2FUIA

Nmr solution structure of phd finger fragment of human bptf in free state
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fuiA00
1RMDA 3M62A 2F6JA 2YT5A 1LDKC 1V87A 5TBNA 2BAYA 2YSJA 5B75A 2IDAA 2ECGA 3O7AA 2LV9A 4YBSA 5TDWA 3RPGC 3I2DA 2PNXA 3U5PA 2ECTA 2M3HA 5JG6A 4PTBA 3N9MA 2CKLB 4AUQB 1IYMA 5C11A 2L75A 3FL2A 1FBVA 2YHNA 5DINA 3U5OA 2JRJA 1Z6UA 1WEQA 4LKAA 2MA5A 4LADB 2EODA 4Q6FA 2KE1A 2KIZA 4FIPA 1X4JA 3C6WA 3GL6A 3RPGB 2VPGA 5KH9A 5B78A 4ZUXU 4N4FA 2QICA 2LGVA 4WA6A 2K16A 2RI7A 2MD8C 4YBTA 2YW8A 1VYXA 2JMJA 1E4UA 1X4IA 2VJEA 1K2FA 4A4BA 5G0FA 2VPBA 3VK6A 3ZPV1 2L80A 2LN0A 4UP0A 5D1MB 2K17A 2KWNA 5KH3A 2FSAA 2F42A 2YYRA 5D1KB 1WEWA 1WFKA 4FO9A 2EA6A 2L0BA 2UZGA 2NAAA 4NN2A 1BORA 3LQIA 2M6MA 3SOWA 5B76A 2KWJA 2Y1MA 2ECWA 5FB0A 5FERA 4CA1A 5LKZA 5D1LB 3HCTA 5LKTA 4PPEA 2M85A 1WENA 2XB1A 2LGLA 2VNFA 2MNYA 2YSMA 3LQJA 5EYAF 5LKXA 3LRQA 4GNDA 2YURA 4GNGA 2L43A 4O64A 4IC2A 3MHHA 2I50A 5B79A 1MM2A 2E6SA 3O70A 4F52B 3RTRB 2H0DA 1WEMA 5H1VA 2ZETC 2MIQA 3KV6A 2G43A 4YADA 1Z60A 3T7LA 1JOCA 4BHWA 3KV5A 4MSXA 3N9NA 2LQ6A 4WZ0A 1HYJA 1VFYA 3O36A 4A49A 4YAXA 2ECVA 2MA6A 2YHOA 2KU3A 4R2YA 2VJEB 4IC3A 4QF3A 5FEYA 4B7YC 4GB0A 4BBQA 3SOUA 4YATA 3M63A 1MM3A 2KREA 3V43A 1WEUA 2YQLA 3ZVYA 2LRIC 5KH7A 1HYIA 1XWHA 4I7CA 4YBMA 2D8SA 4P5OB 2C2VS 5FB1A 5TABA 3DQVR 2OXQC 5J3XA 2KWKA 2YUCA 3ZTGA 3T6RA 5C13A 2KR4A 3PHDA 5G04B 1WESA 4X3GA 3N9OA 3KQIA 2FUUA 2Y1NA 4LLBA 3U5NA 2ECNA 4GNEA 5DKAA 3PUQA 5TRBA 5B77A 3IHPA 3O34A 2H0DB 5I3LA 2VP7A 4R7EA 2ECIA 4W4UA 4YC9A 4S3OC 3HCSA 4MVTA 2VPDA 5LCWB 1WEEA 4ZDTA 4FJCA 1JM7B 5H1UA 2C2LA 3U5MA 3ASLA 1VD4A 2KFTA 3L1ZB 4UI9B 3KNVA 3O35A 1ZBDB 1FP0A 1G25A 2CSYA 2MUMA 3DPLR 2LXHC 2LXPC 4A4CA 2KGGA 4S3OB 4TKPB 3L11A 1WEPA 2ECJA 3HTKC 2L5UA 3NG2A 3MHSA 4QF2A 4WZ2A 4V3KC 3SHBA 2CSZA 1DVPA 1WGMA 4A0CD 1JM7A 4ZQLA 3O33A 2LGKA 4LK9A 5TDRA 3GV4A 2VPEA 2XEUA 5B8DA 4N3WA 3HCUA 5AITA 2MT5A 2G6QA 2KYUA 4L58A 3N9PA 4R8PK 4YABA 3SOXA 3ZPVE 4AYCB 2K1JA 2CT2A 2E6RA 2JMIA 4XI1A 4GNFA 3M99A 2F6NA 2KWOA 1WEOA 2PUYA 1WILA 2JMDA 2Y43A 4I7BA 3QZVA 5H9MA 2CKLA 4V3LC 4AYCA 2VJFB 3O37A 1CHCA 1WIMA 2K4DA 3PURA 4WZ3B 2MD7B 2LDRA 3N9LA 2DX8A 2QJ0A 2KGIA 4CCGX 2MNZA 5G05B 4AP4A 1X4UA 4C9ZA 2HYED 2QIZA 2FUIA 1N87A 1F62A 1T1HA 2YU4A 2VJFA 4L7XA 4I7DA 3EB5A 2AN6A 5AIUA 1U6GB 4UP5A 2M1RA 3EB6A 5H1TA 3LQHA 1LDJB 2RSDA 2EGPA 2YQMA 4FK5A 2YREA 2HDPA 4AVXA 1Z2QA 4B86C 1WE9A 3ZYQA 3ZVZB 3L1XA 4LJNA 1WEVA 5LKUA 3N9QA 3ZNIA 2G45A 2LGGA 3C5KA
