4AP4A

Rnf4 - ubch5a - ubiquitin heterotrimeric complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYIGSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/signalling protein
molecule keywords E3 UBIQUITIN LIGASE RNF4
publication title Structure of a Ring E3 Ligase and Ubiquitin-Loaded E2 Primed for Catalysis
pubmed doi rcsb
source organism Rattus norvegicus
total genus 30
structure length 129
sequence length 129
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ap4A00
2VPBA 2YQLA 5KH3A 3V43A 2LXHC 2KFTA 3L1XA 4P5OB 2YT5A 4AP4A 4NN2A 4A4CA 2Y1MA 5J3XA 2YU4A 4WZ0A 4YAXA 3M63A 3DPLR 2IDAA 1VFYA 1CHCA 1IYMA 5B76A 5G04B 2YYRA 3U5NA 1WEOA 4S3OB 5LKXA 2CKLB 2FUUA 4FO9A 4LKAA 5G05B 2LGGA 3HCSA 3U5PA 1JM7B 2NAAA 2RSDA 2LQ6A 3KNVA 4L58A 1G25A 4W4UA 4YC9A 4R7EA 2LGLA 2XEUA 3DQVR 4CA1A 4UI9B 4N3WA 2L80A 1Z6UA 5KH7A 2YURA 2D8SA 2ECGA 3SOWA 3LRQA 2KE1A 4ZDTA 2YQMA 5JG6A 3MHSA 3O35A 4FIPA 4I7DA 4YBTA 4C9ZA 5H9MA 1U6GB 3RPGC 4A49A 4V3LC 5I3LA 5FB1A 2BAYA 2CT2A 2KREA 5FEYA 2M3HA 2MA6A 5FB0A 2VJEB 3KQIA 4V3KC 2C2VS 4GNDA 3T7LA 2VPGA 4AVXA 5DKAA 1WENA 1ZBDB 4XI1A 2YSMA 2LXPC 2VJFA 2H0DB 3LQHA 3ZPVE 2KWJA 3ZTGA 4F52B 2G43A 5TBNA 2ZETC 3SOUA 2JMJA 5TABA 4GNEA 2ECNA 5B8DA 2AN6A 2E6SA 2VP7A 1LDKC 2VNFA 4GNFA 5LKTA 2I50A 2L43A 3HCTA 3I2DA 3ZYQA 1WESA 2K16A 3L11A 3LQIA 2L75A 3ZVZB 2K4DA 1WEUA 3EB5A 4B86C 2PNXA 2KWNA 4AYCB 1FBVA 3VK6A 4GB0A 2YW8A 2CSZA 3NG2A 2ECTA 3U5OA 3RTRB 4LJNA 4WA6A 5EYAF 2OXQC 2LGVA 1X4IA 2CSYA 2UZGA 1VD4A 2KWOA 1XWHA 5B78A 4R8PK 4A0CD 2EA6A 4N4FA 5TDRA 4AUQB 2HDPA 2L0BA 1LDJB 2CKLA 1WEPA 4PPEA 2JRJA 2MA5A 4LADB 2F42A 2MT5A 5FERA 4LK9A 5D1KB 1JM7A 4UP5A 4YADA 1MM2A 3ZVYA 3RPGB 4PTBA 2M85A 4ZUXU 2KIZA 5B75A 5C11A 2MIQA 1F62A 3PUQA 3O7AA 2K17A 2K1JA 4CCGX 5D1LB 3KV5A 3MHHA 1HYIA 2FSAA 2G6QA 2Y1NA 4BHWA 2EGPA 4A4BA 4FJCA 2KYUA 2LV9A 3N9PA 4YBMA 1N87A 2MNZA 4MSXA 3O36A 3N9QA 2E6RA 2VPDA 4B7YC 4WZ2A 2Y43A 2MUMA 2YSJA 4LLBA 2VJEA 1X4JA 3N9MA 2LN0A 3ZNIA 4FK5A 4L7XA 2ECIA 3O70A 2FUIA 1WEVA 2H0DA 3SOXA 3PURA 1VYXA 4X3GA 3N9NA 3L1ZB 5LCWB 2EODA 2QICA 4TKPB 1V87A 4IC2A 2ECVA 2JMIA 4I7BA 4IC3A 4YBSA 4YATA 2LRIC 3M99A 5H1VA 5D1MB 3LQJA 2HYED 5LKUA 2KU3A 5AITA 3U5MA 2LGKA 2MNYA 4S3OC 1X4UA 2VPEA 4AYCA 1WEWA 1WFKA 2YUCA 2KGIA 5AIUA 1FP0A 1Z2QA 5B77A 1WE9A 3M62A 4UP0A 1Z60A 3HTKC 2F6JA 2M1RA 2QJ0A 4R2YA 2YREA 2PUYA 2QIZA 2XB1A 4BBQA 2G45A 3N9OA 1WGMA 4YABA 1WEMA 4O64A 3N9LA 1WEQA 