2VJFA

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'SSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
publication title Structure of the Mdm2/Mdmx Ring Domain Heterodimer Reveals Dimerization is Required for Their Ubiquitylation in Trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjfA00
5D1LB 4FO9A 2KGGA 5AITA 3L11A 4Q6FA 2KE1A 2YQMA 2I50A 2LRIC 4A49A 4N4FA 2KREA 4V3KC 5D1KB 2K4DA 4YBSA 2RSDA 4YBTA 4AP4A 2CKLA 3U5MA 2ZETC 5TRBA 4MSXA 2KFTA 4AYCB 3C5KA 2Y43A 2YQLA 1V87A 2G6QA 4B7YC 4YATA 2F6NA 3ZVZB 3PHDA 5H9MA 2LGLA 2LQ6A 1XWHA 2BAYA 2KWNA 3ZNIA 5FB1A 3O7AA 4WZ2A 2KWJA 1WEQA 2VP7A 3L1XA 4PPEA 1WFKA 5B78A 2YREA 4F52B 2ECTA 1N87A 3N9OA 2YURA 4C9ZA 2FSAA 1DVPA 4O64A 1JOCA 3M62A 5JG6A 4S3OC 2FUUA 2PUYA 3QZVA 1WEVA 3I2DA 2YYRA 3LQJA 3SHBA 3ZTGA 2KU3A 2YSMA 2YW8A 1RMDA 2XB1A 3SOWA 2KWOA 3KV5A 1ZBDB 1MM2A 3LQHA 2CSZA 5B76A 2MIQA 1WEEA 2C2LA 4LADB 1FP0A 4X3GA 5B8DA 1X4IA 2LDRA 5B77A 5FB0A 2RI7A 3EB6A 2K17A 4BBQA 2LXPC 2MNZA 2IDAA 4GNEA 2HYED 3U5OA 4LLBA 3FL2A 2YHNA 2ECGA 2MNYA 3N9PA 1LDKC 1X4UA 4CA1A 4YC9A 4YAXA 4FIPA 4FK5A 3O34A 2H0DB 3N9NA 4N3WA 2VJFB 2LGKA 5TDRA 2LGVA 5H1VA 4A4CA 5TABA 3PUQA 4GNGA 3HCUA 2C2VS 2M85A 4FJCA 1WEPA 2VJEA 2VPEA 2MA5A 4W4UA 2ECIA 1WE9A 3T7LA 2CT2A 4QF2A 2VNFA 5DINA 2FUIA 2MD7B 2EGPA 3RPGC 3N9LA 2ECJA 3NG2A 4B86C 4ZDTA 3M99A 1Z60A 5FERA 1T1HA 2E6RA 5DKAA 4TKPB 4AYCA 3U5NA 3ZPVE 2QJ0A 2VPDA 2LV9A 5LKXA 2VPGA 3T6RA 3O36A 2JMIA 1HYJA 4I7BA 4R2YA 1JM7B 3GL6A 4ZQLA 4YABA 2G43A 4LJNA 3M63A 2XEUA 3HTKC 4LKAA 3O33A 3EB5A 1WILA 2ECNA 2KR4A 4PTBA 1LDJB 4P5OB 5B79A 3IHPA 4A4BA 4AUQB 1VYXA 2EODA 5H1TA 3HCTA 3RTRB 3KQIA 4I7CA 4WZ3B 5LKUA 2YHOA 4R7EA 5B75A 3DPLR 2L5UA 3RPGB 3GV4A 2QIZA 2YU4A 3MHSA 4UI9B 4L7XA 2KYUA 3V43A 4L58A 4I7DA 2M1RA 2F42A 2NAAA 4V3LC 1IYMA 2CKLB 2L43A 1MM3A 4S3OB 5J3XA 5AIUA 1WENA 5EYAF 2L0BA 3LRQA 2YUCA 2LXHC 2L80A 4WA6A 2OXQC 2EA6A 2UZGA 2AN6A 4NN2A 1BORA 4GNDA 4LK9A 2JMJA 3KNVA 2D8SA 3VK6A 5G04B 2ECWA 3DQVR 4UP0A 2Y1MA 3HCSA 1CHCA 1Z2QA 5G0FA 