chains in the Genus database with same CATH superfamily
1RMDA 2EXUA 3M62A 2F6JA 2YT5A 1LDKC 5SVIA 1V87A 3PLWA 5TBNA 2BAYA 2YSJA 5B75A 2IDAA 2ECGA 4O62A 3O7AA 2LV9A 4YBSA 5TDWA 3RPGC 3I2DA 2PNXA 3U5PA 2ECTA 2M3HA 5JG6A 4PTBA 3N9MA 2M13A 2CKLB 4AUQB 1IYMA 5C11A 2L75A 3FL2A 1FBVA 2YHNA 5DINA 3U5OA 2JRJA 1Z6UA 1WEQA 4LKAA 2MA5A 4LADB 2EODA 4Q6FA 2KE1A 2XOCA 3E2DA 2KIZA 4FIPA 1X4JA 3C6WA 3GL6A 3RPGB 2VPGA 3DDTA 5KH9A 5B78A 4ZUXU 4N4FA 2QICA 3FJUB 2LGVA 4WA6A 2K16A 2RI7A 2MD8C 4YBTA 2YW8A 1VYXA 2B0OE 2JMJA 1E4UA 1X4IA 2VJEA 1K2FA 4A4BA 5G0FA 2VPBA 3VK6A 3ZPV1 2L80A 2LN0A 2OWAA 4UP0A 5D1MB 2K17A 2KWNA 2DJAA 5KH3A 2FSAA 2F42A 2YYRA 5D1KB 1WEWA 1WFKA 4FO9A 2EA6A 3FANA 2CRWA 2L0BA 2UZGA 2NAAA 2XOZA 4NN2A 1BORA 3LQIA 2M6MA 3SOWA 5B76A 2KWJA 2Y1MA 2ECWA 5FB0A 5FERA 4CA1A 5LKZA 5D1LB 3HCTA 5LKTA 4PPEA 2M85A 1WENA 2XB1A 2LGLA 2VNFA 2MNYA 2YSMA 3LQJA 5EYAF 4Z0RA 5LKXA 3LRQA 4GNDA 2YURA 3DWDA 2JM3A 4GNGA 2L43A 2FFWA 4O64A 4IC2A 3MHHA 2I50A 5B79A 1MM2A 2E6SA 3O70A 4F52B 3RTRB 2H0DA 1WEMA 5H1VA 3JUEA 4Z0OA 2ZETC 2MIQA 2RR4A 3KV6A 2G43A 4YADA 1Z60A 3T7LA 1JOCA 4BHWA 3KV5A 4MSXA 3N9NA 2LQ6A 4WZ0A 2KKYA 1HYJA 1VFYA 3O36A 4A49A 4YAXA 2ECVA 2MA6A 2YHOA 2KU3A 4R2YA 2VJEB 4IC3A 4QF3A 2D8UA 5FEYA 4B7YC 4GB0A 4BBQA 3SOUA 4YATA 3M63A 1DCQA 1MM3A 4OGCA 2KREA 3V43A 2P57A 1WEUA 2YQLA 3ZVYA 2LRIC 3T9KA 5KH7A 1HYIA 1XWHA 4I7CA 4YBMA 2D8SA 4P5OB 2C2VS 3M7KA 5FB1A 2IQJA 5TABA 3DQVR 2OXQC 5J3XA 2KWKA 2YUCA 5SVYA 3ZTGA 3T6RA 5C13A 2KR4A 3PHDA 5G04B 1WESA 4X3GA 3N9OA 3KQIA 2FUUA 2Y1NA 2XP0A 4LLBA 3U5NA 2ECNA 4GNEA 5DKAA 2JUNA 3PUQA 5TRBA 5B77A 3IHPA 3O34A 2H0DB 5I3LA 2VP7A 2CONA 4R7EA 3FEHA 2ECIA 4W4UA 4YC9A 4S3OC 3HCSA 4MVTA 2VPDA 2YVRA 5LCWB 1WEEA 4ZDTA 4FJCA 2KKXA 1JM7B 5H1UA 2C2LA 3U5MA 3ASLA 1VD4A 2KFTA 3L1ZB 4UI9B 3KNVA 3O35A 1ZBDB 1FP0A 2XOYA 1G25A 3FM8C 2CSYA 2MUMA 3DPLR 2LXHC 2LXPC 3FAOA 2L7PA 4A4CA 2KGGA 4S3OB 4TKPB 3L11A 1WEPA 2ECJA 3HTKC 2MKEA 2CRRA 2L5UA 3NG2A 3MHSA 4QF2A 4WZ2A 3LDYA 4V3KC 3SHBA 2CSZA 1DVPA 1WGMA 4A0CD 1JM7A 4ZQLA 3O33A 2LGKA 4LK9A 5TDRA 3SUBA 1MBMA 2EGMA 3GV4A 2VPEA 2XEUA 5B8DA 4N3WA 3HCUA 2MT5A 5AITA 2G6QA 2KYUA 4L58A 3N9PA 4R8PK 4YABA 3SOXA 3ZPVE 4AYCB 2K1JA 2CT2A 2E6RA 2JMIA 2E61A 4XI1A 4GNFA 3M99A 2F6NA 2KWOA 1WEOA 2PUYA 1WILA 2JMDA 2Y43A 