5LKZA 2MD7B 4WZ3B 3C5KA 2M6MA 2ECJA 2MD8C 3C6WA 3QZVA 1E4UA 2KGGA 1WEEA 1K2FA 4QF2A 1WIMA 1WILA 2YHOA 2DX8A 2ECWA 3GL6A 4GNGA 4Q6FA 2RI7A 4QF3A 2F6NA 3FL2A 2VJFB 1DVPA 3ZPV1 1T1HA 1BORA 2YHNA 5H1UA 2JMDA 5DINA 1RMDA 3T6RA 3GV4A 2L5UA 3EB6A 5B79A 5C13A 5G0FA 3O33A 4I7CA 4ZQLA 5TDWA 5TRBA 2LDRA 3HCUA 1HYJA 3O37A 5H1TA 1JOCA 2C2LA 3PHDA 2KWKA 3ASLA 3IHPA 3SHBA 1MM3A 2KR4A 5KH9A 3KV6A 4MVTA 3O34A
chains in the Genus database with same CATH superfamily
2VPBA 2YQLA 2M13A 5KH3A 3FJUB 4Z0OA 3V43A 2LXHC 2KFTA 2CSVA 3L1XA 4P5OB 2YT5A 4AP4A 4NN2A 4A4CA 2Y1MA 5J3XA 2YU4A 4WZ0A 4YAXA 3M63A 3DPLR 2IDAA 1VFYA 1CHCA 1IYMA 5B76A 5G04B 2YYRA 3U5NA 1WEOA 4S3OB 5LKXA 2CKLB 2FUUA 4FO9A 4LKAA 3LVRE 4O62A 5G05B 2LGGA 3HCSA 3FAOA 3U5PA 1JM7B 2NAAA 4Z0RA 2RSDA 2LQ6A 3KNVA 4L58A 1G25A 4W4UA 2FFWA 4YC9A 3SUBA 4R7EA 2LGLA 2XEUA 3DQVR 4CA1A 4UI9B 4N3WA 2L80A 1Z6UA 5KH7A 2YURA 2D8SA 2ECGA 3SOWA 3LRQA 2KE1A 4ZDTA 2YQMA 5JG6A 3MHSA 3O35A 4FIPA 4I7DA 4YBTA 4C9ZA 5H9MA 1U6GB 3RPGC 4A49A 4V3LC 5I3LA 5FB1A 2BAYA 2MKEA 2XOYA 2KKYA 2CT2A 2KREA 5FEYA 2M3HA 2MA6A 5FB0A 4QQ4A 2VJEB 3H7HA 3KQIA 4V3KC 2C2VS 2D8UA 4GNDA 3T7LA 2VPGA 4AVXA 5DKAA 1WENA 1ZBDB 4XI1A 2YSMA 2LXPC 2VJFA 3KDEC 2H0DB 3LQHA 3ZPVE 2KWJA 3ZTGA 3LVQE 4F52B 2G43A 5TBNA 2DSMA 2ZETC 3SOUA 2JUNA 2JMJA 2XOZA 5TABA 4GNEA 2ECNA 5B8DA 2AN6A 2E6SA 2VP7A 2OWAA 1LDKC 2VNFA 3FANA 3O47A 4GNFA 5LKTA 2I50A 2L43A 3HCTA 3I2DA 3ZYQA 1WESA 2K16A 3L11A 3LQIA 2L75A 3ZVZB 4H9DA 2K4DA 1WEUA 3EB5A 4B86C 2PNXA 2KWNA 5K3QA 4AYCB 1FBVA 2XOCA 3VK6A 4OGEA 4GB0A 2YW8A 2CSZA 3NG2A 2ECTA 3U5OA 3RTRB 4LJNA 3DDTA 2JM3A 4WA6A 5EYAF 2OXQC 2LGVA 1X4IA 2CSYA 2UZGA 2YVRA 1VD4A 2KWOA 1XWHA 3T9KA 5B78A 4R8PK 4A0CD 2EA6A 4N4FA 5TDRA 4AUQB 2HDPA 2L0BA 1LDJB 2CKLA 1WEPA 4PPEA 2JRJA 2MA5A 4LADB 2F42A 2MT5A 5SVIB 5FERA 4LK9A 5D1KB 1JM7A 4UP5A 4YADA 1MM2A 3ZVYA 3RPGB 2FD4A 4PTBA 2M85A 4ZUXU 2KIZA 5B75A 5C11A 2MIQA 3JUEA 3PLWA 1F62A 3PUQA 3O7AA 2K17A 2K1JA 4CCGX 5D1LB 3KV5A 3MHHA 1HYIA 2FSAA 2IQJA 2E61A 2G6QA 2Y1NA 2XP0A 4BHWA 2EGPA 4A4BA 4FJCA 2KYUA 2LV9A 3N9PA 4YBMA 1N87A 2MNZA 4MSXA 3LDYA 3O36A 3N9QA 2E6RA 2VPDA 4B7YC 4WZ2A 2Y43A 2MUMA 2YSJA 4LLBA 2VJEA 1X4JA 3N9MA 2LN0A 2B0OE 3ZNIA 4FK5A 4L7XA 2ECIA 3O70A 2FUIA 1WEVA 2H0DA 4OGCA 2RR4A 3SOXA 3PURA 1VYXA 3N9NA 4X3GA 3L1ZB 5LCWB 2CRRA 2EODA 2QICA 4TKPB 1V87A 4IC2A 2ECVA 2JMIA 4I7BA 2L7PA 4IC3A 4YBSA 4YATA 2LRIC 2CRWA 3M99A 5H1VA 5D1MB 3LQJA 