4MVTA 3N9QA 3O70A 1U6GB 1WEUA 1X4JA 1VD4A 5LKTA 2DX8A 3LQIA 2H0DA 2M3HA 5TDWA 4GNFA 5FEYA 2L75A 2VJFA 2KGIA 4QF3A 3U5PA 2MD8C 2K1JA 2KWKA 5H1UA 1K2FA 4A0CD 2JRJA 2G45A 3N9MA 3L1ZB 1E4UA 1WEWA 5G05B 4XI1A 3ZVYA 3SOXA 2MUMA 2CSYA 1HYIA 5D1MB 2HDPA 2LGGA 2E6SA 3ASLA 2K16A 4GB0A 2F6JA 3SOUA 3O35A 1Z6UA 2Y1NA 5LCWB 3ZPV1 4AVXA 1F62A 5C13A 4R8PK 5TBNA 5KH3A 5LKZA 4CCGX 4BHWA 3ZYQA 4UP5A 1WIMA 2ECVA 2M6MA 5I3LA 3C6WA 1JM7A 2LN0A 4YADA 1VFYA 5KH7A 3KV6A 2YSJA 4ZUXU 1G25A 2MT5A 2YT5A 4IC3A 2JMDA 4YBMA 2PNXA 1WEOA 4WZ0A 1WESA 2KIZA 5KH9A 3PURA 3O37A 1WGMA 1FBVA 4IC2A 5C11A 3MHHA 2VPBA 2QICA 2MA6A 1WEMA 2VJEB
chains in the Genus database with same CATH superfamily
5D1LB 4FO9A 2KGGA 2L7PA 5AITA 3L11A 4Q6FA 2XOYA 2KE1A 2YQMA 2I50A 2LRIC 4A49A 4N4FA 2D8UA 2KREA 3JUEA 2K4DA 4V3KC 5D1KB 4YBSA 2RSDA 4YBTA 4AP4A 2CKLA 3U5MA 5SVYA 2ZETC 3FAOA 5TRBA 4MSXA 2KFTA 4AYCB 3C5KA 2Y43A 2YQLA 1V87A 2G6QA 4B7YC 4YATA 2F6NA 3ZVZB 5K3QA 3PHDA 5H9MA 2LGLA 2LQ6A 1XWHA 2BAYA 2KWNA 2XOCA 3ZNIA 5FB1A 3O7AA 4WZ2A 2KWJA 1WEQA 4QQ4A 2VP7A 3L1XA 4PPEA 1WFKA 5B78A 2M13A 3FJUB 2YREA 4F52B 2ECTA 1N87A 3N9OA 2YURA 4C9ZA 2FSAA 1MBMA 1DVPA 4O64A 1JOCA 3M62A 5SVIB 5JG6A 4S3OC 2FUUA 2PUYA 2DSMA 3QZVA 1WEVA 2FFWA 3I2DA 2YYRA 3LQJA 3SHBA 3ZTGA 2KU3A 2YSMA 2YW8A 1RMDA 2XB1A 3SOWA 2KWOA 3KV5A 1ZBDB 1MM2A 3LQHA 2CSZA 5B76A 2MIQA 1WEEA 2C2LA 4LADB 3LVRE 1FP0A 4X3GA 5B8DA 1X4IA 2LDRA 5B77A 5FB0A 2RI7A 3EB6A 3PLWA 2K17A 4BBQA 2LXPC 2MNZA 2IDAA 2FD4A 4GNEA 2HYED 3Q1DA 3U5OA 4LLBA 3FL2A 2YHNA 2ECGA 2EXUA 2MNYA 3N9PA 1LDKC 1X4UA 4CA1A 2KKYA 3SUBA 4YC9A 4YAXA 4FIPA 4FK5A 3O34A 2H0DB 3N9NA 4N3WA 2EGMA 2VJFB 2LGKA 5TDRA 2LGVA 5H1VA 4A4CA 5TABA 3PUQA 4GNGA 3HCUA 2C2VS 2M85A 4FJCA 1WEPA 2VJEA 2VPEA 2MA5A 2DJAA 2MKEA 4W4UA 2ECIA 1WE9A 3T7LA 2CT2A 4QF2A 2VNFA 5DINA 2FUIA 2MD7B 2EGPA 3RPGC 3N9LA 2ECJA 3NG2A 4B86C 4ZDTA 3M99A 1Z60A 5FERA 1T1HA 3M7KA 2E6RA 5DKAA 2RR4A 4TKPB 4AYCA 3U5NA 3ZPVE 2QJ0A 2VPDA 4Z0OA 2LV9A 5LKXA 2VPGA 3T6RA 2KKXA 3O36A 2JMIA 1HYJA 4I7BA 