2FUIA

Nmr solution structure of phd finger fragment of human bptf in free state
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fuiA00
3ZPVE 5LCWB 3U5NA 2UZGA 4A4CA 2CKLB 2L0BA 2KWOA 3C6WA 3GV4A 2Y1MA 2D8SA 2G43A 4V3KC 4S3OC 4GNDA 4A4BA 2YHOA 2YUCA 2MA5A 2KYUA 5I3LA 5DKAA 3ZYQA 5KH3A 1F62A 4AYCB 2VPBA 2PNXA 3LQJA 2ECJA 2L5UA 4B86C 1JOCA 3LQHA 3ZPV1 4GB0A 5H9MA 1G25A 5DINA 4IC3A 4TKPB 4V3LC 2HDPA 1Z6UA 4X3GA 5D1KB 2VJEA 5B75A 5B76A 3PURA 5TDRA 2C2LA 4R2YA 4WZ3B 2LGGA 2H0DB 4QF3A 4P5OB 4L7XA 3KNVA 3EB5A 3EB6A 2F6JA 2C2VS 1FBVA 1LDJB 2JMIA 2K4DA 2PUYA 2L80A 4PTBA 2EODA 4W4UA 2ECNA 2MT5A 1HYIA 2RI7A 3ZTGA 3O33A 3O70A 3PHDA 5C11A 2YW8A 2LGLA 1WEOA 2VJFB 4LADB 5KH9A 5FB0A 2KWJA 1K2FA 2K17A 4YC9A 3M62A 4MVTA 4FO9A 5AIUA 2E6RA 2KE1A 1FP0A 4B7YC 2ECTA 2MD7B 1WEUA 3RPGB 3DQVR 4YBMA 2KFTA 2MNYA 4A0CD 2EGPA 3VK6A 1JM7A 2LN0A 4AVXA 2DX8A 5D1MB 4N3WA 3FL2A 2ECVA 3KV6A 2YSJA 3N9OA 2ECIA 4CA1A 1WILA 4R8PK 2QJ0A 2IDAA 2YQLA 2AN6A 1X4UA 1VFYA 5EYAF 4Q6FA 2KR4A 5LKUA 1IYMA 2RSDA 5G05B 4YADA 5H1VA 2ZETC 5C13A 2Y1NA 2YYRA 3ZNIA 2LXPC 4AYCA 5D1LB 1V87A 5LKTA 4QF2A 3SOXA 3O35A 5FB1A 4WZ2A 2F42A 4AUQB 2MIQA 5B77A 4LLBA 5G04B 5TBNA 3HCSA 3KQIA 2KGGA 3ZVYA 2OXQC 2KWNA 5B8DA 2H0DA 1WEQA 2K16A 2M1RA 2M6MA 4UI9B 3ZVZB 3M63A 2MD8C 2JMJA 4R7EA 1WFKA 3I2DA 2YQMA 4XI1A 5FERA 2FUIA 3V43A 1WEVA 2LGVA 2LRIC 4A49A 2YURA 4L58A 1WE9A 2LGKA 2VJFA 3HCTA 1U6GB 3PUQA 4YBTA 3QZVA 4PPEA 3C5KA 4I7BA 2EA6A 3IHPA 5TRBA 4BHWA 3L1ZB 2HYED 4YATA 4YABA 3O34A 2VPGA 5AITA 4FK5A 1N87A 3RTRB 1DVPA 3SHBA 3HCUA 4O64A 3SOWA 2VPEA 3U5OA 2XB1A 2LXHC 4BBQA 4GNFA 1VYXA 4YAXA 1BORA 2VNFA 4GNGA 3RPGC 4AP4A 1WENA 2QICA 2CKLA 2G45A 1WEPA 5LKZA 5TDWA 1WEMA 4S3OB 4IC2A 2KGIA 3N9LA 2YHNA 5TABA 1Z60A 3U5MA 3ASLA 2G6QA 4FIPA 3L1XA 5B79A 3T6RA 1WGMA 1Z2QA 2YT5A 2YU4A 3HTKC 3U5PA 2NAAA 3LRQA 3LQIA 2M3HA 4C9ZA 5LKXA 2BAYA 3M99A 4N4FA 4NN2A 2FSAA 3MHSA 4FJCA 5H1TA 4I7DA 2F6NA 5H1UA 4F52B 4I7CA 1RMDA 3L11A 5G0FA 3N9PA 2MUMA 2K1JA 4UP5A 2XEUA 4LKAA 5B78A 2ECWA 2VJEB 4UP0A 2JMDA 3MHHA 2KWKA 3O7AA 5JG6A 2YSMA 5KH7A 2CSZA 2L75A 4LK9A 1T1HA 2VP7A 1WIMA 4WZ0A 3KV5A 2QIZA 3N9QA 4ZDTA 2LQ6A 1X4JA 3NG2A 2LV9A 1MM3A 3O36A 2Y43A 1LDKC 2YREA 2VPDA 3GL6A 5FEYA 1WESA 3DPLR 1MM2A 2KU3A 4ZQLA 3SOUA 2CSYA 2JRJA 2E6SA 4GNEA 2MA6A 1XWHA 2LDRA 4YBSA 2FUUA 4LJNA 1E4UA 1ZBDB 1WEEA 5J3XA 3O37A 2KREA 3T7LA 4WA6A 1JM7B 2MNZA 2I50A 2KIZA 1VD4A 4CCGX 3N9NA 2L43A 2ECGA 2CT2A 3N9MA 2M85A 4MSXA 1CHCA 1X4IA 1HYJA 1WEWA 4ZUXU