4I7BA 4QQ4A 3QZVA 5H9MA 2CKLA 4V3LC 4AYCA 2VJFB 3LJUX 3O37A 1CHCA 1WIMA 3KDEC 2K4DA 3PURA 4WZ3B 2MD7B 2FD4A 2CSVA 2LDRA 3N9LA 3H7HA 2DX8A 2QJ0A 2KGIA 3O47A 4CCGX 2MNZA 5G05B 4AP4A 1X4UA 4C9ZA 2HYED 2QIZA 2FUIA 1N87A 1F62A 1T1HA 2LAUA 2YU4A 2VJFA 4F1PA 4L7XA 4I7DA 3EB5A 2AN6A 4OGEA 5AIUA 5K3QA 1U6GB 4UP5A 2M1RA 3EB6A 5H1TA 3LQHA 1LDJB 2RSDA 2EGPA 2YQMA 4FK5A 5SVIB 2DSMA 3LVQE 2YREA 2HDPA 4AVXA 1Z2QA 4B86C 1WE9A 3ZYQA 3ZVZB 3L1XA 4LJNA 1WEVA 5LKUA 5SVXA 3N9QA 3LVRE 3ZNIA 4H9DA 2G45A 3Q1DA 2LGGA 3MDBC 3C5KA
chains in the Genus database with same CATH topology
1RMDA 3M62A 2F6JA 2YT5A 1LDKC 1V87A 5TBNA 2BAYA 2YSJA 5B75A 2IDAA 2ECGA 3O7AA 2LV9A 4YBSA 5TDWA 3RPGC 3I2DA 2PNXA 3U5PA 2ECTA 2M3HA 5JG6A 4PTBA 3N9MA 2CKLB 4AUQB 1IYMA 5C11A 2L75A 3FL2A 1FBVA 2YHNA 5DINA 3U5OA 2JRJA 1Z6UA 1WEQA 4LKAA 2MA5A 4LADB 2EODA 4Q6FA 2KE1A 2KIZA 4FIPA 1X4JA 3C6WA 3GL6A 3RPGB 2VPGA 5KH9A 5B78A 4ZUXU 4N4FA 2QICA 2LGVA 4WA6A 2K16A 2RI7A 2MD8C 4YBTA 2YW8A 1VYXA 2JMJA 1E4UA 1X4IA 2VJEA 1K2FA 4A4BA 5G0FA 2VPBA 3VK6A 3ZPV1 2L80A 2LN0A 4UP0A 5D1MB 2K17A 2KWNA 5KH3A 2FSAA 2F42A 2YYRA 5D1KB 1WEWA 1WFKA 4FO9A 2EA6A 2L0BA 2UZGA 2NAAA 4NN2A 1BORA 3LQIA 2M6MA 3SOWA 5B76A 2KWJA 2Y1MA 2ECWA 5FB0A 5FERA 4CA1A 5LKZA 5D1LB 3HCTA 5LKTA 4PPEA 2M85A 1WENA 2XB1A 2LGLA 2VNFA 2MNYA 2YSMA 3LQJA 5EYAF 5LKXA 3LRQA 4GNDA 2YURA 4GNGA 2L43A 4O64A 4IC2A 3MHHA 2I50A 5B79A 1MM2A 2E6SA 3O70A 4F52B 3RTRB 2H0DA 1WEMA 5H1VA 2ZETC 2MIQA 3KV6A 2G43A 4YADA 1Z60A 3T7LA 1JOCA 4BHWA 3KV5A 4MSXA 3N9NA 2LQ6A 4WZ0A 1HYJA 1VFYA 3O36A 4A49A 4YAXA 2ECVA 2MA6A 2YHOA 2KU3A 4R2YA 2VJEB 4IC3A 4QF3A 5FEYA 4B7YC 4GB0A 4BBQA 3SOUA 4YATA 3M63A 1MM3A 2KREA 3V43A 1WEUA 2YQLA 3ZVYA 2LRIC 5KH7A 1HYIA 1XWHA 4I7CA 4YBMA 2D8SA 4P5OB 2C2VS 5FB1A 5TABA 3DQVR 2OXQC 5J3XA 2KWKA 2YUCA 3ZTGA 3T6RA 5C13A 2KR4A 3PHDA 5G04B 1WESA 4X3GA 3N9OA 3KQIA 2FUUA 2Y1NA 4LLBA 3U5NA 2ECNA 4GNEA 5DKAA 3PUQA 5TRBA 5B77A 3IHPA 3O34A 2H0DB 5I3LA 2VP7A 4R7EA 2ECIA 4W4UA 4YC9A 4S3OC 3HCSA 4MVTA 2VPDA 5LCWB 1WEEA 4ZDTA 4FJCA 1JM7B 5H1UA 2C2LA 3U5MA 3ASLA 1VD4A 2KFTA 3L1ZB 4UI9B 3KNVA 3O35A 1ZBDB 1FP0A 1G25A 2CSYA 2MUMA 3DPLR 2LXHC 2LXPC 4A4CA 2KGGA 4S3OB 4TKPB 3L11A 1WEPA 2ECJA 3HTKC 2L5UA 3NG2A 3MHSA 4QF2A 4WZ2A 4V3KC 3SHBA 2CSZA 1DVPA 1WGMA 4A0CD 1JM7A 4ZQLA 3O33A 2LGKA 4LK9A 5TDRA 3GV4A 2VPEA 2XEUA 5B8DA 4N3WA 3HCUA 5AITA 2MT5A 2G6QA 2KYUA 