2FUIA

Nmr solution structure of phd finger fragment of human bptf in free state
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
b'GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fuiA00
4AP4A 3SOWA 2NAAA 5B77A 3LQJA 2FUIA 4YBTA 1X4JA 3KV6A 4ZDTA 4ZUXU 2JMIA 2K4DA 4GNGA 2KU3A 4W4UA 3O34A 2VP7A 4UP5A 2LXPC 5TDWA 1JOCA 3O70A 3L1ZB 4LADB 3KV5A 2I50A 2VJFA 3N9QA 4I7BA 2YREA 4YATA 1F62A 4LJNA 5KH9A 1MM3A 3ZVZB 4AUQB 1WFKA 4LK9A 3U5OA 5I3LA 4TKPB 1CHCA 3ZYQA 4R8PK 2KFTA 2CKLB 3SOUA 4Q6FA 3MHSA 5G04B 1FBVA 3L1XA 1BORA 4WZ3B 4BBQA 2ECIA 1WEEA 1JM7B 1WEUA 2LQ6A 1WEWA 1FP0A 3LQHA 4YBSA 2XEUA 2BAYA 5G0FA 2YHNA 1DVPA 2OXQC 4O64A 5LKUA 5TDRA 2YU4A 2MT5A 5DINA 5TBNA 2VJEB 2EGPA 3U5MA 2CSYA 2YT5A 4WZ2A 1U6GB 2VPDA 1ZBDB 2HYED 2KGIA 3T7LA 4P5OB 5G05B 2MIQA 4YAXA 5H1TA 3RPGB 5DKAA 1WEVA 2K17A 5H1VA 2F6JA 4N3WA 3C5KA 2ZETC 5KH3A 1RMDA 4I7CA 4S3OC 2E6RA 4LKAA 4FJCA 4A4CA 5FB0A 5LKXA 4A0CD 3N9PA 2L75A 2YQLA 2YSMA 2CSZA 4GNDA 5FERA 3SOXA 1N87A 3SHBA 4AVXA 5D1LB 5D1MB 2M85A 2FSAA 1WEMA 3LRQA 3I2DA 3GV4A 5KH7A 2RI7A 3EB5A 3FL2A 1V87A 3T6RA 3M62A 2LXHC 3QZVA 2HDPA 2M3HA 2VPEA 1WIMA 2MNYA 2YQMA 2MA6A 5LKTA 1VYXA 1IYMA 2RSDA 1XWHA 2L43A 1LDJB 5J3XA 2KIZA 3O36A 2G45A 2YYRA 4BHWA 2KWNA 2XB1A 2LV9A 4V3LC 2ECJA 3N9LA 3KQIA 2KE1A 2F6NA 3KNVA 5AITA 4AYCA 2LN0A 2YURA 5D1KB 4A4BA 1WILA 2VJFB 1MM2A 3M63A 4B86C 4FIPA 2LRIC 2LDRA 2KR4A 2QJ0A 5H9MA 2F42A 4PTBA 4CCGX 3PHDA 2PUYA 2MD8C 5C11A 4QF3A 2K1JA 4R7EA 4V3KC 5B8DA 1WE9A 1E4UA 2JMDA 5JG6A 3ZTGA 3MHHA 2MUMA 1X4UA 2H0DB 3V43A 3HTKC 5H1UA 2ECVA 5TRBA 2C2LA 2KWOA 2LGKA 1LDKC 3NG2A 2EA6A 4C9ZA 4WZ0A 2YHOA 3DPLR 2K16A 3RPGC 2ECWA 4IC3A 1VD4A 2L80A 3N9OA 2LGVA 4FK5A 4FO9A 2ECTA 1HYIA 1K2FA 4F52B 2QIZA 5FB1A 3C6WA 4L7XA 2YSJA 3PURA 4A49A 1Z6UA 2Y1MA 3ZPVE 3N9NA 4QF2A 1WEQA 5C13A 2JMJA 2IDAA 2DX8A 2LGGA 3LQIA 2KGGA 4XI1A 3RTRB 1Z60A 3N9MA 2QICA 5B76A 5B79A 3ZPV1 4ZQLA 2EODA 3PUQA 3U5PA 2L5UA 1WEOA 2CKLA 4YC9A 2E6SA 2CT2A 2AN6A 4GNFA 4PPEA 2G6QA 1JM7A 2G43A 4I7DA 3HCSA 3O33A 4WA6A 3EB6A 4YADA 1T1HA 3IHPA 4UI9B 2KYUA 1WESA 3DQVR 2MD7B 1WEPA 4YABA 5AIUA 2D8SA 2ECGA 5FEYA 2VJEA 4X3GA 4AYCB 2LGLA 3VK6A 2UZGA 4GB0A 4R2YA 3U5NA 3HCUA 2VNFA 2Y1NA 5B78A 3ZNIA 1HYJA 1Z2QA 2H0DA 2MA5A 2YUCA 2PNXA 2L0BA 2Y43A 4MSXA 5B75A 4YBMA 3GL6A 2ECNA 5EYAF 1WGMA 1X4IA 3O7AA 2C2VS 5LKZA 3ZVYA 3M99A 4S3OB 4IC2A 4B7YC 4N4FA 1G25A 1WENA 4LLBA 2VPGA 2KREA 2FUUA 2JRJA 2M6MA 2VPBA 2YW8A 2MNZA 4CA1A 4MVTA 2KWJA 3HCTA 2KWKA 3O35A 3ASLA 3L11A 4L58A 4GNEA 4NN2A 4UP0A 3O37A 2M1RA 5LCWB 5TABA 1VFYA