chains in the Genus database with same CATH superfamily
3ZPVE 5LCWB 3U5NA 2P57A 2UZGA 4A4CA 2CKLB 2L0BA 2KWOA 4H9DA 3C6WA 3GV4A 2Y1MA 3FJUB 2D8SA 2G43A 4V3KC 4S3OC 4GNDA 4A4BA 2YHOA 2YUCA 2MA5A 2KYUA 5I3LA 5DKAA 3ZYQA 5KH3A 1F62A 4AYCB 2VPBA 2B0OE 2PNXA 3LQJA 2ECJA 2L5UA 4B86C 1JOCA 3LQHA 3ZPV1 4O62A 2OWAA 4GB0A 5H9MA 1G25A 5DINA 4IC3A 2XOYA 4TKPB 4V3LC 2HDPA 1Z6UA 4X3GA 5D1KB 2VJEA 5B75A 5B76A 2CSVA 2DJAA 3PURA 2FFWA 5TDRA 2C2LA 4R2YA 3FM8C 4WZ3B 2LGGA 2H0DB 4QF3A 3Q1DA 3SUBA 4P5OB 4L7XA 3KNVA 2RR4A 3EB5A 4Z0RA 3EB6A 2F6JA 2C2VS 1FBVA 1LDJB 2JMIA 2K4DA 2PUYA 2L80A 4PTBA 2EODA 4W4UA 2ECNA 2MT5A 3M7KA 2RI7A 1HYIA 3ZTGA 3O33A 3O70A 3PHDA 5C11A 2YW8A 2LGLA 1WEOA 2VJFB 4LADB 5KH9A 5FB0A 2KWJA 2JUNA 1K2FA 3LVQE 2K17A 4YC9A 3M62A 2L7PA 4MVTA 2LAUA 4FO9A 5AIUA 2E6RA 2KE1A 2XOZA 5SVIB 1FP0A 4B7YC 2ECTA 2MD7B 1WEUA 3RPGB 3DQVR 4YBMA 2KFTA 2MNYA 4A0CD 4QQ4A 2EGPA 4Z0OA 3VK6A 1JM7A 2LN0A 4AVXA 2DX8A 5D1MB 4N3WA 3FL2A 2ECVA 3KV6A 2YSJA 3N9OA 2ECIA 4CA1A 1WILA 2E61A 4R8PK 3LVRE 2QJ0A 2IDAA 2YQLA 2AN6A 1X4UA 1VFYA 5EYAF 4Q6FA 2KR4A 3JUEA 5LKUA 1IYMA 2RSDA 5G05B 4YADA 3DDTA 5H1VA 5K3QA 2ZETC 5C13A 2Y1NA 2YYRA 3ZNIA 2LXPC 4AYCA 2IQJA 5D1LB 3H7HA 1V87A 2CRWA 2CRRA 5LKTA 4QF2A 3SOXA 3O35A 5FB1A 4WZ2A 2F42A 4AUQB 2MIQA 5B77A 4OGCA 2CONA 4LLBA 2MKEA 5G04B 5TBNA 3HCSA 3KQIA 2KGGA 3ZVYA 2OXQC 2KWNA 5B8DA 2H0DA 1WEQA 2K16A 2M1RA 2M6MA 4UI9B 2D8UA 5SVYA 3ZVZB 3M63A 2MD8C 2JMJA 4R7EA 1WFKA 3I2DA 2YQMA 4XI1A 5FERA 2FUIA 3V43A 1WEVA 2LGVA 4OGEA 2LRIC 4A49A 2YURA 4L58A 1WE9A 2LGKA 2VJFA 3HCTA 1U6GB 3PUQA 4YBTA 1DCQA 3QZVA 4PPEA 3C5KA 4I7BA 2EA6A 3IHPA 5TRBA 4BHWA 3L1ZB 2HYED 3E2DA 4YATA 2M13A 4YABA 3O34A 2VPGA 5SVIA 2EXUA 5AITA 4FK5A 1N87A 3RTRB 1DVPA 3SHBA 3HCUA 4O64A 2KKYA 3FANA 2FD4A 3SOWA 2VPEA 3U5OA 2XB1A 2LXHC 4BBQA 4GNFA 1VYXA 4YAXA 3O47A 1BORA 2VNFA 4GNGA 3RPGC 1MBMA 1WENA 4AP4A 2QICA 3LJUX 2CKLA 3LDYA 2G45A 1WEPA 5LKZA 5TDWA 2EGMA 1WEMA 4S3OB 3FEHA 4IC2A 2KGIA 3N9LA 2YHNA 5TABA 1Z60A 4F1PA 2XOCA 3U5MA 3ASLA 2G6QA 4FIPA 3L1XA 5B79A 3T6RA 1WGMA 1Z2QA 2YT5A 2YU4A 3HTKC 3U5PA 2JM3A 2NAAA 3LRQA 3LQIA 2M3HA 4C9ZA 5LKXA 2BAYA 3M99A 4N4FA 4NN2A 2FSAA 3MHSA 4FJCA 5H1TA 3MDBC 4I7DA 2F6NA 5H1UA 4F52B 4I7CA 1RMDA 3L11A 5G0FA 3N9PA 2MUMA 2K1JA 4UP5A 2XEUA 4LKAA 5B78A 