4O62A 4R2YA 1JM7B 3GL6A 4ZQLA 4H9DA 4YABA 2G43A 4LJNA 3M63A 2XEUA 3O47A 3HTKC 4LKAA 3LVQE 3O33A 3EB5A 1WILA 2ECNA 3T9KA 2KR4A 2XOZA 4PTBA 4P5OB 1LDJB 5B79A 3IHPA 4A4BA 4AUQB 1VYXA 2EODA 5H1TA 3HCTA 3RTRB 3KQIA 4I7CA 4WZ3B 5LKUA 3E2DA 2YHOA 5SVIA 4R7EA 5B75A 2JM3A 3DPLR 4OGEA 2L5UA 3RPGB 3KDEC 3GV4A 2QIZA 2YU4A 3MHSA 4UI9B 4L7XA 2KYUA 3V43A 4L58A 4I7DA 2M1RA 2IQJA 2F42A 2NAAA 4V3LC 1IYMA 2CKLB 2L43A 1MM3A 4S3OB 5J3XA 5AIUA 1WENA 5EYAF 2L0BA 3LRQA 2YUCA 2LXHC 2L80A 4WA6A 2OXQC 2EA6A 4Z0RA 2UZGA 2AN6A 4NN2A 3FANA 1BORA 4GNDA 4LK9A 2JMJA 3KNVA 2D8SA 3VK6A 5G04B 2ECWA 3DQVR 4UP0A 2Y1MA 3HCSA 1CHCA 1Z2QA 5G0FA 4MVTA 3N9QA 3O70A 1U6GB 1WEUA 1X4JA 1VD4A 5LKTA 2DX8A 3LQIA 2H0DA 2M3HA 5TDWA 4GNFA 5FEYA 2OWAA 2L75A 2VJFA 2KGIA 4QF3A 3U5PA 2MD8C 2K1JA 2KWKA 5H1UA 1K2FA 4A0CD 2JRJA 3LJUX 2G45A 2CRWA 3N9MA 3DDTA 3L1ZB 5SVXA 1E4UA 1WEWA 5G05B 4XI1A 2B0OE 3ZVYA 3SOXA 2MUMA 2CSYA 1HYIA 5D1MB 2HDPA 3MDBC 2LGGA 2CSVA 2E6SA 2E61A 3ASLA 2K16A 4F1PA 3FEHA 4GB0A 2F6JA 3SOUA 3O35A 1Z6UA 3FM8C 2Y1NA 5LCWB 3H7HA 3ZPV1 4AVXA 2JUNA 2LAUA 1F62A 3DWDA 5C13A 4R8PK 5TBNA 5KH3A 5LKZA 1DCQA 4CCGX 2CRRA 4BHWA 3ZYQA 4UP5A 1WIMA 2ECVA 2M6MA 5I3LA 3C6WA 1JM7A 2LN0A 4YADA 1VFYA 5KH7A 3KV6A 2YSJA 4ZUXU 1G25A 2MT5A 2YVRA 2YT5A 4IC3A 2JMDA 4YBMA 2P57A 2PNXA 1WEOA 4WZ0A 3LDYA 2CONA 4OGCA 1WESA 2KIZA 5KH9A 3PURA 3O37A 1WGMA 1FBVA 4IC2A 5C11A 3MHHA 2XP0A 2VPBA 2QICA 2MA6A 1WEMA 2VJEB
chains in the Genus database with same CATH topology
5D1LB 4FO9A 2KGGA 5AITA 3L11A 4Q6FA 2KE1A 2YQMA 2I50A 2LRIC 4A49A 4N4FA 2KREA 4V3KC 5D1KB 2K4DA 4YBSA 2RSDA 4YBTA 4AP4A 2CKLA 3U5MA 2ZETC 5TRBA 4MSXA 2KFTA 4AYCB 3C5KA 2Y43A 2YQLA 1V87A 2G6QA 4B7YC 4YATA 2F6NA 3ZVZB 3PHDA 5H9MA 2LGLA 2LQ6A 1XWHA 2BAYA 2KWNA 3ZNIA 5FB1A 3O7AA 4WZ2A 2KWJA 1WEQA 2VP7A 3L1XA 4PPEA 1WFKA 5B78A 2YREA 4F52B 2ECTA 1N87A 3N9OA 2YURA 4C9ZA 2FSAA 1DVPA 4O64A 1JOCA 3M62A 5JG6A 4S3OC 2FUUA 2PUYA 3QZVA 1WEVA 3I2DA 2YYRA 3LQJA 3SHBA 3ZTGA 2KU3A 2YSMA 2YW8A 1RMDA 2XB1A 3SOWA 2KWOA 3KV5A 1ZBDB 