4L58A 3N9PA 4R8PK 4YABA 3SOXA 3ZPVE 4AYCB 2K1JA 2CT2A 2E6RA 2JMIA 4XI1A 4GNFA 3M99A 2F6NA 2KWOA 1WEOA 2PUYA 1WILA 2JMDA 2Y43A 4I7BA 3QZVA 5H9MA 2CKLA 4V3LC 4AYCA 2VJFB 3O37A 1CHCA 1WIMA 2K4DA 3PURA 4WZ3B 2MD7B 2LDRA 3N9LA 2DX8A 2QJ0A 2KGIA 4CCGX 2MNZA 5G05B 4AP4A 1X4UA 4C9ZA 2HYED 2QIZA 2FUIA 1N87A 1F62A 1T1HA 2YU4A 2VJFA 4L7XA 4I7DA 3EB5A 2AN6A 5AIUA 1U6GB 4UP5A 2M1RA 3EB6A 5H1TA 3LQHA 1LDJB 2RSDA 2EGPA 2YQMA 4FK5A 2YREA 2HDPA 4AVXA 1Z2QA 4B86C 1WE9A 3ZYQA 3ZVZB 3L1XA 4LJNA 1WEVA 5LKUA 3N9QA 3ZNIA 2G45A 2LGGA 3C5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMD A;  3M62 A;  2F6J A;  2YT5 A;  1LDK C;  1V87 A;  5TBN A;  2BAY A;  2YSJ A;  5B75 A;  2IDA A;  2ECG A;  3O7A A;  2LV9 A;  4YBS A;  5TDW A;  3RPG C;  3I2D A;  2PNX A;  3U5P A;  2ECT A;  2M3H A;  5JG6 A;  4PTB A;  3N9M A;  2CKL B;  4AUQ B;  1IYM A;  5C11 A;  2L75 A;  3FL2 A;  1FBV A;  2YHN A;  5DIN A;  3U5O A;  2JRJ A;  1Z6U A;  1WEQ A;  4LKA A;  2MA5 A;  4LAD B;  2EOD A;  4Q6F A;  2KE1 A;  2KIZ A;  4FIP A;  1X4J A;  3C6W A;  3GL6 A;  3RPG B;  2VPG A;  5KH9 A;  5B78 A;  4ZUX U;  4N4F A;  2QIC A;  2LGV A;  4WA6 A;  2K16 A;  2RI7 A;  2MD8 C;  4YBT A;  2YW8 A;  1VYX A;  2JMJ A;  1E4U A;  1X4I A;  2VJE A;  1K2F A;  4A4B A;  5G0F A;  2VPB A;  3VK6 A;  3ZPV 1;  2L80 A;  2LN0 A;  4UP0 A;  5D1M B;  2K17 A;  2KWN A;  5KH3 A;  2FSA A;  2F42 A;  2YYR A;  5D1K B;  1WEW A;  1WFK A;  4FO9 A;  2EA6 A;  2L0B A;  2UZG A;  2NAA A;  4NN2 A;  1BOR A;  3LQI A;  2M6M A;  3SOW A;  5B76 A;  2KWJ A;  2Y1M A;  2ECW A;  5FB0 A;  5FER A;  4CA1 A;  5LKZ A;  5D1L B;  3HCT A;  5LKT A;  4PPE A;  2M85 A;  1WEN A;  2XB1 A;  2LGL A;  2VNF A;  2MNY A;  2YSM A;  3LQJ A;  5EYA F;  5LKX A;  3LRQ A;  4GND A;  2YUR A;  4GNG A;  2L43 A;  4O64 A;  4IC2 A;  3MHH A;  2I50 A;  5B79 A;  1MM2 A;  2E6S A;  3O70 A;  4F52 B;  3RTR B;  2H0D A;  1WEM A;  5H1V A;  2ZET C;  2MIQ A;  3KV6 A;  2G43 A;  4YAD A;  1Z60 A;  3T7L A;  1JOC A;  4BHW A;  3KV5 A;  4MSX A;  3N9N A;  2LQ6 A;  4WZ0 A;  1HYJ A;  1VFY A;  3O36 A;  4A49 A;  4YAX A;  2ECV A;  2MA6 A;  2YHO A;  2KU3 A;  4R2Y A;  2VJE B;  4IC3 A;  4QF3 A;  5FEY A;  4B7Y C;  4GB0 A;  4BBQ A;  3SOU A;  4YAT A;  3M63 A;  1MM3 A;  2KRE A;  3V43 A;  1WEU A;  2YQL A;  3ZVY A;  2LRI C;  5KH7 A;  1HYI A;  1XWH A;  4I7C A;  4YBM A;  2D8S A;  4P5O B;  2C2V S;  5FB1 A;  5TAB A;  3DQV R;  