;  5H1U A;  1JOC A;  2E6R A;  2IDA A;  3LQH A;  2M3H A;  1V87 A;  1DCQ A;  1VD4 A;  2QIZ A;  5C11 A;  4GND A;  2YSM A;  3M62 A;  3HCU A;  1X4J A;  2CKL B;  4B7Y C;  3LQJ A;  5C13 A;  3DWD A;  1WEP A;  5KH9 A;  3EB6 A;  1IYM A;  2H0D B;  2EGP A;  4C9Z A;  2YVR A;  1WEE A;  4OGC A;  1Z2Q A;  1WEU A;  3O33 A;  3LDY A;  2KWO A;  3ASL A;  3ZPV 1;  2G45 A;  3VK6 A;  2BAY A;  2ECN A;  4MVT A;  2E61 A;  3N9L A;  4NN2 A;  3FJU B;  2LAU A;  5DIN A;  5FEY A;  4LLB A;  2ECI A;  3KNV A;  2MUM A;  5H9M A;  3IHP A;  1WIM A;  3C5K A;  3O34 A;  1CHC A;  2YYR A;  3DDT A;  4BBQ A;  4GNF A;  2M13 A;  2L43 A;  4GNE A;  5LCW B;  4X3G A;  5TRB A;  2ECT A;  2YSJ A;  2XEU A;  5G0F A;  2YUC A;  2H0D A;  4QF3 A;  3L11 A;  4F1P A;  2FFW A;  2L7P A;  2KFT A;  2CSZ A;  5B8D A;  2KKX A;  4AP4 A;  2B0O E;  1VYX A;  1K2F A;  5LKX A;  2KGG A;  3DPL R;  4GNG A;  3ZYQ A;  3RPG B;  2YU4 A;  1E4U A;  2MIQ A;  2FUU A;  2EA6 A;  4Z0O A;  2HDP A;  3MHS A;  4LAD B;  4AUQ B;  2DJA A;  3SHB A;  4AVX A;  4IC3 A;  4UI9 B;  4I7D A;  4S3O B;  2LGG A;  1WEN A;  1WEW A;  1F62 A;  2FSA A;  5KH3 A;  5LKZ A;  2LV9 A;  3SUB A;  2D8U A;  3KV5 A;  1WES A;  4GB0 A;  2KKY A;  2LN0 A;  1N87 A;  2F6N A;  4QQ4 A;  2OWA A;  2YHO A;  4MSX A;  3U5N A;  3RTR B;  3O36 A;  1WFK A;  2CSY A;  2P57 A;  1DVP A;  2MKE A;  2JMD A;  4F52 B;  4ZUX U;  2YQL A;  2FUI A;  4Q6F A;  4N3W A;  4O62 A;  5D1M B;  3ZVZ B;  2VPG A;  2DX8 A;  4YAT A;  2G43 A;  5LKT A;  1FP0 A;  2L0B A;  4A4B A;  2YW8 A;  2LQ6 A;  3V43 A;  1WEQ A;  4LJN A;  2MD7 B;  3FAN A;  4BHW A;  3ZPV E;  3T6R A;  1U6G B;  2EOD A;  3N9P A;  3ZVY A;  4FK5 A;  2KIZ A;  2OXQ C;  3KV6 A;  2IQJ A;  1Z60 A;  3T7L A;  3ZTG A;  2QJ0 A;  3NG2 A;  2LGL A;  4FIP A;  4PTB A;  5SVX A;  2KE1 A;  2KGI A;  2YUR A;  2JRJ A;  3JUE A;  5TDR A;  5G04 B;  2VJF A;  5EYA F;  2K16 A;  2ECG A;  2EXU A;  2MA6 A;  2F42 A;  2QIC A;  2JMI A;  2CRR A;  5I3L A;  2LDR A;  2YT5 A;  1JM7 A;  4V3L C;  2LXH C;  2MA5 A;  3GV4 A;  2RSD A;  3FM8 C;  3PUR A;  4A4C A;  4LK9 A;  4Z0R A;  4YAX A;  4H9D A;  2MD8 C;  3M7K A;  5G05 B;  2Y1N A;  1MBM A;  2MNY A;  2D8S A;  5B78 A;  5H1V A;  2E6S A;  1MM2 A;  2JM3 A;  3HTK C;  5D1L B;  2VNF A;  2YHN A;  3ZNI A;  2NAA A;  3O7A A;  2KU3 A;  4AYC A;  4AYC B;  5B75 A;  2VJF B;  1WEM A;  2JUN A;  2RI7 A;  3EB5 A;  3U5O