1MM2A 3LQHA 2CSZA 5B76A 2MIQA 1WEEA 2C2LA 4LADB 1FP0A 4X3GA 5B8DA 1X4IA 2LDRA 5B77A 5FB0A 2RI7A 3EB6A 2K17A 4BBQA 2LXPC 2MNZA 2IDAA 4GNEA 2HYED 3U5OA 4LLBA 3FL2A 2YHNA 2ECGA 2MNYA 3N9PA 1LDKC 1X4UA 4CA1A 4YC9A 4YAXA 4FIPA 4FK5A 3O34A 2H0DB 3N9NA 4N3WA 2VJFB 2LGKA 5TDRA 2LGVA 5H1VA 4A4CA 5TABA 3PUQA 4GNGA 3HCUA 2C2VS 2M85A 4FJCA 1WEPA 2VJEA 2VPEA 2MA5A 4W4UA 2ECIA 1WE9A 3T7LA 2CT2A 4QF2A 2VNFA 5DINA 2FUIA 2MD7B 2EGPA 3RPGC 3N9LA 2ECJA 3NG2A 4B86C 4ZDTA 3M99A 1Z60A 5FERA 1T1HA 2E6RA 5DKAA 4TKPB 4AYCA 3U5NA 3ZPVE 2QJ0A 2VPDA 2LV9A 5LKXA 2VPGA 3T6RA 3O36A 2JMIA 1HYJA 4I7BA 4R2YA 1JM7B 3GL6A 4ZQLA 4YABA 2G43A 4LJNA 3M63A 2XEUA 3HTKC 4LKAA 3O33A 3EB5A 1WILA 2ECNA 2KR4A 4PTBA 1LDJB 4P5OB 5B79A 3IHPA 4A4BA 4AUQB 1VYXA 2EODA 5H1TA 3HCTA 3RTRB 3KQIA 4I7CA 4WZ3B 5LKUA 2YHOA 4R7EA 5B75A 3DPLR 2L5UA 3RPGB 3GV4A 2QIZA 2YU4A 3MHSA 4UI9B 4L7XA 2KYUA 3V43A 4L58A 4I7DA 2M1RA 2F42A 2NAAA 4V3LC 1IYMA 2CKLB 2L43A 1MM3A 4S3OB 5J3XA 5AIUA 1WENA 5EYAF 2L0BA 3LRQA 2YUCA 2LXHC 2L80A 4WA6A 2OXQC 2EA6A 2UZGA 2AN6A 4NN2A 1BORA 4GNDA 4LK9A 2JMJA 3KNVA 2D8SA 3VK6A 5G04B 2ECWA 3DQVR 4UP0A 2Y1MA 3HCSA 1CHCA 1Z2QA 5G0FA 4MVTA 3N9QA 3O70A 1U6GB 1WEUA 1X4JA 1VD4A 5LKTA 2DX8A 3LQIA 2H0DA 2M3HA 5TDWA 4GNFA 5FEYA 2L75A 2VJFA 2KGIA 4QF3A 3U5PA 2MD8C 2K1JA 2KWKA 5H1UA 1K2FA 4A0CD 2JRJA 2G45A 3N9MA 3L1ZB 1E4UA 1WEWA 5G05B 4XI1A 3ZVYA 3SOXA 2MUMA 2CSYA 1HYIA 5D1MB 2HDPA 2LGGA 2E6SA 3ASLA 2K16A 4GB0A 2F6JA 3SOUA 3O35A 1Z6UA 2Y1NA 5LCWB 3ZPV1 4AVXA 1F62A 5C13A 4R8PK 5TBNA 5KH3A 5LKZA 4CCGX 4BHWA 3ZYQA 4UP5A 1WIMA 2ECVA 2M6MA 5I3LA 3C6WA 1JM7A 2LN0A 4YADA 1VFYA 5KH7A 3KV6A 2YSJA 4ZUXU 1G25A 2MT5A 2YT5A 4IC3A 2JMDA 4YBMA 2PNXA 1WEOA 4WZ0A 1WESA 2KIZA 5KH9A 3PURA 3O37A 1WGMA 1FBVA 4IC2A 5C11A 3MHHA 2VPBA 2QICA 2MA6A 1WEMA 2VJEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1L B;  4FO9 A;  2KGG A;  5AIT A;  3L11 A;  4Q6F A;  2KE1 A;  2YQM A;  2I50 A;  2LRI C;  4A49 A;  4N4F A;  2KRE A;  4V3K C;  5D1K B;  2K4D A;  4YBS A;  2RSD A;  4YBT A;  