2HYED 5LKUA 2KU3A 5AITA 3U5MA 2LGKA 2MNYA 2CONA 4S3OC 1MBMA 1X4UA 2VPEA 4AYCA 1WEWA 1DCQA 1WFKA 2YUCA 2KGIA 5AIUA 1FP0A 1Z2QA 5B77A 3FEHA 1WE9A 3M62A 4UP0A 3Q1DA 1Z60A 3HTKC 2F6JA 2M1RA 2QJ0A 4R2YA 2LAUA 2YREA 2PUYA 2QIZA 2XB1A 4BBQA 3M7KA 2G45A 3N9OA 1WGMA 4YABA 2EGMA 1WEMA 4O64A 3N9LA 4F1PA 2DJAA 1WEQA 5LKZA 2MD7B 4WZ3B 3C5KA 2M6MA 2ECJA 2EXUA 2MD8C 3C6WA 3QZVA 1E4UA 2KGGA 1WEEA 5SVIA 1K2FA 4QF2A 1WIMA 1WILA 3FM8C 2P57A 2YHOA 2DX8A 2ECWA 3GL6A 4GNGA 4Q6FA 2RI7A 4QF3A 2F6NA 2KKXA 3LJUX 3FL2A 2VJFB 1DVPA 5SVXA 3ZPV1 1T1HA 1BORA 2YHNA 5H1UA 2JMDA 5DINA 1RMDA 3T6RA 3GV4A 2L5UA 3EB6A 5B79A 5C13A 5G0FA 3O33A 4I7CA 4ZQLA 5TDWA 5TRBA 2LDRA 3HCUA 1HYJA 3O37A 5H1TA 1JOCA 2C2LA 3PHDA 2KWKA 3ASLA 3DWDA 3IHPA 3MDBC 3SHBA 1MM3A 2KR4A 5SVYA 5KH9A 3E2DA 3KV6A 4MVTA 3O34A
chains in the Genus database with same CATH topology
2VPBA 2YQLA 5KH3A 3V43A 2LXHC 2KFTA 3L1XA 4P5OB 2YT5A 4AP4A 4NN2A 4A4CA 2Y1MA 5J3XA 2YU4A 4WZ0A 4YAXA 3M63A 3DPLR 2IDAA 1VFYA 1CHCA 1IYMA 5B76A 5G04B 2YYRA 3U5NA 1WEOA 4S3OB 5LKXA 2CKLB 2FUUA 4FO9A 4LKAA 5G05B 2LGGA 3HCSA 3U5PA 1JM7B 2NAAA 2RSDA 2LQ6A 3KNVA 4L58A 1G25A 4W4UA 4YC9A 4R7EA 2LGLA 2XEUA 3DQVR 4CA1A 4UI9B 4N3WA 2L80A 1Z6UA 5KH7A 2YURA 2D8SA 2ECGA 3SOWA 3LRQA 2KE1A 4ZDTA 2YQMA 5JG6A 3MHSA 3O35A 4FIPA 4I7DA 4YBTA 4C9ZA 5H9MA 1U6GB 3RPGC 4A49A 4V3LC 5I3LA 5FB1A 2BAYA 2CT2A 2KREA 5FEYA 2M3HA 2MA6A 5FB0A 2VJEB 3KQIA 4V3KC 2C2VS 4GNDA 3T7LA 2VPGA 4AVXA 5DKAA 1WENA 1ZBDB 4XI1A 2YSMA 2LXPC 2VJFA 2H0DB 3LQHA 3ZPVE 2KWJA 3ZTGA 4F52B 2G43A 5TBNA 2ZETC 3SOUA 2JMJA 5TABA 4GNEA 2ECNA 5B8DA 2AN6A 2E6SA 2VP7A 1LDKC 2VNFA 4GNFA 5LKTA 2I50A 2L43A 3HCTA 3I2DA 3ZYQA 1WESA 2K16A 3L11A 3LQIA 2L75A 3ZVZB 2K4DA 1WEUA 3EB5A 4B86C 2PNXA 2KWNA 4AYCB 1FBVA 3VK6A 4GB0A 2YW8A 2CSZA 3NG2A 2ECTA 3U5OA 3RTRB 4LJNA 4WA6A 5EYAF 2OXQC 2LGVA 1X4IA 2CSYA 2UZGA 1VD4A 2KWOA 1XWHA 5B78A 4R8PK 4A0CD 2EA6A 4N4FA 5TDRA 4AUQB 2HDPA 2L0BA 1LDJB 2CKLA 1WEPA 4PPEA 2JRJA 2MA5A 4LADB 2F42A 2MT5A 5FERA 4LK9A 5D1KB 1JM7A 4UP5A 4YADA 1MM2A 3ZVYA 3RPGB 4PTBA 2M85A 4ZUXU 2KIZA 5B75A 5C11A 2MIQA 1F62A 3PUQA 3O7AA 2K17A 2K1JA 4CCGX 5D1LB 3KV5A 3MHHA 1HYIA 2FSAA 2G6QA 2Y1NA 4BHWA 2EGPA 4A4BA 4FJCA 2KYUA 2LV9A 3N9PA 4YBMA 1N87A 2MNZA 4MSXA 3O36A 3N9QA 2E6RA 2VPDA 4B7YC 4WZ2A 2Y43A 2MUMA 2YSJA 4LLBA 2VJEA 1X4JA 3N9MA 2LN0A 3ZNIA 4FK5A 4L7XA 2ECIA 3O70A 2FUIA 1WEVA 2H0DA 3SOXA 3PURA 1VYXA 4X3GA 3N9NA 3L1ZB 5LCWB 