chains in the Genus database with same CATH superfamily
4AP4A 3SOWA 2NAAA 2KKXA 5B77A 5SVIB 3LQJA 2FUIA 4YBTA 1X4JA 3KV6A 4ZDTA 4ZUXU 2XOZA 2JMIA 2K4DA 3DDTA 4GNGA 2KU3A 4W4UA 3O34A 2VP7A 4UP5A 2LXPC 5TDWA 1JOCA 3O70A 3L1ZB 4LADB 3KV5A 2I50A 2VJFA 3N9QA 4I7BA 2YREA 4YATA 1F62A 4LJNA 5KH9A 1MM3A 2D8UA 3ZVZB 3FJUB 1WFKA 4LK9A 4AUQB 3U5OA 5I3LA 4TKPB 1CHCA 3ZYQA 4R8PK 2KFTA 2CKLB 3SOUA 2XP0A 4Q6FA 3MHSA 5G04B 1FBVA 3L1XA 1BORA 4WZ3B 4BBQA 2ECIA 1WEEA 1JM7B 1WEUA 2LQ6A 1WEWA 3FANA 1FP0A 2EXUA 3LQHA 4YBSA 2XEUA 2BAYA 3Q1DA 5G0FA 2YHNA 1DVPA 2OXQC 4O64A 5LKUA 5TDRA 2YU4A 2MT5A 5DINA 5TBNA 2VJEB 2EGPA 3U5MA 2CSYA 2YT5A 4WZ2A 1U6GB 2VPDA 1ZBDB 2HYED 2KGIA 3T7LA 4P5OB 5G05B 2MIQA 4YAXA 3DWDA 5H1TA 1DCQA 2XOYA 3RPGB 5DKAA 1WEVA 2K17A 2JUNA 5H1VA 3O47A 2F6JA 4N3WA 3C5KA 2ZETC 5KH3A 1RMDA 4I7CA 4S3OC 5SVYA 2E6RA 4LKAA 4FJCA 4A4CA 5SVXA 5FB0A 5LKXA 4Z0OA 4A0CD 3N9PA 2CRWA 2L75A 2YQLA 2YSMA 2CSZA 2CONA 4GNDA 5FERA 3LJUX 3SOXA 1N87A 2IQJA 3SHBA 4AVXA 5D1LB 5D1MB 2M85A 2FSAA 1WEMA 3LRQA 4Z0RA 3I2DA 3GV4A 5KH7A 2RI7A 3EB5A 2DSMA 3FL2A 1V87A 3T6RA 3M62A 2LXHC 3QZVA 2HDPA 2M3HA 2VPEA 1WIMA 2OWAA 2MNYA 2YQMA 2MA6A 5LKTA 1VYXA 1IYMA 2RSDA 1XWHA 2L43A 1LDJB 5J3XA 3LVQE 2KIZA 3O36A 3FM8C 2G45A 2YYRA 4BHWA 2KWNA 2XB1A 2LV9A 4V3LC 2ECJA 3N9LA 3KQIA 2KE1A 2F6NA 3KNVA 5AITA 4AYCA 2LN0A 2YURA 5D1KB 4A4BA 1WILA 2VJFB 1MM2A 3M63A 4B86C 4FIPA 2LRIC 2LDRA 2KR4A 2M13A 2QJ0A 3H7HA 2FD4A 5H9MA 2F42A 4PTBA 4CCGX 4F1PA 3PHDA 2PUYA 2MD8C 3PLWA 5C11A 4QF3A 2K1JA 4R7EA 4V3KC 4O62A 5B8DA 1WE9A 1E4UA 2JMDA 5JG6A 3ZTGA 3MHHA 2MUMA 1X4UA 3LDYA 2H0DB 3V43A 3HTKC 5H1UA 2EGMA 2ECVA 5TRBA 2C2LA 2KWOA 2LGKA 1LDKC 3NG2A 4QQ4A 2EA6A 4C9ZA 4WZ0A 3FEHA 2YHOA 3DPLR 2K16A 3RPGC 2ECWA 4IC3A 1VD4A 2L80A 3N9OA 2LGVA 4FK5A 4FO9A 2ECTA 1HYIA 1K2FA 4F52B 5SVIA 2QIZA 5FB1A 3C6WA 4L7XA 2YSJA 3PURA 2DJAA 4A49A 1Z6UA 2Y1MA 3ZPVE 2KKYA 3N9NA 4H9DA 4QF2A 1WEQA 2B0OE 5C13A 2JMJA 2IDAA 2DX8A 2LGGA 3LQIA 2KGGA 4XI1A 3RTRB 2MKEA 1Z60A 3N9MA 2QICA 5B76A 5B79A 2P57A 3ZPV1 3M7KA 3LVRE 4ZQLA 2EODA 3PUQA 3U5PA 2L5UA 1WEOA 3FAOA 2CKLA 4YC9A 2E6SA 2CT2A 2AN6A 4GNFA 4OGCA 4PPEA 2G6QA 1JM7A 2G43A 4I7DA 3HCSA 2FFWA 3O33A 4WA6A 3EB6A 4YADA 1T1HA 3IHPA 4UI9B 2KYUA 1WESA 3DQVR 