4AP4 A;  2CKL A;  3U5M A;  2ZET C;  5TRB A;  4MSX A;  2KFT A;  4AYC B;  3C5K A;  2Y43 A;  2YQL A;  1V87 A;  2G6Q A;  4B7Y C;  4YAT A;  2F6N A;  3ZVZ B;  3PHD A;  5H9M A;  2LGL A;  2LQ6 A;  1XWH A;  2BAY A;  2KWN A;  3ZNI A;  5FB1 A;  3O7A A;  4WZ2 A;  2KWJ A;  1WEQ A;  2VP7 A;  3L1X A;  4PPE A;  1WFK A;  5B78 A;  2YRE A;  4F52 B;  2ECT A;  1N87 A;  3N9O A;  2YUR A;  4C9Z A;  2FSA A;  1DVP A;  4O64 A;  1JOC A;  3M62 A;  5JG6 A;  4S3O C;  2FUU A;  2PUY A;  3QZV A;  1WEV A;  3I2D A;  2YYR A;  3LQJ A;  3SHB A;  3ZTG A;  2KU3 A;  2YSM A;  2YW8 A;  1RMD A;  2XB1 A;  3SOW A;  2KWO A;  3KV5 A;  1ZBD B;  1MM2 A;  3LQH A;  2CSZ A;  5B76 A;  2MIQ A;  1WEE A;  2C2L A;  4LAD B;  1FP0 A;  4X3G A;  5B8D A;  1X4I A;  2LDR A;  5B77 A;  5FB0 A;  2RI7 A;  3EB6 A;  2K17 A;  4BBQ A;  2LXP C;  2MNZ A;  2IDA A;  4GNE A;  2HYE D;  3U5O A;  4LLB A;  3FL2 A;  2YHN A;  2ECG A;  2MNY A;  3N9P A;  1LDK C;  1X4U A;  4CA1 A;  4YC9 A;  4YAX A;  4FIP A;  4FK5 A;  3O34 A;  2H0D B;  3N9N A;  4N3W A;  2VJF B;  2LGK A;  5TDR A;  2LGV A;  5H1V A;  4A4C A;  5TAB A;  3PUQ A;  4GNG A;  3HCU A;  2C2V S;  2M85 A;  4FJC A;  1WEP A;  2VJE A;  2VPE A;  2MA5 A;  4W4U A;  2ECI A;  1WE9 A;  3T7L A;  2CT2 A;  4QF2 A;  2VNF A;  5DIN A;  2FUI A;  2MD7 B;  2EGP A;  3RPG C;  3N9L A;  2ECJ A;  3NG2 A;  4B86 C;  4ZDT A;  3M99 A;  1Z60 A;  5FER A;  1T1H A;  2E6R A;  5DKA A;  4TKP B;  4AYC A;  3U5N A;  3ZPV E;  2QJ0 A;  2VPD A;  2LV9 A;  5LKX A;  2VPG A;  3T6R A;  3O36 A;  2JMI A;  1HYJ A;  4I7B A;  4R2Y A;  1JM7 B;  3GL6 A;  4ZQL A;  4YAB A;  2G43 A;  4LJN A;  3M63 A;  2XEU A;  3HTK C;  4LKA A;  3O33 A;  3EB5 A;  1WIL A;  2ECN A;  2KR4 A;  4PTB A;  1LDJ B;  4P5O B;  5B79 A;  3IHP A;  4A4B A;  4AUQ B;  1VYX A;  2EOD A;  5H1T A;  3HCT A;  3RTR B;  3KQI A;  4I7C A;  4WZ3 B;  5LKU A;  2YHO A;  4R7E A;  5B75 A;  3DPL R;  2L5U A;  3RPG B;  3GV4 A;  2QIZ A;  2YU4 A;  3MHS A;  4UI9 B;  4L7X A;  2KYU A;  3V43 A;  4L58 A;  4I7D A;  2M1R A;  2F42 A;  2NAA A;  4V3L