2ECWA 2VJEB 4UP0A 2JMDA 3MHHA 2KWKA 3O7AA 5JG6A 2YSMA 5KH7A 2CSZA 2KKXA 2L75A 4LK9A 1T1HA 2VP7A 1WIMA 4WZ0A 3KV5A 2QIZA 3N9QA 2XP0A 4ZDTA 5SVXA 3T9KA 2LQ6A 1X4JA 3NG2A 3PLWA 2YVRA 2LV9A 1MM3A 3O36A 2Y43A 1LDKC 2YREA 2VPDA 3GL6A 5FEYA 1WESA 3DPLR 1MM2A 2KU3A 4ZQLA 3SOUA 3DWDA 2CSYA 2JRJA 2E6SA 2DSMA 4GNEA 3KDEC 2MA6A 1XWHA 2LDRA 4YBSA 2FUUA 3FAOA 4LJNA 1E4UA 1ZBDB 1WEEA 5J3XA 3O37A 2KREA 3T7LA 4WA6A 1JM7B 2MNZA 2I50A 2KIZA 1VD4A 4CCGX 3N9NA 2L43A 2ECGA 2CT2A 3N9MA 2M85A 4MSXA 1CHCA 1X4IA 1HYJA 1WEWA 4ZUXU
chains in the Genus database with same CATH topology
3ZPVE 5LCWB 3U5NA 2UZGA 4A4CA 2CKLB 2L0BA 2KWOA 3C6WA 3GV4A 2Y1MA 2D8SA 2G43A 4V3KC 4S3OC 4GNDA 4A4BA 2YHOA 2YUCA 2MA5A 2KYUA 5I3LA 5DKAA 3ZYQA 5KH3A 1F62A 4AYCB 2VPBA 2PNXA 3LQJA 2ECJA 2L5UA 4B86C 1JOCA 3LQHA 3ZPV1 4GB0A 5H9MA 1G25A 5DINA 4IC3A 4TKPB 4V3LC 2HDPA 1Z6UA 4X3GA 5D1KB 2VJEA 5B75A 5B76A 3PURA 5TDRA 2C2LA 4R2YA 4WZ3B 2LGGA 2H0DB 4QF3A 4P5OB 4L7XA 3KNVA 3EB5A 3EB6A 2F6JA 2C2VS 1FBVA 1LDJB 2JMIA 2K4DA 2PUYA 2L80A 4PTBA 2EODA 4W4UA 2ECNA 2MT5A 1HYIA 2RI7A 3ZTGA 3O33A 3O70A 3PHDA 5C11A 2YW8A 2LGLA 1WEOA 2VJFB 4LADB 5KH9A 5FB0A 2KWJA 1K2FA 2K17A 4YC9A 3M62A 4MVTA 4FO9A 5AIUA 2E6RA 2KE1A 1FP0A 4B7YC 2ECTA 2MD7B 1WEUA 3RPGB 3DQVR 4YBMA 2KFTA 2MNYA 4A0CD 2EGPA 3VK6A 1JM7A 2LN0A 4AVXA 2DX8A 5D1MB 4N3WA 3FL2A 2ECVA 3KV6A 2YSJA 3N9OA 2ECIA 4CA1A 1WILA 4R8PK 2QJ0A 2IDAA 2YQLA 2AN6A 1X4UA 1VFYA 5EYAF 4Q6FA 2KR4A 5LKUA 1IYMA 2RSDA 5G05B 4YADA 5H1VA 2ZETC 5C13A 2Y1NA 2YYRA 3ZNIA 2LXPC 4AYCA 5D1LB 1V87A 5LKTA 4QF2A 3SOXA 3O35A 5FB1A 4WZ2A 2F42A 4AUQB 2MIQA 5B77A 4LLBA 5G04B 5TBNA 3HCSA 3KQIA 2KGGA 3ZVYA 2OXQC 2KWNA 5B8DA 2H0DA 1WEQA 2K16A 2M1RA 2M6MA 4UI9B 3ZVZB 3M63A 2MD8C 2JMJA 4R7EA 1WFKA 3I2DA 2YQMA 4XI1A 5FERA 2FUIA 3V43A 1WEVA 2LGVA 2LRIC 4A49A 2YURA 4L58A 1WE9A 2LGKA 2VJFA 3HCTA 1U6GB 3PUQA 4YBTA 3QZVA 4PPEA 3C5KA 4I7BA 2EA6A 3IHPA 5TRBA 4BHWA 3L1ZB 2HYED 4YATA 4YABA 3O34A 2VPGA 5AITA 4FK5A 1N87A 3RTRB 1DVPA 3SHBA 3HCUA 4O64A 3SOWA 2VPEA 3U5OA 2XB1A 2LXHC 4BBQA 4GNFA 1VYXA 4YAXA 1BORA 2VNFA 4GNGA 3RPGC 4AP4A 1WENA 2QICA 2CKLA 2G45A 1WEPA 5LKZA 5TDWA 1WEMA 4S3OB 4IC2A 2KGIA 3N9LA 2YHNA 5TABA 1Z60A 3U5MA 3ASLA 2G6QA 4FIPA 3L1XA 5B79A 3T6RA 1WGMA 1Z2QA 2YT5A 2YU4A 3HTKC 3U5PA 2NAAA 3LRQA 3LQIA 2M3HA 4C9ZA 5LKXA 2BAYA 3M99A 4N4FA 4NN2A 2FSAA 3MHSA 4FJCA 5H1TA 4I7DA 2F6NA 5H1UA 4F52B 