2EODA 2QICA 4TKPB 1V87A 4IC2A 2ECVA 2JMIA 4I7BA 4IC3A 4YBSA 4YATA 2LRIC 3M99A 5H1VA 5D1MB 3LQJA 2HYED 5LKUA 2KU3A 5AITA 3U5MA 2LGKA 2MNYA 4S3OC 1X4UA 2VPEA 4AYCA 1WEWA 1WFKA 2YUCA 2KGIA 5AIUA 1FP0A 1Z2QA 5B77A 1WE9A 3M62A 4UP0A 1Z60A 3HTKC 2F6JA 2M1RA 2QJ0A 4R2YA 2YREA 2PUYA 2QIZA 2XB1A 4BBQA 2G45A 3N9OA 1WGMA 4YABA 1WEMA 4O64A 3N9LA 1WEQA 5LKZA 2MD7B 4WZ3B 3C5KA 2M6MA 2ECJA 2MD8C 3C6WA 3QZVA 1E4UA 2KGGA 1WEEA 1K2FA 4QF2A 1WIMA 1WILA 2YHOA 2DX8A 2ECWA 3GL6A 4GNGA 4Q6FA 2RI7A 4QF3A 2F6NA 3FL2A 2VJFB 1DVPA 3ZPV1 1T1HA 1BORA 2YHNA 5H1UA 2JMDA 5DINA 1RMDA 3T6RA 3GV4A 2L5UA 3EB6A 5B79A 5C13A 5G0FA 3O33A 4I7CA 4ZQLA 5TDWA 5TRBA 2LDRA 3HCUA 1HYJA 3O37A 5H1TA 1JOCA 2C2LA 3PHDA 2KWKA 3ASLA 3IHPA 3SHBA 1MM3A 2KR4A 5KH9A 3KV6A 4MVTA 3O34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPB A;  2YQL A;  5KH3 A;  3V43 A;  2LXH C;  2KFT A;  3L1X A;  4P5O B;  2YT5 A;  4AP4 A;  4NN2 A;  4A4C A;  2Y1M A;  5J3X A;  2YU4 A;  4WZ0 A;  4YAX A;  3M63 A;  3DPL R;  2IDA A;  1VFY A;  1CHC A;  1IYM A;  5B76 A;  5G04 B;  2YYR A;  3U5N A;  1WEO A;  4S3O B;  5LKX A;  2CKL B;  2FUU A;  4FO9 A;  4LKA A;  5G05 B;  2LGG A;  3HCS A;  3U5P A;  1JM7 B;  2NAA A;  2RSD A;  2LQ6 A;  3KNV A;  4L58 A;  1G25 A;  4W4U A;  4YC9 A;  4R7E A;  2LGL A;  2XEU A;  3DQV R;  4CA1 A;  4UI9 B;  4N3W A;  2L80 A;  1Z6U A;  5KH7 A;  2YUR A;  2D8S A;  2ECG A;  3SOW A;  3LRQ A;  2KE1 A;  4ZDT A;  2YQM A;  5JG6 A;  3MHS A;  3O35 A;  4FIP A;  4I7D A;  4YBT A;  4C9Z A;  5H9M A;  1U6G B;  3RPG C;  4A49 A;  4V3L C;  5I3L A;  5FB1 A;  2BAY A;  2CT2 A;  2KRE A;  5FEY A;  2M3H A;  2MA6 A;  5FB0 A;  2VJE B;  3KQI A;  4V3K C;  2C2V S;  4GND A;  3T7L A;  2VPG A;  4AVX A;  5DKA A;  1WEN A;  1ZBD B;  4XI1 A;  2YSM A;  2LXP C;  2VJF A;  2H0D B;  3LQH A;  3ZPV E;  2KWJ A;  3ZTG A;  4F52 B;  2G43 A;  5TBN A;  2ZET C;  3SOU A;  2JMJ A;  5TAB A;  4GNE A;  2ECN A;  5B8D A;  2AN6 A;  2E6S A;  2VP7 A;  1LDK C;  2VNF A;  4GNF A;  5LKT A;  2I50 A;  2L43 A;  3HCT A;  3I2D A;  3ZYQ A;  1WES A;  2K16 A;  3L11 A;  3LQI A;  2L75 A;  3ZVZ B;  2K4D A;  1WEU A;  3EB5 A;  4B86 C;  2PNX A;  2KWN A;  4AYC B;  1FBV A;  3VK6 A;  4GB0 A;  2YW8 A;  2CSZ A;  3NG2 A;  2ECT A;  3U5O A;  3RTR B;  4LJN A;  4WA6 A;  5EYA F;  2OXQ C;  2LGV A;  1X4I A;  2CSY A;  2UZG A;  1VD4 A;  2KWO A;  1XWH A;  5B78 A;  4R8P K;  4A0C D;  2EA6 A;  4N4F A;  5TDR A;  4AUQ B;  2HDP A;  2L0B A;  