C;  1IYM A;  2CKL B;  2L43 A;  1MM3 A;  4S3O B;  5J3X A;  5AIU A;  1WEN A;  5EYA F;  2L0B A;  3LRQ A;  2YUC A;  2LXH C;  2L80 A;  4WA6 A;  2OXQ C;  2EA6 A;  2UZG A;  2AN6 A;  4NN2 A;  1BOR A;  4GND A;  4LK9 A;  2JMJ A;  3KNV A;  2D8S A;  3VK6 A;  5G04 B;  2ECW A;  3DQV R;  4UP0 A;  2Y1M A;  3HCS A;  1CHC A;  1Z2Q A;  5G0F A;  4MVT A;  3N9Q A;  3O70 A;  1U6G B;  1WEU A;  1X4J A;  1VD4 A;  5LKT A;  2DX8 A;  3LQI A;  2H0D A;  2M3H A;  5TDW A;  4GNF A;  5FEY A;  2L75 A;  2VJF A;  2KGI A;  4QF3 A;  3U5P A;  2MD8 C;  2K1J A;  2KWK A;  5H1U A;  1K2F A;  4A0C D;  2JRJ A;  2G45 A;  3N9M A;  3L1Z B;  1E4U A;  1WEW A;  5G05 B;  4XI1 A;  3ZVY A;  3SOX A;  2MUM A;  2CSY A;  1HYI A;  5D1M B;  2HDP A;  2LGG A;  2E6S A;  3ASL A;  2K16 A;  4GB0 A;  2F6J A;  3SOU A;  3O35 A;  1Z6U A;  2Y1N A;  5LCW B;  3ZPV 1;  4AVX A;  1F62 A;  5C13 A;  4R8P K;  5TBN A;  5KH3 A;  5LKZ A;  4CCG X;  4BHW A;  3ZYQ A;  4UP5 A;  1WIM A;  2ECV A;  2M6M A;  5I3L A;  3C6W A;  1JM7 A;  2LN0 A;  4YAD A;  1VFY A;  5KH7 A;  3KV6 A;  2YSJ A;  4ZUX U;  1G25 A;  2MT5 A;  2YT5 A;  4IC3 A;  2JMD A;  4YBM A;  2PNX A;  1WEO A;  4WZ0 A;  1WES A;  2KIZ A;  5KH9 A;  3PUR A;  3O37 A;  1WGM A;  1FBV A;  4IC2 A;  5C11 A;  3MHH A;  2VPB A;  2QIC A;  2MA6 A;  1WEM A;  2VJE B; 
#chains in the Genus database with same CATH topology
 5D1L B;  4FO9 A;  2KGG A;  2L7P A;  5AIT A;  3L11 A;  4Q6F A;  2XOY A;  2KE1 A;  2YQM A;  2I50 A;  2LRI C;  4A49 A;  4N4F A;  2D8U A;  2KRE A;  3JUE A;  2K4D A;  4V3K C;  5D1K B;  4YBS A;  2RSD A;  4YBT A;  4AP4 A;  2CKL A;  3U5M A;  5SVY A;  2ZET C;  3FAO A;  5TRB A;  4MSX A;  2KFT A;  4AYC B;  3C5K A;  2Y43 A;  2YQL A;  1V87 A;  2G6Q A;  4B7Y C;  4YAT A;  2F6N A;  3ZVZ B;  5K3Q A;  3PHD A;  5H9M A;  2LGL A;  2LQ6 A;  1XWH A;  2BAY A;  2KWN A;  2XOC A;  3ZNI A;  5FB1 A;  3O7A A;  4WZ2 A;  2KWJ A;  1WEQ A;  4QQ4 A;  2VP7 A;  3L1X A;  4PPE A;  1WFK A;  5B78 A;  2M13 A;  3FJU B;  2YRE A;  4F52 B;  2ECT A;  1N87 A;  3N9O A;  2YUR