4I7CA 1RMDA 3L11A 5G0FA 3N9PA 2MUMA 2K1JA 4UP5A 2XEUA 4LKAA 5B78A 2ECWA 2VJEB 4UP0A 2JMDA 3MHHA 2KWKA 3O7AA 5JG6A 2YSMA 5KH7A 2CSZA 2L75A 4LK9A 1T1HA 2VP7A 1WIMA 4WZ0A 3KV5A 2QIZA 3N9QA 4ZDTA 2LQ6A 1X4JA 3NG2A 2LV9A 1MM3A 3O36A 2Y43A 1LDKC 2YREA 2VPDA 3GL6A 5FEYA 1WESA 3DPLR 1MM2A 2KU3A 4ZQLA 3SOUA 2CSYA 2JRJA 2E6SA 4GNEA 2MA6A 1XWHA 2LDRA 4YBSA 2FUUA 4LJNA 1E4UA 1ZBDB 1WEEA 5J3XA 3O37A 2KREA 3T7LA 4WA6A 1JM7B 2MNZA 2I50A 2KIZA 1VD4A 4CCGX 3N9NA 2L43A 2ECGA 2CT2A 3N9MA 2M85A 4MSXA 1CHCA 1X4IA 1HYJA 1WEWA 4ZUXU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPV E;  5LCW B;  3U5N A;  2UZG A;  4A4C A;  2CKL B;  2L0B A;  2KWO A;  3C6W A;  3GV4 A;  2Y1M A;  2D8S A;  2G43 A;  4V3K C;  4S3O C;  4GND A;  4A4B A;  2YHO A;  2YUC A;  2MA5 A;  2KYU A;  5I3L A;  5DKA A;  3ZYQ A;  5KH3 A;  1F62 A;  4AYC B;  2VPB A;  2PNX A;  3LQJ A;  2ECJ A;  2L5U A;  4B86 C;  1JOC A;  3LQH A;  3ZPV 1;  4GB0 A;  5H9M A;  1G25 A;  5DIN A;  4IC3 A;  4TKP B;  4V3L C;  2HDP A;  1Z6U A;  4X3G A;  5D1K B;  2VJE A;  5B75 A;  5B76 A;  3PUR A;  5TDR A;  2C2L A;  4R2Y A;  4WZ3 B;  2LGG A;  2H0D B;  4QF3 A;  4P5O B;  4L7X A;  3KNV A;  3EB5 A;  3EB6 A;  2F6J A;  2C2V S;  1FBV A;  1LDJ B;  2JMI A;  2K4D A;  2PUY A;  2L80 A;  4PTB A;  2EOD A;  4W4U A;  2ECN A;  2MT5 A;  1HYI A;  2RI7 A;  3ZTG A;  3O33 A;  3O70 A;  3PHD A;  5C11 A;  2YW8 A;  2LGL A;  1WEO A;  2VJF B;  4LAD B;  5KH9 A;  5FB0 A;  2KWJ A;  1K2F A;  2K17 A;  4YC9 A;  3M62 A;  4MVT A;  4FO9 A;  5AIU A;  2E6R A;  2KE1 A;  1FP0 A;  4B7Y C;  2ECT A;  2MD7 B;  1WEU A;  3RPG B;  3DQV R;  4YBM A;  2KFT A;  2MNY A;  4A0C D;  2EGP A;  3VK6 A;  1JM7 A;  2LN0 A;  4AVX A;  2DX8 A;  5D1M B;  4N3W A;  3FL2 A;  2ECV A;  3KV6 A;  2YSJ A;  3N9O A;  2ECI A;  4CA1 A;  1WIL A;  4R8P K;  2QJ0 A;  2IDA A;  2YQL A;  2AN6 A;  1X4U A;  1VFY A;  5EYA F;  4Q6F A;  2KR4 A;  5LKU A;  1IYM A;  2RSD A;  5G05 B;  4YAD A;  5H1V A;  2ZET C;  5C13 A;  2Y1N A;  2YYR A;  3ZNI A;  2LXP C;  4AYC A;  5D1L B;  1V87 A;  5LKT A;  4QF2 A;  3SOX A;  3O35 A;  5FB1 A;  4WZ2 A;  2F42 A;  4AUQ B;  2MIQ A;  5B77 A;  4LLB A;  5G04 B;  5TBN A;  3HCS A;  3KQI A;  2KGG A;  3ZVY A;  2OXQ C;  2KWN A;  5B8D A;  2H0D A;  1WEQ A;  2K16 A;  2M1R A;  2M6M A;  4UI9 B;  3ZVZ B;  3M63 A;  2MD8 C;  2JMJ A;  4R7E A;  1WFK A;  3I2D A;  2YQM A;  4XI1 A;  5FER A;  2FUI A;  