1LDJ B;  2CKL A;  1WEP A;  4PPE A;  2JRJ A;  2MA5 A;  4LAD B;  2F42 A;  2MT5 A;  5FER A;  4LK9 A;  5D1K B;  1JM7 A;  4UP5 A;  4YAD A;  1MM2 A;  3ZVY A;  3RPG B;  4PTB A;  2M85 A;  4ZUX U;  2KIZ A;  5B75 A;  5C11 A;  2MIQ A;  1F62 A;  3PUQ A;  3O7A A;  2K17 A;  2K1J A;  4CCG X;  5D1L B;  3KV5 A;  3MHH A;  1HYI A;  2FSA A;  2G6Q A;  2Y1N A;  4BHW A;  2EGP A;  4A4B A;  4FJC A;  2KYU A;  2LV9 A;  3N9P A;  4YBM A;  1N87 A;  2MNZ A;  4MSX A;  3O36 A;  3N9Q A;  2E6R A;  2VPD A;  4B7Y C;  4WZ2 A;  2Y43 A;  2MUM A;  2YSJ A;  4LLB A;  2VJE A;  1X4J A;  3N9M A;  2LN0 A;  3ZNI A;  4FK5 A;  4L7X A;  2ECI A;  3O70 A;  2FUI A;  1WEV A;  2H0D A;  3SOX A;  3PUR A;  1VYX A;  4X3G A;  3N9N A;  3L1Z B;  5LCW B;  2EOD A;  2QIC A;  4TKP B;  1V87 A;  4IC2 A;  2ECV A;  2JMI A;  4I7B A;  4IC3 A;  4YBS A;  4YAT A;  2LRI C;  3M99 A;  5H1V A;  5D1M B;  3LQJ A;  2HYE D;  5LKU A;  2KU3 A;  5AIT A;  3U5M A;  2LGK A;  2MNY A;  4S3O C;  1X4U A;  2VPE A;  4AYC A;  1WEW A;  1WFK A;  2YUC A;  2KGI A;  5AIU A;  1FP0 A;  1Z2Q A;  5B77 A;  1WE9 A;  3M62 A;  4UP0 A;  1Z60 A;  3HTK C;  2F6J A;  2M1R A;  2QJ0 A;  4R2Y A;  2YRE A;  2PUY A;  2QIZ A;  2XB1 A;  4BBQ A;  2G45 A;  3N9O A;  1WGM A;  4YAB A;  1WEM A;  4O64 A;  3N9L A;  1WEQ A;  5LKZ A;  2MD7 B;  4WZ3 B;  3C5K A;  2M6M A;  2ECJ A;  2MD8 C;  3C6W A;  3QZV A;  1E4U A;  2KGG A;  1WEE A;  1K2F A;  4QF2 A;  1WIM A;  1WIL A;  2YHO A;  2DX8 A;  2ECW A;  3GL6 A;  4GNG A;  4Q6F A;  2RI7 A;  4QF3 A;  2F6N A;  3FL2 A;  2VJF B;  1DVP A;  3ZPV 1;  1T1H A;  1BOR A;  2YHN A;  5H1U A;  2JMD A;  5DIN A;  1RMD A;  3T6R A;  3GV4 A;  2L5U A;  3EB6 A;  5B79 A;  5C13 A;  5G0F A;  3O33 A;  4I7C A;  4ZQL A;  5TDW A;  5TRB A;  2LDR A;  3HCU A;  1HYJ A;  3O37 A;  5H1T A;  1JOC A;  2C2L A;  3PHD A;  2KWK A;  3ASL A;  3IHP A;  3SHB A;  1MM3 A;  2KR4 A;  5KH9 A;  3KV6 A;  4MVT A;  3O34 A; 
#chains in the Genus database with same CATH topology
 2VPB A;  2YQL A;  2M13 A;  5KH3 A;  3FJU B;  4Z0O A;  3V43 A;  2LXH C;  2KFT A;  2CSV A;  3L1X A;  4P5O B;  2YT5 A;  4AP4 A;  4NN2 A;  4A4C A;  2Y1M A;  5J3X A;  2YU4 A;  4WZ0 A;  4YAX A;  3M63 A;  3DPL R;  2IDA A;  1VFY A;  1CHC A;  1IYM A;  5B76 A;  5G04 B;  2YYR A;  3U5N A;  1WEO A;  4S3O B;  5LKX A;  2CKL B;  2FUU A;  4FO9 A;  4LKA A;  3LVR E;  4O62 A;  5G05 B;  2LGG A;  3HCS A;  3FAO A;  3U5P A;  1JM7 B;  2NAA A;  4Z0R A;  2RSD A;  2LQ6 