2OXQ C;  5J3X A;  2KWK A;  2YUC A;  3ZTG A;  3T6R A;  5C13 A;  2KR4 A;  3PHD A;  5G04 B;  1WES A;  4X3G A;  3N9O A;  3KQI A;  2FUU A;  2Y1N A;  4LLB A;  3U5N A;  2ECN A;  4GNE A;  5DKA A;  3PUQ A;  5TRB A;  5B77 A;  3IHP A;  3O34 A;  2H0D B;  5I3L A;  2VP7 A;  4R7E A;  2ECI A;  4W4U A;  4YC9 A;  4S3O C;  3HCS A;  4MVT A;  2VPD A;  5LCW B;  1WEE A;  4ZDT A;  4FJC A;  1JM7 B;  5H1U A;  2C2L A;  3U5M A;  3ASL A;  1VD4 A;  2KFT A;  3L1Z B;  4UI9 B;  3KNV A;  3O35 A;  1ZBD B;  1FP0 A;  1G25 A;  2CSY A;  2MUM A;  3DPL R;  2LXH C;  2LXP C;  4A4C A;  2KGG A;  4S3O B;  4TKP B;  3L11 A;  1WEP A;  2ECJ A;  3HTK C;  2L5U A;  3NG2 A;  3MHS A;  4QF2 A;  4WZ2 A;  4V3K C;  3SHB A;  2CSZ A;  1DVP A;  1WGM A;  4A0C D;  1JM7 A;  4ZQL A;  3O33 A;  2LGK A;  4LK9 A;  5TDR A;  3GV4 A;  2VPE A;  2XEU A;  5B8D A;  4N3W A;  3HCU A;  5AIT A;  2MT5 A;  2G6Q A;  2KYU A;  4L58 A;  3N9P A;  4R8P K;  4YAB A;  3SOX A;  3ZPV E;  4AYC B;  2K1J A;  2CT2 A;  2E6R A;  2JMI A;  4XI1 A;  4GNF A;  3M99 A;  2F6N A;  2KWO A;  1WEO A;  2PUY A;  1WIL A;  2JMD A;  2Y43 A;  4I7B A;  3QZV A;  5H9M A;  2CKL A;  4V3L C;  4AYC A;  2VJF B;  3O37 A;  1CHC A;  1WIM A;  2K4D A;  3PUR A;  4WZ3 B;  2MD7 B;  2LDR A;  3N9L A;  2DX8 A;  2QJ0 A;  2KGI A;  4CCG X;  2MNZ A;  5G05 B;  4AP4 A;  1X4U A;  4C9Z A;  2HYE D;  2QIZ A;  2FUI A;  1N87 A;  1F62 A;  1T1H A;  2YU4 A;  2VJF A;  4L7X A;  4I7D A;  3EB5 A;  2AN6 A;  5AIU A;  1U6G B;  4UP5 A;  2M1R A;  3EB6 A;  5H1T A;  3LQH A;  1LDJ B;  2RSD A;  2EGP A;  2YQM A;  4FK5 A;  2YRE A;  2HDP A;  4AVX A;  1Z2Q A;  4B86 C;  1WE9 A;  3ZYQ A;  3ZVZ B;  3L1X A;  4LJN A;  1WEV A;  5LKU A;  3N9Q A;  3ZNI A;  2G45 A;  2LGG A;  3C5K A; 
#chains in the Genus database with same CATH topology
 1RMD A;  2EXU A;  3M62 A;  2F6J A;  2YT5 A;  1LDK C;  5SVI A;  1V87 A;  3PLW A;  5TBN A;  2BAY A;  2YSJ A;  5B75 A;  2IDA A;  2ECG A;  4O62 A;  3O7A A;  2LV9 A;  4YBS A;  5TDW A;  3RPG C;  3I2D A;  2PNX A;  3U5P A;  2ECT A;  2M3H A;  5JG6 A;  4PTB A;  3N9M A;  2M13 A;  2CKL B;  4AUQ B;  1IYM A;  5C11 A;  2L75 A;  3FL2 A;  1FBV A;  2YHN A;  5DIN A;  3U5O A;  2JRJ A;  1Z6U A;  1WEQ A;  4LKA A;  2MA5 A;  4LAD B;  2EOD A;  4Q6F A;  2KE1 A;  2XOC A;  3E2D A;  2KIZ A;  4FIP A;  1X4J A;  3C6W A;  3GL6 A;  3RPG B;  2VPG A;  3DDT A;  5KH9 A;  5B78 A;  4ZUX U;  4N4F A;  2QIC A;  