3V43 A;  1WEV A;  2LGV A;  2LRI C;  4A49 A;  2YUR A;  4L58 A;  1WE9 A;  2LGK A;  2VJF A;  3HCT A;  1U6G B;  3PUQ A;  4YBT A;  3QZV A;  4PPE A;  3C5K A;  4I7B A;  2EA6 A;  3IHP A;  5TRB A;  4BHW A;  3L1Z B;  2HYE D;  4YAT A;  4YAB A;  3O34 A;  2VPG A;  5AIT A;  4FK5 A;  1N87 A;  3RTR B;  1DVP A;  3SHB A;  3HCU A;  4O64 A;  3SOW A;  2VPE A;  3U5O A;  2XB1 A;  2LXH C;  4BBQ A;  4GNF A;  1VYX A;  4YAX A;  1BOR A;  2VNF A;  4GNG A;  3RPG C;  4AP4 A;  1WEN A;  2QIC A;  2CKL A;  2G45 A;  1WEP A;  5LKZ A;  5TDW A;  1WEM A;  4S3O B;  4IC2 A;  2KGI A;  3N9L A;  2YHN A;  5TAB A;  1Z60 A;  3U5M A;  3ASL A;  2G6Q A;  4FIP A;  3L1X A;  5B79 A;  3T6R A;  1WGM A;  1Z2Q A;  2YT5 A;  2YU4 A;  3HTK C;  3U5P A;  2NAA A;  3LRQ A;  3LQI A;  2M3H A;  4C9Z A;  5LKX A;  2BAY A;  3M99 A;  4N4F A;  4NN2 A;  2FSA A;  3MHS A;  4FJC A;  5H1T A;  4I7D A;  2F6N A;  5H1U A;  4F52 B;  4I7C A;  1RMD A;  3L11 A;  5G0F A;  3N9P A;  2MUM A;  2K1J A;  4UP5 A;  2XEU A;  4LKA A;  5B78 A;  2ECW A;  2VJE B;  4UP0 A;  2JMD A;  3MHH A;  2KWK A;  3O7A A;  5JG6 A;  2YSM A;  5KH7 A;  2CSZ A;  2L75 A;  4LK9 A;  1T1H A;  2VP7 A;  1WIM A;  4WZ0 A;  3KV5 A;  2QIZ A;  3N9Q A;  4ZDT A;  2LQ6 A;  1X4J A;  3NG2 A;  2LV9 A;  1MM3 A;  3O36 A;  2Y43 A;  1LDK C;  2YRE A;  2VPD A;  3GL6 A;  5FEY A;  1WES A;  3DPL R;  1MM2 A;  2KU3 A;  4ZQL A;  3SOU A;  2CSY A;  2JRJ A;  2E6S A;  4GNE A;  2MA6 A;  1XWH A;  2LDR A;  4YBS A;  2FUU A;  4LJN A;  1E4U A;  1ZBD B;  1WEE A;  5J3X A;  3O37 A;  2KRE A;  3T7L A;  4WA6 A;  1JM7 B;  2MNZ A;  2I50 A;  2KIZ A;  1VD4 A;  4CCG X;  3N9N A;  2L43 A;  2ECG A;  2CT2 A;  3N9M A;  2M85 A;  4MSX A;  1CHC A;  1X4I A;  1HYJ A;  1WEW A;  4ZUX U; 
#chains in the Genus database with same CATH topology
 3ZPV E;  5LCW B;  3U5N A;  2P57 A;  2UZG A;  4A4C A;  2CKL B;  2L0B A;  2KWO A;  4H9D A;  3C6W A;  3GV4 A;  2Y1M A;  3FJU B;  2D8S A;  2G43 A;  4V3K C;  4S3O C;  4GND A;  4A4B A;  2YHO A;  2YUC A;  2MA5 A;  2KYU A;  5I3L A;  5DKA A;  3ZYQ A;  5KH3 A;  1F62 A;  4AYC B;  2VPB A;  2B0O E;  2PNX A;  3LQJ A;  2ECJ A;  2L5U A;  4B86 C;  1JOC A;  3LQH A;  3ZPV 1;  4O62 A;  2OWA A;  4GB0 A;  5H9M A;  1G25 A;  5DIN A;  4IC3 A;  2XOY A;  4TKP B;  4V3L C;  2HDP A;  1Z6U A;  4X3G A;  5D1K B;  2VJE A;  5B75 A;  5B76 A;  2CSV A;  2DJA A;  3PUR A;  2FFW A;  5TDR A;  2C2L A;  4R2Y A;  