A;  4C9Z A;  2FSA A;  1MBM A;  1DVP A;  4O64 A;  1JOC A;  3M62 A;  5SVI B;  5JG6 A;  4S3O C;  2FUU A;  2PUY A;  2DSM A;  3QZV A;  1WEV A;  2FFW A;  3I2D A;  2YYR A;  3LQJ A;  3SHB A;  3ZTG A;  2KU3 A;  2YSM A;  2YW8 A;  1RMD A;  2XB1 A;  3SOW A;  2KWO A;  3KV5 A;  1ZBD B;  1MM2 A;  3LQH A;  2CSZ A;  5B76 A;  2MIQ A;  1WEE A;  2C2L A;  4LAD B;  3LVR E;  1FP0 A;  4X3G A;  5B8D A;  1X4I A;  2LDR A;  5B77 A;  5FB0 A;  2RI7 A;  3EB6 A;  3PLW A;  2K17 A;  4BBQ A;  2LXP C;  2MNZ A;  2IDA A;  2FD4 A;  4GNE A;  2HYE D;  3Q1D A;  3U5O A;  4LLB A;  3FL2 A;  2YHN A;  2ECG A;  2EXU A;  2MNY A;  3N9P A;  1LDK C;  1X4U A;  4CA1 A;  2KKY A;  3SUB A;  4YC9 A;  4YAX A;  4FIP A;  4FK5 A;  3O34 A;  2H0D B;  3N9N A;  4N3W A;  2EGM A;  2VJF B;  2LGK A;  5TDR A;  2LGV A;  5H1V A;  4A4C A;  5TAB A;  3PUQ A;  4GNG A;  3HCU A;  2C2V S;  2M85 A;  4FJC A;  1WEP A;  2VJE A;  2VPE A;  2MA5 A;  2DJA A;  2MKE A;  4W4U A;  2ECI A;  1WE9 A;  3T7L A;  2CT2 A;  4QF2 A;  2VNF A;  5DIN A;  2FUI A;  2MD7 B;  2EGP A;  3RPG C;  3N9L A;  2ECJ A;  3NG2 A;  4B86 C;  4ZDT A;  3M99 A;  1Z60 A;  5FER A;  1T1H A;  3M7K A;  2E6R A;  5DKA A;  2RR4 A;  4TKP B;  4AYC A;  3U5N A;  3ZPV E;  2QJ0 A;  2VPD A;  4Z0O A;  2LV9 A;  5LKX A;  2VPG A;  3T6R A;  2KKX A;  3O36 A;  2JMI A;  1HYJ A;  4I7B A;  4O62 A;  4R2Y A;  1JM7 B;  3GL6 A;  4ZQL A;  4H9D A;  4YAB A;  2G43 A;  4LJN A;  3M63 A;  2XEU A;  3O47 A;  3HTK C;  4LKA A;  3LVQ E;  3O33 A;  3EB5 A;  1WIL A;  2ECN A;  3T9K A;  2KR4 A;  2XOZ A;  4PTB A;  4P5O B;  1LDJ B;  5B79 A;  3IHP A;  4A4B A;  4AUQ B;  1VYX A;  2EOD A;  5H1T A;  3HCT A;  3RTR B;  3KQI A;  4I7C A;  4WZ3 B;  5LKU A;  3E2D A;  2YHO A;  5SVI A;  4R7E A;  5B75 A;  2JM3 A;  3DPL R;  4OGE A;  2L5U A;  3RPG B;  3KDE C;  3GV4 A;  2QIZ A;  2YU4 A;  3MHS A;  4UI9 B;  4L7X A;  2KYU A;  3V43 A;  4L58 A;  4I7D A;  2M1R A;  2IQJ A;  2F42 A;  2NAA A;  4V3L C;  1IYM A;  2CKL B;  2L43 A;  1MM3 A;  4S3O B;  5J3X A;  5AIU A;  1WEN A;  5EYA F;  2L0B A;  