3FJU B;  2LGV A;  4WA6 A;  2K16 A;  2RI7 A;  2MD8 C;  4YBT A;  2YW8 A;  1VYX A;  2B0O E;  2JMJ A;  1E4U A;  1X4I A;  2VJE A;  1K2F A;  4A4B A;  5G0F A;  2VPB A;  3VK6 A;  3ZPV 1;  2L80 A;  2LN0 A;  2OWA A;  4UP0 A;  5D1M B;  2K17 A;  2KWN A;  2DJA A;  5KH3 A;  2FSA A;  2F42 A;  2YYR A;  5D1K B;  1WEW A;  1WFK A;  4FO9 A;  2EA6 A;  3FAN A;  2CRW A;  2L0B A;  2UZG A;  2NAA A;  2XOZ A;  4NN2 A;  1BOR A;  3LQI A;  2M6M A;  3SOW A;  5B76 A;  2KWJ A;  2Y1M A;  2ECW A;  5FB0 A;  5FER A;  4CA1 A;  5LKZ A;  5D1L B;  3HCT A;  5LKT A;  4PPE A;  2M85 A;  1WEN A;  2XB1 A;  2LGL A;  2VNF A;  2MNY A;  2YSM A;  3LQJ A;  5EYA F;  4Z0R A;  5LKX A;  3LRQ A;  4GND A;  2YUR A;  3DWD A;  2JM3 A;  4GNG A;  2L43 A;  2FFW A;  4O64 A;  4IC2 A;  3MHH A;  2I50 A;  5B79 A;  1MM2 A;  2E6S A;  3O70 A;  4F52 B;  3RTR B;  2H0D A;  1WEM A;  5H1V A;  3JUE A;  4Z0O A;  2ZET C;  2MIQ A;  2RR4 A;  3KV6 A;  2G43 A;  4YAD A;  1Z60 A;  3T7L A;  1JOC A;  4BHW A;  3KV5 A;  4MSX A;  3N9N A;  2LQ6 A;  4WZ0 A;  2KKY A;  1HYJ A;  1VFY A;  3O36 A;  4A49 A;  4YAX A;  2ECV A;  2MA6 A;  2YHO A;  2KU3 A;  4R2Y A;  2VJE B;  4IC3 A;  4QF3 A;  2D8U A;  5FEY A;  4B7Y C;  4GB0 A;  4BBQ A;  3SOU A;  4YAT A;  3M63 A;  1DCQ A;  1MM3 A;  4OGC A;  2KRE A;  3V43 A;  2P57 A;  1WEU A;  2YQL A;  3ZVY A;  2LRI C;  3T9K A;  5KH7 A;  1HYI A;  1XWH A;  4I7C A;  4YBM A;  2D8S A;  4P5O B;  2C2V S;  3M7K A;  5FB1 A;  2IQJ A;  5TAB A;  3DQV R;  2OXQ C;  5J3X A;  2KWK A;  2YUC A;  5SVY A;  3ZTG A;  3T6R A;  5C13 A;  2KR4 A;  3PHD A;  5G04 B;  1WES A;  4X3G A;  3N9O A;  3KQI A;  2FUU A;  2Y1N A;  2XP0 A;  4LLB A;  3U5N A;  2ECN A;  4GNE A;  5DKA A;  2JUN A;  3PUQ A;  5TRB A;  5B77 A;  3IHP A;  3O34 A;  2H0D B;  5I3L A;  2VP7 A;  2CON A;  4R7E A;  3FEH A;  2ECI A;  4W4U A;  4YC9 A;  4S3O C;  3HCS A;  4MVT A;  2VPD A;  2YVR A;  5LCW B;  1WEE A;  4ZDT A;  4FJC A;  2KKX A;  1JM7 B;  5H1U A;  2C2L A;  3U5M A;  3ASL A;  1VD4 A;  2KFT A;  3L1Z B;  4UI9 B;  3KNV A;  3O35 A;  1ZBD B;  1FP0 A;  2XOY A;  1G25 A;  3FM8 C;  2CSY A;  2MUM A;  3DPL R;  2LXH C;  2LXP C;  3FAO A;  2L7P A;  4A4C A;  2KGG A;  4S3O B;  4TKP B;  3L11 A;  1WEP A;  2ECJ A;  3HTK C;  2MKE A;  2CRR A;  2L5U A;  3NG2 A;  3MHS A;  4QF2 A;  4WZ2 A;  3LDY A;  4V3K C;  3SHB A;  2CSZ A;  1DVP A;  1WGM A;  4A0C D;  1JM7 A;  4ZQL A;  3O33 A;  2LGK A;  