3FM8 C;  4WZ3 B;  2LGG A;  2H0D B;  4QF3 A;  3Q1D A;  3SUB A;  4P5O B;  4L7X A;  3KNV A;  2RR4 A;  3EB5 A;  4Z0R A;  3EB6 A;  2F6J A;  2C2V S;  1FBV A;  1LDJ B;  2JMI A;  2K4D A;  2PUY A;  2L80 A;  4PTB A;  2EOD A;  4W4U A;  2ECN A;  2MT5 A;  3M7K A;  2RI7 A;  1HYI A;  3ZTG A;  3O33 A;  3O70 A;  3PHD A;  5C11 A;  2YW8 A;  2LGL A;  1WEO A;  2VJF B;  4LAD B;  5KH9 A;  5FB0 A;  2KWJ A;  2JUN A;  1K2F A;  3LVQ E;  2K17 A;  4YC9 A;  3M62 A;  2L7P A;  4MVT A;  2LAU A;  4FO9 A;  5AIU A;  2E6R A;  2KE1 A;  2XOZ A;  5SVI B;  1FP0 A;  4B7Y C;  2ECT A;  2MD7 B;  1WEU A;  3RPG B;  3DQV R;  4YBM A;  2KFT A;  2MNY A;  4A0C D;  4QQ4 A;  2EGP A;  4Z0O A;  3VK6 A;  1JM7 A;  2LN0 A;  4AVX A;  2DX8 A;  5D1M B;  4N3W A;  3FL2 A;  2ECV A;  3KV6 A;  2YSJ A;  3N9O A;  2ECI A;  4CA1 A;  1WIL A;  2E61 A;  4R8P K;  3LVR E;  2QJ0 A;  2IDA A;  2YQL A;  2AN6 A;  1X4U A;  1VFY A;  5EYA F;  4Q6F A;  2KR4 A;  3JUE A;  5LKU A;  1IYM A;  2RSD A;  5G05 B;  4YAD A;  3DDT A;  5H1V A;  5K3Q A;  2ZET C;  5C13 A;  2Y1N A;  2YYR A;  3ZNI A;  2LXP C;  4AYC A;  2IQJ A;  5D1L B;  3H7H A;  1V87 A;  2CRW A;  2CRR A;  5LKT A;  4QF2 A;  3SOX A;  3O35 A;  5FB1 A;  4WZ2 A;  2F42 A;  4AUQ B;  2MIQ A;  5B77 A;  4OGC A;  2CON A;  4LLB A;  2MKE A;  5G04 B;  5TBN A;  3HCS A;  3KQI A;  2KGG A;  3ZVY A;  2OXQ C;  2KWN A;  5B8D A;  2H0D A;  1WEQ A;  2K16 A;  2M1R A;  2M6M A;  4UI9 B;  2D8U A;  5SVY A;  3ZVZ B;  3M63 A;  2MD8 C;  2JMJ A;  4R7E A;  1WFK A;  3I2D A;  2YQM A;  4XI1 A;  5FER A;  2FUI A;  3V43 A;  1WEV A;  2LGV A;  4OGE A;  2LRI C;  4A49 A;  2YUR A;  4L58 A;  1WE9 A;  2LGK A;  2VJF A;  3HCT A;  1U6G B;  3PUQ A;  4YBT A;  1DCQ A;  3QZV A;  4PPE A;  3C5K A;  4I7B A;  2EA6 A;  3IHP A;  5TRB A;  4BHW A;  3L1Z B;  2HYE D;  3E2D A;  4YAT A;  2M13 A;  4YAB A;  3O34 A;  2VPG A;  5SVI A;  2EXU A;  5AIT A;  4FK5 A;  1N87 A;  3RTR B;  1DVP A;  3SHB A;  3HCU A;  4O64 A;  2KKY A;  3FAN A;  2FD4 A;  3SOW A;  2VPE A;  3U5O A;  2XB1 A;  2LXH C;  4BBQ A;  4GNF A;  1VYX A;  4YAX A;  3O47 A;  1BOR A;  2VNF A;  4GNG A;  3RPG C;  1MBM A;  1WEN A;  4AP4 A;  2QIC A;  3LJU X;  2CKL A;  3LDY A;  2G45 A;  1WEP A;  5LKZ A;  5TDW A;  2EGM A;  1WEM A;  4S3O B;  3FEH A;  4IC2 A;  2KGI A;  3N9L A;  2YHN A;  5TAB A;  1Z60 A;  4F1P A;  2XOC A;  3U5M A;  3ASL A;  2G6Q A;  4FIP A;  3L1X A;  5B79 A;  3T6R A;  1WGM