3KDEC 5K3QA 2MD7B 4OGEA 3SUBA 1WEPA 4YABA 2XOCA 5AIUA 2D8SA 2ECGA 5FEYA 2VJEA 4X3GA 4AYCB 2CSVA 2LGLA 3VK6A 1MBMA 2UZGA 4GB0A 4R2YA 3U5NA 3HCUA 2VNFA 2Y1NA 5B78A 3ZNIA 1HYJA 3E2DA 1Z2QA 3MDBC 2H0DA 2MA5A 2YUCA 2PNXA 2L0BA 2Y43A 4MSXA 5B75A 4YBMA 3GL6A 2ECNA 5EYAF 1WGMA 1X4IA 3O7AA 3T9KA 2YVRA 2C2VS 5LKZA 3ZVYA 3M99A 4S3OB 4IC2A 4B7YC 4N4FA 1G25A 1WENA 4LLBA 2VPGA 2KREA 2FUUA 2JRJA 2M6MA 2LAUA 2VPBA 2YW8A 2MNZA 4CA1A 4MVTA 2KWJA 2E61A 3HCTA 2KWKA 3JUEA 3ASLA 3O35A 2JM3A 3L11A 4L58A 4GNEA 4NN2A 4UP0A 3O37A 2M1RA 5LCWB 2L7PA 2CRRA 5TABA 2RR4A 1VFYA
chains in the Genus database with same CATH topology
4AP4A 3SOWA 2NAAA 5B77A 3LQJA 2FUIA 4YBTA 1X4JA 3KV6A 4ZDTA 4ZUXU 2JMIA 2K4DA 4GNGA 2KU3A 4W4UA 3O34A 2VP7A 4UP5A 2LXPC 5TDWA 1JOCA 3O70A 3L1ZB 4LADB 3KV5A 2I50A 2VJFA 3N9QA 4I7BA 2YREA 4YATA 1F62A 4LJNA 5KH9A 1MM3A 3ZVZB 4AUQB 1WFKA 4LK9A 3U5OA 5I3LA 4TKPB 1CHCA 3ZYQA 4R8PK 2KFTA 2CKLB 3SOUA 4Q6FA 3MHSA 5G04B 1FBVA 3L1XA 1BORA 4WZ3B 4BBQA 2ECIA 1WEEA 1JM7B 1WEUA 2LQ6A 1WEWA 1FP0A 3LQHA 4YBSA 2XEUA 2BAYA 5G0FA 2YHNA 1DVPA 2OXQC 4O64A 5LKUA 5TDRA 2YU4A 2MT5A 5DINA 5TBNA 2VJEB 2EGPA 3U5MA 2CSYA 2YT5A 4WZ2A 1U6GB 2VPDA 1ZBDB 2HYED 2KGIA 3T7LA 4P5OB 5G05B 2MIQA 4YAXA 5H1TA 3RPGB 5DKAA 1WEVA 2K17A 5H1VA 2F6JA 4N3WA 3C5KA 2ZETC 5KH3A 1RMDA 4I7CA 4S3OC 2E6RA 4LKAA 4FJCA 4A4CA 5FB0A 5LKXA 4A0CD 3N9PA 2L75A 2YQLA 2YSMA 2CSZA 4GNDA 5FERA 3SOXA 1N87A 3SHBA 4AVXA 5D1LB 5D1MB 2M85A 2FSAA 1WEMA 3LRQA 3I2DA 3GV4A 5KH7A 2RI7A 3EB5A 3FL2A 1V87A 3T6RA 3M62A 2LXHC 3QZVA 2HDPA 2M3HA 2VPEA 1WIMA 2MNYA 2YQMA 2MA6A 5LKTA 1VYXA 1IYMA 2RSDA 1XWHA 2L43A 1LDJB 5J3XA 2KIZA 3O36A 2G45A 2YYRA 4BHWA 2KWNA 2XB1A 2LV9A 4V3LC 2ECJA 3N9LA 3KQIA 2KE1A 2F6NA 3KNVA 5AITA 4AYCA 2LN0A 2YURA 5D1KB 4A4BA 1WILA 2VJFB 1MM2A 3M63A 4B86C 4FIPA 2LRIC 2LDRA 2KR4A 2QJ0A 5H9MA 2F42A 4PTBA 4CCGX 3PHDA 2PUYA 2MD8C 5C11A 4QF3A 2K1JA 4R7EA 4V3KC 5B8DA 1WE9A 1E4UA 2JMDA 5JG6A 3ZTGA 3MHHA 2MUMA 1X4UA 2H0DB 3V43A 3HTKC 5H1UA 2ECVA 5TRBA 2C2LA 2KWOA 2LGKA 1LDKC 3NG2A 2EA6A 4C9ZA 4WZ0A 2YHOA 3DPLR 2K16A 3RPGC 2ECWA 4IC3A 1VD4A 2L80A 3N9OA 2LGVA 4FK5A 4FO9A 2ECTA 1HYIA 1K2FA 4F52B 2QIZA 5FB1A 3C6WA 4L7XA 2YSJA 3PURA 4A49A 1Z6UA 2Y1MA 3ZPVE 3N9NA 4QF2A 1WEQA 5C13A 2JMJA 2IDAA 2DX8A 2LGGA 3LQIA 2KGGA 4XI1A 3RTRB 1Z60A 3N9MA 2QICA 5B76A 5B79A 3ZPV1 4ZQLA 2EODA 3PUQA 3U5PA 2L5UA 1WEOA 2CKLA 4YC9A 2E6SA 