A;  2MT5 A;  2VPB A;  2M1R A;  4TKP B;  2KRE A;  1JM7 B;  1Z6U A;  2CRW A;  4XI1 A;  2ECJ A;  4A49 A;  4ZQL A;  2KYU A;  3PHD A;  4QF2 A;  5FER A;  3L1Z B;  5SVI B;  3DQV R;  3E2D A;  2C2V S;  3MHH A;  2G6Q A;  2Y43 A;  4OGE A;  4ZDT A;  4CCG X;  3N9N A;  3L1X A;  3LQI A;  2KWN A;  2FD4 A;  1ZBD B;  3O47 A;  3FL2 A;  2JMJ A;  2RR4 A;  3KQI A;  1XWH A;  2MNZ A;  2KWJ A;  3QZV A;  2LXP C;  1X4I A;  5SVI A;  4N4F A;  5JG6 A;  2I50 A;  1LDK C;  2CKL A;  3HCS A;  5D1K B;  3SOU A;  3H7H A;  4YBS A;  2VJE A;  3O35 A;  3N9Q A;  2PNX A;  4R8P K;  3N9O A;  4UP0 A;  4FO9 A;  4YAD A;  2K4D A;  3O70 A;  2K1J A;  2HYE D;  3GL6 A;  2XOC A;  4O64 A;  2EGM A;  2L80 A;  1G25 A;  5DKA A;  3Q1D A;  3FAO A;  3LVR E;  5AIU A;  4WZ0 A;  4L7X A;  2YQM A;  3SOX A;  4YC9 A;  1VFY A;  2CSV A;  2CON A;  1WEO A;  3M99 A;  1WIL A;  3N9M A;  5SVY A;  5FB1 A;  1WE9 A;  3MDB C;  2LGK A;  2XB1 A;  4CA1 A;  1RMD A;  2VP7 A;  3C6W A;  2VJE B;  4LKA A;  5B77 A;  4IC2 A;  3PLW A;  2VPE A;  4YAB A;  2DSM A;  3O37 A;  1WEV A;  2XOZ A;  4WZ3 B;  1LDJ B; 
#chains in the Genus database with same CATH homology
 4WA6 A;  5B76 A;  2Y1M A;  1FBV A;  3U5M A;  4A0C D;  2LRI C;  4S3O C;  3I2D A;  4I7C A;  2ZET C;  4P5O B;  5TBN A;  4R7E A;  5KH7 A;  3PUQ A;  2YRE A;  2M85 A;  2L5U A;  3SOW A;  5FB0 A;  1X4U A;  4V3K C;  3RPG C;  4W4U A;  2AN6 A;  2KWK A;  4FJC A;  3HCT A;  4PPE A;  4R2Y A;  1HYJ A;  4YBM A;  4WZ2 A;  2F6J A;  5AIT A;  4UP5 A;  3U5P A;  2K17 A;  3LRQ A;  5H1T A;  3M63 A;  1HYI A;  2VPD A;  1T1H A;  5B79 A;  4YBT A;  2CT2 A;  1WGM A;  2ECV A;  2KR4 A;  2PUY A;  5TAB A;  4B86 C;  2L75 A;  4L58 A;  4I7B A;  1BOR A;  2LGV A;  2M6M A;  2UZG A;  2C2L A;  5LKU A;  5TDW A;  1MM3 A;  2ECW A;  5J3X A;  5H1U A;  1JOC A;  2E6R A;  2IDA A;  3LQH A;  2M3H A;  1V87 A;  1VD4 A;  2QIZ A;  5C11 A;  4GND A;  2YSM A;  3M62 A;  3HCU A;  1X4J A;  2CKL B;  4B7Y C;  3LQJ A;  5C13 A;  1WEP A;  5KH9 A;  3EB6 A;  1IYM A;  2H0D B;  2EGP A;  4C9Z A;  1WEE A;  1Z2Q A;  1WEU A;  3O33 A;  2KWO A;  3ASL A;  3ZPV 1;  2G45 A;  3VK6 A;  2BAY A;  2ECN A;  4MVT A;  4NN2 A;  3N9L A;  5DIN A;  5FEY A;  4LLB A;  2ECI A;  3KNV A;  2MUM A;  5H9M A;  3IHP A;  1WIM A;  3C5K A;  3O34 A;  1CHC A;  2YYR A;  4BBQ A;  4GNF A;  2L43 A;  4GNE A;  5LCW B;  4X3G A;  5TRB A;  2ECT A;  