A;  1Z2Q A;  2YT5 A;  2YU4 A;  3HTK C;  3U5P A;  2JM3 A;  2NAA A;  3LRQ A;  3LQI A;  2M3H A;  4C9Z A;  5LKX A;  2BAY A;  3M99 A;  4N4F A;  4NN2 A;  2FSA A;  3MHS A;  4FJC A;  5H1T A;  3MDB C;  4I7D A;  2F6N A;  5H1U A;  4F52 B;  4I7C A;  1RMD A;  3L11 A;  5G0F A;  3N9P A;  2MUM A;  2K1J A;  4UP5 A;  2XEU A;  4LKA A;  5B78 A;  2ECW A;  2VJE B;  4UP0 A;  2JMD A;  3MHH A;  2KWK A;  3O7A A;  5JG6 A;  2YSM A;  5KH7 A;  2CSZ A;  2KKX A;  2L75 A;  4LK9 A;  1T1H A;  2VP7 A;  1WIM A;  4WZ0 A;  3KV5 A;  2QIZ A;  3N9Q A;  2XP0 A;  4ZDT A;  5SVX A;  3T9K A;  2LQ6 A;  1X4J A;  3NG2 A;  3PLW A;  2YVR A;  2LV9 A;  1MM3 A;  3O36 A;  2Y43 A;  1LDK C;  2YRE A;  2VPD A;  3GL6 A;  5FEY A;  1WES A;  3DPL R;  1MM2 A;  2KU3 A;  4ZQL A;  3SOU A;  3DWD A;  2CSY A;  2JRJ A;  2E6S A;  2DSM A;  4GNE A;  3KDE C;  2MA6 A;  1XWH A;  2LDR A;  4YBS A;  2FUU A;  3FAO A;  4LJN A;  1E4U A;  1ZBD B;  1WEE A;  5J3X A;  3O37 A;  2KRE A;  3T7L A;  4WA6 A;  1JM7 B;  2MNZ A;  2I50 A;  2KIZ A;  1VD4 A;  4CCG X;  3N9N A;  2L43 A;  2ECG A;  2CT2 A;  3N9M A;  2M85 A;  4MSX A;  1CHC A;  1X4I A;  1HYJ A;  1WEW A;  4ZUX U; 
#chains in the Genus database with same CATH homology
 3ZPV E;  5LCW B;  3U5N A;  2UZG A;  4A4C A;  2CKL B;  2L0B A;  2KWO A;  3C6W A;  3GV4 A;  2Y1M A;  2D8S A;  2G43 A;  4V3K C;  4S3O C;  4GND A;  4A4B A;  2YHO A;  2YUC A;  2MA5 A;  2KYU A;  5I3L A;  5DKA A;  3ZYQ A;  5KH3 A;  1F62 A;  4AYC B;  2VPB A;  2PNX A;  3LQJ A;  2ECJ A;  2L5U A;  4B86 C;  1JOC A;  3LQH A;  3ZPV 1;  4GB0 A;  5H9M A;  1G25 A;  5DIN A;  4IC3 A;  4TKP B;  4V3L C;  2HDP A;  1Z6U A;  4X3G A;  5D1K B;  2VJE A;  5B75 A;  5B76 A;  3PUR A;  5TDR A;  2C2L A;  4R2Y A;  4WZ3 B;  2LGG A;  2H0D B;  4QF3 A;  4P5O B;  4L7X A;  3KNV A;  3EB5 A;  3EB6 A;  2F6J A;  2C2V S;  1FBV A;  1LDJ B;  2JMI A;  2K4D A;  2PUY A;  2L80 A;  4PTB A;  2EOD A;  4W4U A;  2ECN A;  2MT5 A;  1HYI A;  2RI7 A;  3ZTG A;  3O33 A;  3O70 A;  3PHD A;  5C11 A;  2YW8 A;  2LGL A;  1WEO A;  2VJF B;  4LAD B;  5KH9 A;  5FB0 A;  2KWJ A;  1K2F A;  2K17 A;  4YC9 A;  3M62 A;  4MVT A;  4FO9 A;  5AIU A;  2E6R A;  2KE1 A;  1FP0 A;  4B7Y C;  2ECT A;  2MD7 B;  1WEU A;  3RPG B;  3DQV R;  4YBM A;  2KFT A;  2MNY A;  4A0C D;  2EGP A;  3VK6 A;  1JM7 A;  2LN0 A;  4AVX A;  2DX8 A;  5D1M B;  4N3W A;  3FL2 A;  2ECV A;  3KV6 A;  2YSJ A;  3N9O A;  2ECI