2CT2A 2AN6A 4GNFA 4PPEA 2G6QA 1JM7A 2G43A 4I7DA 3HCSA 3O33A 4WA6A 3EB6A 4YADA 1T1HA 3IHPA 4UI9B 2KYUA 1WESA 3DQVR 2MD7B 1WEPA 4YABA 5AIUA 2D8SA 2ECGA 5FEYA 2VJEA 4X3GA 4AYCB 2LGLA 3VK6A 2UZGA 4GB0A 4R2YA 3U5NA 3HCUA 2VNFA 2Y1NA 5B78A 3ZNIA 1HYJA 1Z2QA 2H0DA 2MA5A 2YUCA 2PNXA 2L0BA 2Y43A 4MSXA 5B75A 4YBMA 3GL6A 2ECNA 5EYAF 1WGMA 1X4IA 3O7AA 2C2VS 5LKZA 3ZVYA 3M99A 4S3OB 4IC2A 4B7YC 4N4FA 1G25A 1WENA 4LLBA 2VPGA 2KREA 2FUUA 2JRJA 2M6MA 2VPBA 2YW8A 2MNZA 4CA1A 4MVTA 2KWJA 3HCTA 2KWKA 3O35A 3ASLA 3L11A 4L58A 4GNEA 4NN2A 4UP0A 3O37A 2M1RA 5LCWB 5TABA 1VFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP4 A;  3SOW A;  2NAA A;  5B77 A;  3LQJ A;  2FUI A;  4YBT A;  1X4J A;  3KV6 A;  4ZDT A;  4ZUX U;  2JMI A;  2K4D A;  4GNG A;  2KU3 A;  4W4U A;  3O34 A;  2VP7 A;  4UP5 A;  2LXP C;  5TDW A;  1JOC A;  3O70 A;  3L1Z B;  4LAD B;  3KV5 A;  2I50 A;  2VJF A;  3N9Q A;  4I7B A;  2YRE A;  4YAT A;  1F62 A;  4LJN A;  5KH9 A;  1MM3 A;  3ZVZ B;  4AUQ B;  1WFK A;  4LK9 A;  3U5O A;  5I3L A;  4TKP B;  1CHC A;  3ZYQ A;  4R8P K;  2KFT A;  2CKL B;  3SOU A;  4Q6F A;  3MHS A;  5G04 B;  1FBV A;  3L1X A;  1BOR A;  4WZ3 B;  4BBQ A;  2ECI A;  1WEE A;  1JM7 B;  1WEU A;  2LQ6 A;  1WEW A;  1FP0 A;  3LQH A;  4YBS A;  2XEU A;  2BAY A;  5G0F A;  2YHN A;  1DVP A;  2OXQ C;  4O64 A;  5LKU A;  5TDR A;  2YU4 A;  2MT5 A;  5DIN A;  5TBN A;  2VJE B;  2EGP A;  3U5M A;  2CSY A;  2YT5 A;  4WZ2 A;  1U6G B;  2VPD A;  1ZBD B;  2HYE D;  2KGI A;  3T7L A;  4P5O B;  5G05 B;  2MIQ A;  4YAX A;  5H1T A;  3RPG B;  5DKA A;  1WEV A;  2K17 A;  5H1V A;  2F6J A;  4N3W A;  3C5K A;  2ZET C;  5KH3 A;  1RMD A;  4I7C A;  4S3O C;  2E6R A;  4LKA A;  4FJC A;  4A4C A;  5FB0 A;  5LKX A;  4A0C D;  3N9P A;  2L75 A;  2YQL A;  2YSM A;  2CSZ A;  4GND A;  5FER A;  3SOX A;  1N87 A;  3SHB A;  4AVX A;  5D1L B;  5D1M B;  2M85 A;  2FSA A;  1WEM A;  3LRQ A;  3I2D A;  3GV4 A;  5KH7 A;  2RI7 A;  3EB5 A;  3FL2 A;  1V87 A;  3T6R A;  3M62 A;  2LXH C;  3QZV A;  2HDP A;  2M3H A;  2VPE A;  1WIM A;  2MNY A;  2YQM A;  2MA6 A;  5LKT A;  1VYX A;  1IYM A;  2RSD A;  1XWH A;  2L43 A;  1LDJ B;  5J3X A;  2KIZ A;  3O36 A;  2G45 A;  2YYR A;  4BHW A;  2KWN A;  2XB1 A;  2LV9 A;  4V3L C;  2ECJ A;  3N9L A;  3KQI A;  2KE1 A;  2F6N A;  3KNV A;  5AIT A;  4AYC A;  2LN0 A;  2YUR A;  5D1K B;  4A4B A;  1WIL A;  2VJF B;  1MM2 A;  3M63 A;  4B86 C;  4FIP A;  