4LK9 A;  5TDR A;  3SUB A;  1MBM A;  2EGM A;  3GV4 A;  2VPE A;  2XEU A;  5B8D A;  4N3W A;  3HCU A;  2MT5 A;  5AIT A;  2G6Q A;  2KYU A;  4L58 A;  3N9P A;  4R8P K;  4YAB A;  3SOX A;  3ZPV E;  4AYC B;  2K1J A;  2CT2 A;  2E6R A;  2JMI A;  2E61 A;  4XI1 A;  4GNF A;  3M99 A;  2F6N A;  2KWO A;  1WEO A;  2PUY A;  1WIL A;  2JMD A;  2Y43 A;  4I7B A;  4QQ4 A;  3QZV A;  5H9M A;  2CKL A;  4V3L C;  4AYC A;  2VJF B;  3LJU X;  3O37 A;  1CHC A;  1WIM A;  3KDE C;  2K4D A;  3PUR A;  4WZ3 B;  2MD7 B;  2FD4 A;  2CSV A;  2LDR A;  3N9L A;  3H7H A;  2DX8 A;  2QJ0 A;  2KGI A;  3O47 A;  4CCG X;  2MNZ A;  5G05 B;  4AP4 A;  1X4U A;  4C9Z A;  2HYE D;  2QIZ A;  2FUI A;  1N87 A;  1F62 A;  1T1H A;  2LAU A;  2YU4 A;  2VJF A;  4F1P A;  4L7X A;  4I7D A;  3EB5 A;  2AN6 A;  4OGE A;  5AIU A;  5K3Q A;  1U6G B;  4UP5 A;  2M1R A;  3EB6 A;  5H1T A;  3LQH A;  1LDJ B;  2RSD A;  2EGP A;  2YQM A;  4FK5 A;  5SVI B;  2DSM A;  3LVQ E;  2YRE A;  2HDP A;  4AVX A;  1Z2Q A;  4B86 C;  1WE9 A;  3ZYQ A;  3ZVZ B;  3L1X A;  4LJN A;  1WEV A;  5LKU A;  5SVX A;  3N9Q A;  3LVR E;  3ZNI A;  4H9D A;  2G45 A;  3Q1D A;  2LGG A;  3MDB C;  3C5K A; 
#chains in the Genus database with same CATH homology
 1RMD A;  3M62 A;  2F6J A;  2YT5 A;  1LDK C;  1V87 A;  5TBN A;  2BAY A;  2YSJ A;  5B75 A;  2IDA A;  2ECG A;  3O7A A;  2LV9 A;  4YBS A;  5TDW A;  3RPG C;  3I2D A;  2PNX A;  3U5P A;  2ECT A;  2M3H A;  5JG6 A;  4PTB A;  3N9M A;  2CKL B;  4AUQ B;  1IYM A;  5C11 A;  2L75 A;  3FL2 A;  1FBV A;  2YHN A;  5DIN A;  3U5O A;  2JRJ A;  1Z6U A;  1WEQ A;  4LKA A;  2MA5 A;  4LAD B;  2EOD A;  4Q6F A;  2KE1 A;  2KIZ A;  4FIP A;  1X4J A;  3C6W A;  3GL6 A;  3RPG B;  2VPG A;  5KH9 A;  5B78 A;  4ZUX U;  4N4F A;  2QIC A;  2LGV A;  4WA6 A;  2K16 A;  2RI7 A;  2MD8 C;  4YBT A;  2YW8 A;  1VYX A;  2JMJ A;  1E4U A;  1X4I A;  2VJE A;  1K2F A;  4A4B A;  5G0F A;  2VPB A;  3VK6 A;  3ZPV 1;  2L80 A;  2LN0 A;  4UP0 A;  5D1M B;  2K17 A;  2KWN A;  5KH3 A;  2FSA A;  2F42 A;  2YYR A;  5D1K B;  1WEW A;  1WFK A;  4FO9 A;  2EA6 A;  2L0B A;  2UZG A;  2NAA A;  4NN2 A;  1BOR A;  3LQI A;  2M6M A;  3SOW A;  5B76 A;  2KWJ A;  2Y1M A;  2ECW A;  5FB0 A;  5FER A;  4CA1 A;  5LKZ A;  5D1L B;  3HCT A;  5LKT A;  4PPE A;  2M85 A;  1WEN A;  2XB1 A;  2LGL A;  2VNF A;  2MNY A;  2YSM A;  3LQJ A;  5EYA F;  5LKX A;  3LRQ A;  4GND A;  2YUR A;  4GNG A;  2L43 A;  4O64 