A;  4CA1 A;  1WIL A;  4R8P K;  2QJ0 A;  2IDA A;  2YQL A;  2AN6 A;  1X4U A;  1VFY A;  5EYA F;  4Q6F A;  2KR4 A;  5LKU A;  1IYM A;  2RSD A;  5G05 B;  4YAD A;  5H1V A;  2ZET C;  5C13 A;  2Y1N A;  2YYR A;  3ZNI A;  2LXP C;  4AYC A;  5D1L B;  1V87 A;  5LKT A;  4QF2 A;  3SOX A;  3O35 A;  5FB1 A;  4WZ2 A;  2F42 A;  4AUQ B;  2MIQ A;  5B77 A;  4LLB A;  5G04 B;  5TBN A;  3HCS A;  3KQI A;  2KGG A;  3ZVY A;  2OXQ C;  2KWN A;  5B8D A;  2H0D A;  1WEQ A;  2K16 A;  2M1R A;  2M6M A;  4UI9 B;  3ZVZ B;  3M63 A;  2MD8 C;  2JMJ A;  4R7E A;  1WFK A;  3I2D A;  2YQM A;  4XI1 A;  5FER A;  2FUI A;  3V43 A;  1WEV A;  2LGV A;  2LRI C;  4A49 A;  2YUR A;  4L58 A;  1WE9 A;  2LGK A;  2VJF A;  3HCT A;  1U6G B;  3PUQ A;  4YBT A;  3QZV A;  4PPE A;  3C5K A;  4I7B A;  2EA6 A;  3IHP A;  5TRB A;  4BHW A;  3L1Z B;  2HYE D;  4YAT A;  4YAB A;  3O34 A;  2VPG A;  5AIT A;  4FK5 A;  1N87 A;  3RTR B;  1DVP A;  3SHB A;  3HCU A;  4O64 A;  3SOW A;  2VPE A;  3U5O A;  2XB1 A;  2LXH C;  4BBQ A;  4GNF A;  1VYX A;  4YAX A;  1BOR A;  2VNF A;  4GNG A;  3RPG C;  4AP4 A;  1WEN A;  2QIC A;  2CKL A;  2G45 A;  1WEP A;  5LKZ A;  5TDW A;  1WEM A;  4S3O B;  4IC2 A;  2KGI A;  3N9L A;  2YHN A;  5TAB A;  1Z60 A;  3U5M A;  3ASL A;  2G6Q A;  4FIP A;  3L1X A;  5B79 A;  3T6R A;  1WGM A;  1Z2Q A;  2YT5 A;  2YU4 A;  3HTK C;  3U5P A;  2NAA A;  3LRQ A;  3LQI A;  2M3H A;  4C9Z A;  5LKX A;  2BAY A;  3M99 A;  4N4F A;  4NN2 A;  2FSA A;  3MHS A;  4FJC A;  5H1T A;  4I7D A;  2F6N A;  5H1U A;  4F52 B;  4I7C A;  1RMD A;  3L11 A;  5G0F A;  3N9P A;  2MUM A;  2K1J A;  4UP5 A;  2XEU A;  4LKA A;  5B78 A;  2ECW A;  2VJE B;  4UP0 A;  2JMD A;  3MHH A;  2KWK A;  3O7A A;  5JG6 A;  2YSM A;  5KH7 A;  2CSZ A;  2L75 A;  4LK9 A;  1T1H A;  2VP7 A;  1WIM A;  4WZ0 A;  3KV5 A;  2QIZ A;  3N9Q A;  4ZDT A;  2LQ6 A;  1X4J A;  3NG2 A;  2LV9 A;  1MM3 A;  3O36 A;  2Y43 A;  1LDK C;  2YRE A;  2VPD A;  3GL6 A;  5FEY A;  1WES A;  3DPL R;  1MM2 A;  2KU3 A;  4ZQL A;  3SOU A;  2CSY A;  2JRJ A;  2E6S A;  4GNE A;  2MA6 A;  1XWH A;  2LDR A;  4YBS A;  2FUU A;  4LJN A;  1E4U A;  1ZBD B;  1WEE A;  5J3X A;  3O37 A;  2KRE A;  3T7L A;  4WA6 A;  1JM7 B;  2MNZ A;  2I50 A;  2KIZ A;  1VD4 A;  4CCG X;  3N9N A;  2L43 A;  2ECG A;  2CT2 A;  3N9M A;  2M85 A;  4MSX A;  1CHC A;  1X4I A;  1HYJ A;  1WEW A;  4ZUX U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...