2LRI C;  2LDR A;  2KR4 A;  2QJ0 A;  5H9M A;  2F42 A;  4PTB A;  4CCG X;  3PHD A;  2PUY A;  2MD8 C;  5C11 A;  4QF3 A;  2K1J A;  4R7E A;  4V3K C;  5B8D A;  1WE9 A;  1E4U A;  2JMD A;  5JG6 A;  3ZTG A;  3MHH A;  2MUM A;  1X4U A;  2H0D B;  3V43 A;  3HTK C;  5H1U A;  2ECV A;  5TRB A;  2C2L A;  2KWO A;  2LGK A;  1LDK C;  3NG2 A;  2EA6 A;  4C9Z A;  4WZ0 A;  2YHO A;  3DPL R;  2K16 A;  3RPG C;  2ECW A;  4IC3 A;  1VD4 A;  2L80 A;  3N9O A;  2LGV A;  4FK5 A;  4FO9 A;  2ECT A;  1HYI A;  1K2F A;  4F52 B;  2QIZ A;  5FB1 A;  3C6W A;  4L7X A;  2YSJ A;  3PUR A;  4A49 A;  1Z6U A;  2Y1M A;  3ZPV E;  3N9N A;  4QF2 A;  1WEQ A;  5C13 A;  2JMJ A;  2IDA A;  2DX8 A;  2LGG A;  3LQI A;  2KGG A;  4XI1 A;  3RTR B;  1Z60 A;  3N9M A;  2QIC A;  5B76 A;  5B79 A;  3ZPV 1;  4ZQL A;  2EOD A;  3PUQ A;  3U5P A;  2L5U A;  1WEO A;  2CKL A;  4YC9 A;  2E6S A;  2CT2 A;  2AN6 A;  4GNF A;  4PPE A;  2G6Q A;  1JM7 A;  2G43 A;  4I7D A;  3HCS A;  3O33 A;  4WA6 A;  3EB6 A;  4YAD A;  1T1H A;  3IHP A;  4UI9 B;  2KYU A;  1WES A;  3DQV R;  2MD7 B;  1WEP A;  4YAB A;  5AIU A;  2D8S A;  2ECG A;  5FEY A;  2VJE A;  4X3G A;  4AYC B;  2LGL A;  3VK6 A;  2UZG A;  4GB0 A;  4R2Y A;  3U5N A;  3HCU A;  2VNF A;  2Y1N A;  5B78 A;  3ZNI A;  1HYJ A;  1Z2Q A;  2H0D A;  2MA5 A;  2YUC A;  2PNX A;  2L0B A;  2Y43 A;  4MSX A;  5B75 A;  4YBM A;  3GL6 A;  2ECN A;  5EYA F;  1WGM A;  1X4I A;  3O7A A;  2C2V S;  5LKZ A;  3ZVY A;  3M99 A;  4S3O B;  4IC2 A;  4B7Y C;  4N4F A;  1G25 A;  1WEN A;  4LLB A;  2VPG A;  2KRE A;  2FUU A;  2JRJ A;  2M6M A;  2VPB A;  2YW8 A;  2MNZ A;  4CA1 A;  4MVT A;  2KWJ A;  3HCT A;  2KWK A;  3O35 A;  3ASL A;  3L11 A;  4L58 A;  4GNE A;  4NN2 A;  4UP0 A;  3O37 A;  2M1R A;  5LCW B;  5TAB A;  1VFY A; 
#chains in the Genus database with same CATH topology
 4AP4 A;  3SOW A;  2NAA A;  2KKX A;  5B77 A;  5SVI B;  3LQJ A;  2FUI A;  4YBT A;  1X4J A;  3KV6 A;  4ZDT A;  4ZUX U;  2XOZ A;  2JMI A;  2K4D A;  3DDT A;  4GNG A;  2KU3 A;  4W4U A;  3O34 A;  2VP7 A;  4UP5 A;  2LXP C;  5TDW A;  1JOC A;  3O70 A;  3L1Z B;  4LAD B;  3KV5 A;  2I50 A;  2VJF A;  3N9Q A;  4I7B A;  2YRE A;  4YAT A;  1F62 A;  4LJN A;  5KH9 A;  1MM3 A;  2D8U A;  3ZVZ B;  3FJU B;  1WFK A;  4LK9 A;  4AUQ B;  3U5O A;  5I3L A;  4TKP B;  1CHC A;  3ZYQ A;  4R8P K;  2KFT A;  2CKL B;  3SOU A;  2XP0 A;  4Q6F A;  3MHS A;  5G04 B;  1FBV A;  3L1X A;  1BOR