A;  3KNV A;  4L58 A;  1G25 A;  4W4U A;  2FFW A;  4YC9 A;  3SUB A;  4R7E A;  2LGL A;  2XEU A;  3DQV R;  4CA1 A;  4UI9 B;  4N3W A;  2L80 A;  1Z6U A;  5KH7 A;  2YUR A;  2D8S A;  2ECG A;  3SOW A;  3LRQ A;  2KE1 A;  4ZDT A;  2YQM A;  5JG6 A;  3MHS A;  3O35 A;  4FIP A;  4I7D A;  4YBT A;  4C9Z A;  5H9M A;  1U6G B;  3RPG C;  4A49 A;  4V3L C;  5I3L A;  5FB1 A;  2BAY A;  2MKE A;  2XOY A;  2KKY A;  2CT2 A;  2KRE A;  5FEY A;  2M3H A;  2MA6 A;  5FB0 A;  4QQ4 A;  2VJE B;  3H7H A;  3KQI A;  4V3K C;  2C2V S;  2D8U A;  4GND A;  3T7L A;  2VPG A;  4AVX A;  5DKA A;  1WEN A;  1ZBD B;  4XI1 A;  2YSM A;  2LXP C;  2VJF A;  3KDE C;  2H0D B;  3LQH A;  3ZPV E;  2KWJ A;  3ZTG A;  3LVQ E;  4F52 B;  2G43 A;  5TBN A;  2DSM A;  2ZET C;  3SOU A;  2JUN A;  2JMJ A;  2XOZ A;  5TAB A;  4GNE A;  2ECN A;  5B8D A;  2AN6 A;  2E6S A;  2VP7 A;  2OWA A;  1LDK C;  2VNF A;  3FAN A;  3O47 A;  4GNF A;  5LKT A;  2I50 A;  2L43 A;  3HCT A;  3I2D A;  3ZYQ A;  1WES A;  2K16 A;  3L11 A;  3LQI A;  2L75 A;  3ZVZ B;  4H9D A;  2K4D A;  1WEU A;  3EB5 A;  4B86 C;  2PNX A;  2KWN A;  5K3Q A;  4AYC B;  1FBV A;  2XOC A;  3VK6 A;  4OGE A;  4GB0 A;  2YW8 A;  2CSZ A;  3NG2 A;  2ECT A;  3U5O A;  3RTR B;  4LJN A;  3DDT A;  2JM3 A;  4WA6 A;  5EYA F;  2OXQ C;  2LGV A;  1X4I A;  2CSY A;  2UZG A;  2YVR A;  1VD4 A;  2KWO A;  1XWH A;  3T9K A;  5B78 A;  4R8P K;  4A0C D;  2EA6 A;  4N4F A;  5TDR A;  4AUQ B;  2HDP A;  2L0B A;  1LDJ B;  2CKL A;  1WEP A;  4PPE A;  2JRJ A;  2MA5 A;  4LAD B;  2F42 A;  2MT5 A;  5SVI B;  5FER A;  4LK9 A;  5D1K B;  1JM7 A;  4UP5 A;  4YAD A;  1MM2 A;  3ZVY A;  3RPG B;  2FD4 A;  4PTB A;  2M85 A;  4ZUX U;  2KIZ A;  5B75 A;  5C11 A;  2MIQ A;  3JUE A;  3PLW A;  1F62 A;  3PUQ A;  3O7A A;  2K17 A;  2K1J A;  4CCG X;  5D1L B;  3KV5 A;  3MHH A;  1HYI A;  2FSA A;  2IQJ A;  2E61 A;  2G6Q A;  2Y1N A;  2XP0 A;  4BHW A;  2EGP A;  4A4B A;  4FJC A;  2KYU A;  2LV9 A;  3N9P A;  4YBM A;  1N87 A;  2MNZ A;  4MSX A;  3LDY A;  3O36 A;  3N9Q A;  2E6R A;  2VPD A;  4B7Y C;  4WZ2 A;  2Y43 A;  2MUM A;  2YSJ A;  4LLB A;  2VJE A;  1X4J A;  3N9M A;  2LN0 A;  2B0O E;  3ZNI A;  4FK5 A;  4L7X A;  2ECI A;  3O70 A;  2FUI A;  1WEV A;  2H0D A;  4OGC A;  2RR4 A;  3SOX A;  3PUR A;  1VYX A;  3N9N A;  4X3G A;  3L1Z B;  5LCW B;  2CRR A;  2EOD A;  2QIC A;  4TKP B;  1V87 A;  4IC2 A;  2ECV A;  2JMI A;  4I7B A;  2L7P A;  4IC3 A;  4YBS A;  4YAT A;  2LRI C;  2CRW A;  3M99 