A;  4IC2 A;  3MHH A;  2I50 A;  5B79 A;  1MM2 A;  2E6S A;  3O70 A;  4F52 B;  3RTR B;  2H0D A;  1WEM A;  5H1V A;  2ZET C;  2MIQ A;  3KV6 A;  2G43 A;  4YAD A;  1Z60 A;  3T7L A;  1JOC A;  4BHW A;  3KV5 A;  4MSX A;  3N9N A;  2LQ6 A;  4WZ0 A;  1HYJ A;  1VFY A;  3O36 A;  4A49 A;  4YAX A;  2ECV A;  2MA6 A;  2YHO A;  2KU3 A;  4R2Y A;  2VJE B;  4IC3 A;  4QF3 A;  5FEY A;  4B7Y C;  4GB0 A;  4BBQ A;  3SOU A;  4YAT A;  3M63 A;  1MM3 A;  2KRE A;  3V43 A;  1WEU A;  2YQL A;  3ZVY A;  2LRI C;  5KH7 A;  1HYI A;  1XWH A;  4I7C A;  4YBM A;  2D8S A;  4P5O B;  2C2V S;  5FB1 A;  5TAB A;  3DQV R;  2OXQ C;  5J3X A;  2KWK A;  2YUC A;  3ZTG A;  3T6R A;  5C13 A;  2KR4 A;  3PHD A;  5G04 B;  1WES A;  4X3G A;  3N9O A;  3KQI A;  2FUU A;  2Y1N A;  4LLB A;  3U5N A;  2ECN A;  4GNE A;  5DKA A;  3PUQ A;  5TRB A;  5B77 A;  3IHP A;  3O34 A;  2H0D B;  5I3L A;  2VP7 A;  4R7E A;  2ECI A;  4W4U A;  4YC9 A;  4S3O C;  3HCS A;  4MVT A;  2VPD A;  5LCW B;  1WEE A;  4ZDT A;  4FJC A;  1JM7 B;  5H1U A;  2C2L A;  3U5M A;  3ASL A;  1VD4 A;  2KFT A;  3L1Z B;  4UI9 B;  3KNV A;  3O35 A;  1ZBD B;  1FP0 A;  1G25 A;  2CSY A;  2MUM A;  3DPL R;  2LXH C;  2LXP C;  4A4C A;  2KGG A;  4S3O B;  4TKP B;  3L11 A;  1WEP A;  2ECJ A;  3HTK C;  2L5U A;  3NG2 A;  3MHS A;  4QF2 A;  4WZ2 A;  4V3K C;  3SHB A;  2CSZ A;  1DVP A;  1WGM A;  4A0C D;  1JM7 A;  4ZQL A;  3O33 A;  2LGK A;  4LK9 A;  5TDR A;  3GV4 A;  2VPE A;  2XEU A;  5B8D A;  4N3W A;  3HCU A;  5AIT A;  2MT5 A;  2G6Q A;  2KYU A;  4L58 A;  3N9P A;  4R8P K;  4YAB A;  3SOX A;  3ZPV E;  4AYC B;  2K1J A;  2CT2 A;  2E6R A;  2JMI A;  4XI1 A;  4GNF A;  3M99 A;  2F6N A;  2KWO A;  1WEO A;  2PUY A;  1WIL A;  2JMD A;  2Y43 A;  4I7B A;  3QZV A;  5H9M A;  2CKL A;  4V3L C;  4AYC A;  2VJF B;  3O37 A;  1CHC A;  1WIM A;  2K4D A;  3PUR A;  4WZ3 B;  2MD7 B;  2LDR A;  3N9L A;  2DX8 A;  2QJ0 A;  2KGI A;  4CCG X;  2MNZ A;  5G05 B;  4AP4 A;  1X4U A;  4C9Z A;  2HYE D;  2QIZ A;  2FUI A;  1N87 A;  1F62 A;  1T1H A;  2YU4 A;  2VJF A;  4L7X A;  4I7D A;  3EB5 A;  2AN6 A;  5AIU A;  1U6G B;  4UP5 A;  2M1R A;  3EB6 A;  5H1T A;  3LQH A;  1LDJ B;  2RSD A;  2EGP A;  2YQM A;  4FK5 A;  2YRE A;  2HDP A;  4AVX A;  1Z2Q A;  4B86 C;  1WE9 A;  3ZYQ A;  3ZVZ B;  3L1X A;  4LJN A;  1WEV A;  5LKU A;  3N9Q A;  3ZNI A;  2G45 A;  2LGG A;  3C5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...