A;  4WZ3 B;  4BBQ A;  2ECI A;  1WEE A;  1JM7 B;  1WEU A;  2LQ6 A;  1WEW A;  3FAN A;  1FP0 A;  2EXU A;  3LQH A;  4YBS A;  2XEU A;  2BAY A;  3Q1D A;  5G0F A;  2YHN A;  1DVP A;  2OXQ C;  4O64 A;  5LKU A;  5TDR A;  2YU4 A;  2MT5 A;  5DIN A;  5TBN A;  2VJE B;  2EGP A;  3U5M A;  2CSY A;  2YT5 A;  4WZ2 A;  1U6G B;  2VPD A;  1ZBD B;  2HYE D;  2KGI A;  3T7L A;  4P5O B;  5G05 B;  2MIQ A;  4YAX A;  3DWD A;  5H1T A;  1DCQ A;  2XOY A;  3RPG B;  5DKA A;  1WEV A;  2K17 A;  2JUN A;  5H1V A;  3O47 A;  2F6J A;  4N3W A;  3C5K A;  2ZET C;  5KH3 A;  1RMD A;  4I7C A;  4S3O C;  5SVY A;  2E6R A;  4LKA A;  4FJC A;  4A4C A;  5SVX A;  5FB0 A;  5LKX A;  4Z0O A;  4A0C D;  3N9P A;  2CRW A;  2L75 A;  2YQL A;  2YSM A;  2CSZ A;  2CON A;  4GND A;  5FER A;  3LJU X;  3SOX A;  1N87 A;  2IQJ A;  3SHB A;  4AVX A;  5D1L B;  5D1M B;  2M85 A;  2FSA A;  1WEM A;  3LRQ A;  4Z0R A;  3I2D A;  3GV4 A;  5KH7 A;  2RI7 A;  3EB5 A;  2DSM A;  3FL2 A;  1V87 A;  3T6R A;  3M62 A;  2LXH C;  3QZV A;  2HDP A;  2M3H A;  2VPE A;  1WIM A;  2OWA A;  2MNY A;  2YQM A;  2MA6 A;  5LKT A;  1VYX A;  1IYM A;  2RSD A;  1XWH A;  2L43 A;  1LDJ B;  5J3X A;  3LVQ E;  2KIZ A;  3O36 A;  3FM8 C;  2G45 A;  2YYR A;  4BHW A;  2KWN A;  2XB1 A;  2LV9 A;  4V3L C;  2ECJ A;  3N9L A;  3KQI A;  2KE1 A;  2F6N A;  3KNV A;  5AIT A;  4AYC A;  2LN0 A;  2YUR A;  5D1K B;  4A4B A;  1WIL A;  2VJF B;  1MM2 A;  3M63 A;  4B86 C;  4FIP A;  2LRI C;  2LDR A;  2KR4 A;  2M13 A;  2QJ0 A;  3H7H A;  2FD4 A;  5H9M A;  2F42 A;  4PTB A;  4CCG X;  4F1P A;  3PHD A;  2PUY A;  2MD8 C;  3PLW A;  5C11 A;  4QF3 A;  2K1J A;  4R7E A;  4V3K C;  4O62 A;  5B8D A;  1WE9 A;  1E4U A;  2JMD A;  5JG6 A;  3ZTG A;  3MHH A;  2MUM A;  1X4U A;  3LDY A;  2H0D B;  3V43 A;  3HTK C;  5H1U A;  2EGM A;  2ECV A;  5TRB A;  2C2L A;  2KWO A;  2LGK A;  1LDK C;  3NG2 A;  4QQ4 A;  2EA6 A;  4C9Z A;  4WZ0 A;  3FEH A;  2YHO A;  3DPL R;  2K16 A;  3RPG C;  2ECW A;  4IC3 A;  1VD4 A;  2L80 A;  3N9O A;  2LGV A;  4FK5 A;  4FO9 A;  2ECT A;  1HYI A;  1K2F A;  4F52 B;  5SVI A;  2QIZ A;  5FB1 A;  3C6W A;  4L7X A;  2YSJ A;  3PUR A;  2DJA A;  4A49 A;  1Z6U A;  2Y1M A;  3ZPV E;  2KKY A;  3N9N A;  4H9D A;  4QF2 A;  1WEQ A;  2B0O E;  5C13 A;  2JMJ A;  2IDA A;  2DX8 A;  2LGG A;  3LQI A;  2KGG A;  4XI1 A;  3RTR B;  2MKE A;  1Z60 A;  3N9M A;  2QIC A;  5B76 A;  5B79 A;  2P57 A;  3ZPV 1;  3M7K A;  3LVR