A;  5H1V A;  5D1M B;  3LQJ A;  2HYE D;  5LKU A;  2KU3 A;  5AIT A;  3U5M A;  2LGK A;  2MNY A;  2CON A;  4S3O C;  1MBM A;  1X4U A;  2VPE A;  4AYC A;  1WEW A;  1DCQ A;  1WFK A;  2YUC A;  2KGI A;  5AIU A;  1FP0 A;  1Z2Q A;  5B77 A;  3FEH A;  1WE9 A;  3M62 A;  4UP0 A;  3Q1D A;  1Z60 A;  3HTK C;  2F6J A;  2M1R A;  2QJ0 A;  4R2Y A;  2LAU A;  2YRE A;  2PUY A;  2QIZ A;  2XB1 A;  4BBQ A;  3M7K A;  2G45 A;  3N9O A;  1WGM A;  4YAB A;  2EGM A;  1WEM A;  4O64 A;  3N9L A;  4F1P A;  2DJA A;  1WEQ A;  5LKZ A;  2MD7 B;  4WZ3 B;  3C5K A;  2M6M A;  2ECJ A;  2EXU A;  2MD8 C;  3C6W A;  3QZV A;  1E4U A;  2KGG A;  1WEE A;  5SVI A;  1K2F A;  4QF2 A;  1WIM A;  1WIL A;  3FM8 C;  2P57 A;  2YHO A;  2DX8 A;  2ECW A;  3GL6 A;  4GNG A;  4Q6F A;  2RI7 A;  4QF3 A;  2F6N A;  2KKX A;  3LJU X;  3FL2 A;  2VJF B;  1DVP A;  5SVX A;  3ZPV 1;  1T1H A;  1BOR A;  2YHN A;  5H1U A;  2JMD A;  5DIN A;  1RMD A;  3T6R A;  3GV4 A;  2L5U A;  3EB6 A;  5B79 A;  5C13 A;  5G0F A;  3O33 A;  4I7C A;  4ZQL A;  5TDW A;  5TRB A;  2LDR A;  3HCU A;  1HYJ A;  3O37 A;  5H1T A;  1JOC A;  2C2L A;  3PHD A;  2KWK A;  3ASL A;  3DWD A;  3IHP A;  3MDB C;  3SHB A;  1MM3 A;  2KR4 A;  5SVY A;  5KH9 A;  3E2D A;  3KV6 A;  4MVT A;  3O34 A; 
#chains in the Genus database with same CATH homology
 2VPB A;  2YQL A;  5KH3 A;  3V43 A;  2LXH C;  2KFT A;  3L1X A;  4P5O B;  2YT5 A;  4AP4 A;  4NN2 A;  4A4C A;  2Y1M A;  5J3X A;  2YU4 A;  4WZ0 A;  4YAX A;  3M63 A;  3DPL R;  2IDA A;  1VFY A;  1CHC A;  1IYM A;  5B76 A;  5G04 B;  2YYR A;  3U5N A;  1WEO A;  4S3O B;  5LKX A;  2CKL B;  2FUU A;  4FO9 A;  4LKA A;  5G05 B;  2LGG A;  3HCS A;  3U5P A;  1JM7 B;  2NAA A;  2RSD A;  2LQ6 A;  3KNV A;  4L58 A;  1G25 A;  4W4U A;  4YC9 A;  4R7E A;  2LGL A;  2XEU A;  3DQV R;  4CA1 A;  4UI9 B;  4N3W A;  2L80 A;  1Z6U A;  5KH7 A;  2YUR A;  2D8S A;  2ECG A;  3SOW A;  3LRQ A;  2KE1 A;  4ZDT A;  2YQM A;  5JG6 A;  3MHS A;  3O35 A;  4FIP A;  4I7D A;  4YBT A;  4C9Z A;  5H9M A;  1U6G B;  3RPG C;  4A49 A;  4V3L C;  5I3L A;  5FB1 A;  2BAY A;  2CT2 A;  2KRE A;  5FEY A;  2M3H A;  2MA6 A;  5FB0 A;  2VJE B;  3KQI A;  4V3K C;  2C2V S;  4GND A;  3T7L A;  2VPG A;  4AVX A;  5DKA A;  1WEN A;  1ZBD B;  4XI1 A;  2YSM A;  2LXP C;  2VJF A;  2H0D B;  3LQH A;  3ZPV E;  2KWJ A;  3ZTG A;  4F52 B;  2G43 A;  5TBN A;  2ZET C;  3SOU A;  2JMJ A;  5TAB A;  4GNE A;  2ECN A;  5B8D A;  2AN6 A;  2E6S A;  2VP7 A;  1LDK