2YSJ A;  2XEU A;  5G0F A;  2YUC A;  2H0D A;  4QF3 A;  3L11 A;  2KFT A;  2CSZ A;  5B8D A;  4AP4 A;  1VYX A;  1K2F A;  5LKX A;  2KGG A;  3DPL R;  4GNG A;  3ZYQ A;  3RPG B;  2YU4 A;  1E4U A;  2MIQ A;  2FUU A;  2EA6 A;  2HDP A;  3MHS A;  4LAD B;  4AUQ B;  3SHB A;  4AVX A;  4IC3 A;  4UI9 B;  4I7D A;  4S3O B;  2LGG A;  1WEN A;  1WEW A;  1F62 A;  2FSA A;  5KH3 A;  5LKZ A;  2LV9 A;  3KV5 A;  1WES A;  4GB0 A;  2LN0 A;  1N87 A;  2F6N A;  2YHO A;  4MSX A;  3U5N A;  3RTR B;  3O36 A;  1WFK A;  2CSY A;  1DVP A;  2JMD A;  4F52 B;  4ZUX U;  2YQL A;  2FUI A;  4N3W A;  4Q6F A;  5D1M B;  3ZVZ B;  2VPG A;  2DX8 A;  4YAT A;  2G43 A;  5LKT A;  1FP0 A;  2L0B A;  4A4B A;  2YW8 A;  2LQ6 A;  3V43 A;  1WEQ A;  4LJN A;  2MD7 B;  4BHW A;  3ZPV E;  3T6R A;  1U6G B;  2EOD A;  3N9P A;  3ZVY A;  4FK5 A;  2KIZ A;  2OXQ C;  3KV6 A;  1Z60 A;  3T7L A;  3ZTG A;  2QJ0 A;  3NG2 A;  2LGL A;  4FIP A;  4PTB A;  2KE1 A;  2KGI A;  2YUR A;  2JRJ A;  5TDR A;  5G04 B;  2VJF A;  5EYA F;  2K16 A;  2ECG A;  2MA6 A;  2F42 A;  2QIC A;  2JMI A;  5I3L A;  2LDR A;  2YT5 A;  1JM7 A;  4V3L C;  2LXH C;  2MA5 A;  3GV4 A;  2RSD A;  3PUR A;  4A4C A;  4LK9 A;  4YAX A;  2MD8 C;  5G05 B;  2Y1N A;  2MNY A;  2D8S A;  5B78 A;  5H1V A;  2E6S A;  1MM2 A;  3HTK C;  5D1L B;  2VNF A;  2YHN A;  3ZNI A;  2NAA A;  3O7A A;  2KU3 A;  4AYC A;  4AYC B;  5B75 A;  2VJF B;  1WEM A;  2RI7 A;  3EB5 A;  3U5O A;  2MT5 A;  2VPB A;  4TKP B;  2M1R A;  2KRE A;  1JM7 B;  1Z6U A;  4XI1 A;  2ECJ A;  4A49 A;  4ZQL A;  2KYU A;  3PHD A;  4QF2 A;  5FER A;  3L1Z B;  3DQV R;  2C2V S;  3MHH A;  2G6Q A;  2Y43 A;  4ZDT A;  4CCG X;  3N9N A;  3L1X A;  3LQI A;  2KWN A;  1ZBD B;  3FL2 A;  2JMJ A;  3KQI A;  1XWH A;  2MNZ A;  2KWJ A;  3QZV A;  2LXP C;  1X4I A;  4N4F A;  5JG6 A;  2I50 A;  1LDK C;  2CKL A;  3HCS A;  5D1K B;  3SOU A;  4YBS A;  2VJE A;  3O35 A;  3N9Q A;  2PNX A;  4R8P K;  3N9O A;  4UP0 A;  4FO9 A;  4YAD A;  2K4D A;  3O70 A;  2K1J A;  2HYE D;  3GL6 A;  4O64 A;  2L80 A;  1G25 A;  5DKA A;  5AIU A;  4WZ0 A;  4L7X A;  2YQM A;  3SOX A;  4YC9 A;  1VFY A;  1WEO A;  3M99 A;  1WIL A;  3N9M A;  5FB1 A;  1WE9 A;  2LGK A;  2XB1 A;  4CA1 A;  1RMD A;  2VP7 A;  3C6W A;  2VJE B;  4LKA A;  5B77 A;  4IC2 A;  2VPE A;  4YAB A;  3O37 A;  1WEV A;  4WZ3 B;  1LDJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...