E;  4ZQL A;  2EOD A;  3PUQ A;  3U5P A;  2L5U A;  1WEO A;  3FAO A;  2CKL A;  4YC9 A;  2E6S A;  2CT2 A;  2AN6 A;  4GNF A;  4OGC A;  4PPE A;  2G6Q A;  1JM7 A;  2G43 A;  4I7D A;  3HCS A;  2FFW A;  3O33 A;  4WA6 A;  3EB6 A;  4YAD A;  1T1H A;  3IHP A;  4UI9 B;  2KYU A;  1WES A;  3DQV R;  3KDE C;  5K3Q A;  2MD7 B;  4OGE A;  3SUB A;  1WEP A;  4YAB A;  2XOC A;  5AIU A;  2D8S A;  2ECG A;  5FEY A;  2VJE A;  4X3G A;  4AYC B;  2CSV A;  2LGL A;  3VK6 A;  1MBM A;  2UZG A;  4GB0 A;  4R2Y A;  3U5N A;  3HCU A;  2VNF A;  2Y1N A;  5B78 A;  3ZNI A;  1HYJ A;  3E2D A;  1Z2Q A;  3MDB C;  2H0D A;  2MA5 A;  2YUC A;  2PNX A;  2L0B A;  2Y43 A;  4MSX A;  5B75 A;  4YBM A;  3GL6 A;  2ECN A;  5EYA F;  1WGM A;  1X4I A;  3O7A A;  3T9K A;  2YVR A;  2C2V S;  5LKZ A;  3ZVY A;  3M99 A;  4S3O B;  4IC2 A;  4B7Y C;  4N4F A;  1G25 A;  1WEN A;  4LLB A;  2VPG A;  2KRE A;  2FUU A;  2JRJ A;  2M6M A;  2LAU A;  2VPB A;  2YW8 A;  2MNZ A;  4CA1 A;  4MVT A;  2KWJ A;  2E61 A;  3HCT A;  2KWK A;  3JUE A;  3ASL A;  3O35 A;  2JM3 A;  3L11 A;  4L58 A;  4GNE A;  4NN2 A;  4UP0 A;  3O37 A;  2M1R A;  5LCW B;  2L7P A;  2CRR A;  5TAB A;  2RR4 A;  1VFY A; 
#chains in the Genus database with same CATH homology
 4AP4 A;  3SOW A;  2NAA A;  5B77 A;  3LQJ A;  2FUI A;  4YBT A;  1X4J A;  3KV6 A;  4ZDT A;  4ZUX U;  2JMI A;  2K4D A;  4GNG A;  2KU3 A;  4W4U A;  3O34 A;  2VP7 A;  4UP5 A;  2LXP C;  5TDW A;  1JOC A;  3O70 A;  3L1Z B;  4LAD B;  3KV5 A;  2I50 A;  2VJF A;  3N9Q A;  4I7B A;  2YRE A;  4YAT A;  1F62 A;  4LJN A;  5KH9 A;  1MM3 A;  3ZVZ B;  4AUQ B;  1WFK A;  4LK9 A;  3U5O A;  5I3L A;  4TKP B;  1CHC A;  3ZYQ A;  4R8P K;  2KFT A;  2CKL B;  3SOU A;  4Q6F A;  3MHS A;  5G04 B;  1FBV A;  3L1X A;  1BOR A;  4WZ3 B;  4BBQ A;  2ECI A;  1WEE A;  1JM7 B;  1WEU A;  2LQ6 A;  1WEW A;  1FP0 A;  3LQH A;  4YBS A;  2XEU A;  2BAY A;  5G0F A;  2YHN A;  1DVP A;  2OXQ C;  4O64 A;  5LKU A;  5TDR A;  2YU4 A;  2MT5 A;  5DIN A;  5TBN A;  2VJE B;  2EGP A;  3U5M A;  2CSY A;  2YT5 A;  4WZ2 A;  1U6G B;  2VPD A;  1ZBD B;  2HYE D;  2KGI A;  3T7L A;  4P5O B;  5G05 B;  2MIQ A;  4YAX A;  5H1T A;  3RPG B;  5DKA A;  1WEV A;  2K17 A;  5H1V A;  2F6J A;  4N3W A;  3C5K A;  2ZET C;  5KH3 A;  1RMD A;  4I7C A;  4S3O C;  2E6R A;  4LKA A;  4FJC A;  4A4C A;  5FB0 A;  5LKX A;  4A0C D;  3N9P A;  2L75 A;  2YQL A;  2YSM A;  2CSZ A;  4GND A;  5FER A;  3SOX