C;  2VNF A;  4GNF A;  5LKT A;  2I50 A;  2L43 A;  3HCT A;  3I2D A;  3ZYQ A;  1WES A;  2K16 A;  3L11 A;  3LQI A;  2L75 A;  3ZVZ B;  2K4D A;  1WEU A;  3EB5 A;  4B86 C;  2PNX A;  2KWN A;  4AYC B;  1FBV A;  3VK6 A;  4GB0 A;  2YW8 A;  2CSZ A;  3NG2 A;  2ECT A;  3U5O A;  3RTR B;  4LJN A;  4WA6 A;  5EYA F;  2OXQ C;  2LGV A;  1X4I A;  2CSY A;  2UZG A;  1VD4 A;  2KWO A;  1XWH A;  5B78 A;  4R8P K;  4A0C D;  2EA6 A;  4N4F A;  5TDR A;  4AUQ B;  2HDP A;  2L0B A;  1LDJ B;  2CKL A;  1WEP A;  4PPE A;  2JRJ A;  2MA5 A;  4LAD B;  2F42 A;  2MT5 A;  5FER A;  4LK9 A;  5D1K B;  1JM7 A;  4UP5 A;  4YAD A;  1MM2 A;  3ZVY A;  3RPG B;  4PTB A;  2M85 A;  4ZUX U;  2KIZ A;  5B75 A;  5C11 A;  2MIQ A;  1F62 A;  3PUQ A;  3O7A A;  2K17 A;  2K1J A;  4CCG X;  5D1L B;  3KV5 A;  3MHH A;  1HYI A;  2FSA A;  2G6Q A;  2Y1N A;  4BHW A;  2EGP A;  4A4B A;  4FJC A;  2KYU A;  2LV9 A;  3N9P A;  4YBM A;  1N87 A;  2MNZ A;  4MSX A;  3O36 A;  3N9Q A;  2E6R A;  2VPD A;  4B7Y C;  4WZ2 A;  2Y43 A;  2MUM A;  2YSJ A;  4LLB A;  2VJE A;  1X4J A;  3N9M A;  2LN0 A;  3ZNI A;  4FK5 A;  4L7X A;  2ECI A;  3O70 A;  2FUI A;  1WEV A;  2H0D A;  3SOX A;  3PUR A;  1VYX A;  4X3G A;  3N9N A;  3L1Z B;  5LCW B;  2EOD A;  2QIC A;  4TKP B;  1V87 A;  4IC2 A;  2ECV A;  2JMI A;  4I7B A;  4IC3 A;  4YBS A;  4YAT A;  2LRI C;  3M99 A;  5H1V A;  5D1M B;  3LQJ A;  2HYE D;  5LKU A;  2KU3 A;  5AIT A;  3U5M A;  2LGK A;  2MNY A;  4S3O C;  1X4U A;  2VPE A;  4AYC A;  1WEW A;  1WFK A;  2YUC A;  2KGI A;  5AIU A;  1FP0 A;  1Z2Q A;  5B77 A;  1WE9 A;  3M62 A;  4UP0 A;  1Z60 A;  3HTK C;  2F6J A;  2M1R A;  2QJ0 A;  4R2Y A;  2YRE A;  2PUY A;  2QIZ A;  2XB1 A;  4BBQ A;  2G45 A;  3N9O A;  1WGM A;  4YAB A;  1WEM A;  4O64 A;  3N9L A;  1WEQ A;  5LKZ A;  2MD7 B;  4WZ3 B;  3C5K A;  2M6M A;  2ECJ A;  2MD8 C;  3C6W A;  3QZV A;  1E4U A;  2KGG A;  1WEE A;  1K2F A;  4QF2 A;  1WIM A;  1WIL A;  2YHO A;  2DX8 A;  2ECW A;  3GL6 A;  4GNG A;  4Q6F A;  2RI7 A;  4QF3 A;  2F6N A;  3FL2 A;  2VJF B;  1DVP A;  3ZPV 1;  1T1H A;  1BOR A;  2YHN A;  5H1U A;  2JMD A;  5DIN A;  1RMD A;  3T6R A;  3GV4 A;  2L5U A;  3EB6 A;  5B79 A;  5C13 A;  5G0F A;  3O33 A;  4I7C A;  4ZQL A;  5TDW A;  5TRB A;  2LDR A;  3HCU A;  1HYJ A;  3O37 A;  5H1T A;  1JOC A;  2C2L A;  3PHD A;  2KWK A;  3ASL A;  3IHP A;  3SHB A;  1MM3 A;  2KR4 A;  5KH9 A;  3KV6 A;  4MVT A;  3O34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...