A;  1N87 A;  3SHB A;  4AVX A;  5D1L B;  5D1M B;  2M85 A;  2FSA A;  1WEM A;  3LRQ A;  3I2D A;  3GV4 A;  5KH7 A;  2RI7 A;  3EB5 A;  3FL2 A;  1V87 A;  3T6R A;  3M62 A;  2LXH C;  3QZV A;  2HDP A;  2M3H A;  2VPE A;  1WIM A;  2MNY A;  2YQM A;  2MA6 A;  5LKT A;  1VYX A;  1IYM A;  2RSD A;  1XWH A;  2L43 A;  1LDJ B;  5J3X A;  2KIZ A;  3O36 A;  2G45 A;  2YYR A;  4BHW A;  2KWN A;  2XB1 A;  2LV9 A;  4V3L C;  2ECJ A;  3N9L A;  3KQI A;  2KE1 A;  2F6N A;  3KNV A;  5AIT A;  4AYC A;  2LN0 A;  2YUR A;  5D1K B;  4A4B A;  1WIL A;  2VJF B;  1MM2 A;  3M63 A;  4B86 C;  4FIP A;  2LRI C;  2LDR A;  2KR4 A;  2QJ0 A;  5H9M A;  2F42 A;  4PTB A;  4CCG X;  3PHD A;  2PUY A;  2MD8 C;  5C11 A;  4QF3 A;  2K1J A;  4R7E A;  4V3K C;  5B8D A;  1WE9 A;  1E4U A;  2JMD A;  5JG6 A;  3ZTG A;  3MHH A;  2MUM A;  1X4U A;  2H0D B;  3V43 A;  3HTK C;  5H1U A;  2ECV A;  5TRB A;  2C2L A;  2KWO A;  2LGK A;  1LDK C;  3NG2 A;  2EA6 A;  4C9Z A;  4WZ0 A;  2YHO A;  3DPL R;  2K16 A;  3RPG C;  2ECW A;  4IC3 A;  1VD4 A;  2L80 A;  3N9O A;  2LGV A;  4FK5 A;  4FO9 A;  2ECT A;  1HYI A;  1K2F A;  4F52 B;  2QIZ A;  5FB1 A;  3C6W A;  4L7X A;  2YSJ A;  3PUR A;  4A49 A;  1Z6U A;  2Y1M A;  3ZPV E;  3N9N A;  4QF2 A;  1WEQ A;  5C13 A;  2JMJ A;  2IDA A;  2DX8 A;  2LGG A;  3LQI A;  2KGG A;  4XI1 A;  3RTR B;  1Z60 A;  3N9M A;  2QIC A;  5B76 A;  5B79 A;  3ZPV 1;  4ZQL A;  2EOD A;  3PUQ A;  3U5P A;  2L5U A;  1WEO A;  2CKL A;  4YC9 A;  2E6S A;  2CT2 A;  2AN6 A;  4GNF A;  4PPE A;  2G6Q A;  1JM7 A;  2G43 A;  4I7D A;  3HCS A;  3O33 A;  4WA6 A;  3EB6 A;  4YAD A;  1T1H A;  3IHP A;  4UI9 B;  2KYU A;  1WES A;  3DQV R;  2MD7 B;  1WEP A;  4YAB A;  5AIU A;  2D8S A;  2ECG A;  5FEY A;  2VJE A;  4X3G A;  4AYC B;  2LGL A;  3VK6 A;  2UZG A;  4GB0 A;  4R2Y A;  3U5N A;  3HCU A;  2VNF A;  2Y1N A;  5B78 A;  3ZNI A;  1HYJ A;  1Z2Q A;  2H0D A;  2MA5 A;  2YUC A;  2PNX A;  2L0B A;  2Y43 A;  4MSX A;  5B75 A;  4YBM A;  3GL6 A;  2ECN A;  5EYA F;  1WGM A;  1X4I A;  3O7A A;  2C2V S;  5LKZ A;  3ZVY A;  3M99 A;  4S3O B;  4IC2 A;  4B7Y C;  4N4F A;  1G25 A;  1WEN A;  4LLB A;  2VPG A;  2KRE A;  2FUU A;  2JRJ A;  2M6M A;  2VPB A;  2YW8 A;  2MNZ A;  4CA1 A;  4MVT A;  2KWJ A;  3HCT A;  2KWK A;  3O35 A;  3ASL A;  3L11 A;  4L58 A;  4GNE A;  4NN2 A;  4UP0 A;  3O37 A;  2M1R A;  5LCW B;  5TAB A;  1VFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...