3LRQ A;  2YUC A;  2LXH C;  2L80 A;  4WA6 A;  2OXQ C;  2EA6 A;  4Z0R A;  2UZG A;  2AN6 A;  4NN2 A;  3FAN A;  1BOR A;  4GND A;  4LK9 A;  2JMJ A;  3KNV A;  2D8S A;  3VK6 A;  5G04 B;  2ECW A;  3DQV R;  4UP0 A;  2Y1M A;  3HCS A;  1CHC A;  1Z2Q A;  5G0F A;  4MVT A;  3N9Q A;  3O70 A;  1U6G B;  1WEU A;  1X4J A;  1VD4 A;  5LKT A;  2DX8 A;  3LQI A;  2H0D A;  2M3H A;  5TDW A;  4GNF A;  5FEY A;  2OWA A;  2L75 A;  2VJF A;  2KGI A;  4QF3 A;  3U5P A;  2MD8 C;  2K1J A;  2KWK A;  5H1U A;  1K2F A;  4A0C D;  2JRJ A;  3LJU X;  2G45 A;  2CRW A;  3N9M A;  3DDT A;  3L1Z B;  5SVX A;  1E4U A;  1WEW A;  5G05 B;  4XI1 A;  2B0O E;  3ZVY A;  3SOX A;  2MUM A;  2CSY A;  1HYI A;  5D1M B;  2HDP A;  3MDB C;  2LGG A;  2CSV A;  2E6S A;  2E61 A;  3ASL A;  2K16 A;  4F1P A;  3FEH A;  4GB0 A;  2F6J A;  3SOU A;  3O35 A;  1Z6U A;  3FM8 C;  2Y1N A;  5LCW B;  3H7H A;  3ZPV 1;  4AVX A;  2JUN A;  2LAU A;  1F62 A;  3DWD A;  5C13 A;  4R8P K;  5TBN A;  5KH3 A;  5LKZ A;  1DCQ A;  4CCG X;  2CRR A;  4BHW A;  3ZYQ A;  4UP5 A;  1WIM A;  2ECV A;  2M6M A;  5I3L A;  3C6W A;  1JM7 A;  2LN0 A;  4YAD A;  1VFY A;  5KH7 A;  3KV6 A;  2YSJ A;  4ZUX U;  1G25 A;  2MT5 A;  2YVR A;  2YT5 A;  4IC3 A;  2JMD A;  4YBM A;  2P57 A;  2PNX A;  1WEO A;  4WZ0 A;  3LDY A;  2CON A;  4OGC A;  1WES A;  2KIZ A;  5KH9 A;  3PUR A;  3O37 A;  1WGM A;  1FBV A;  4IC2 A;  5C11 A;  3MHH A;  2XP0 A;  2VPB A;  2QIC A;  2MA6 A;  1WEM A;  2VJE B; 
#chains in the Genus database with same CATH homology
 5D1L B;  4FO9 A;  2KGG A;  5AIT A;  3L11 A;  4Q6F A;  2KE1 A;  2YQM A;  2I50 A;  2LRI C;  4A49 A;  4N4F A;  2KRE A;  4V3K C;  5D1K B;  2K4D A;  4YBS A;  2RSD A;  4YBT A;  4AP4 A;  2CKL A;  3U5M A;  2ZET C;  5TRB A;  4MSX A;  2KFT A;  4AYC B;  3C5K A;  2Y43 A;  2YQL A;  1V87 A;  2G6Q A;  4B7Y C;  4YAT A;  2F6N A;  3ZVZ B;  3PHD A;  5H9M A;  2LGL A;  2LQ6 A;  1XWH A;  2BAY A;  2KWN A;  3ZNI A;  5FB1 A;  3O7A A;  4WZ2 A;  2KWJ A;  1WEQ A;  2VP7 A;  3L1X A;  4PPE A;  1WFK A;  5B78 A;  2YRE A;  4F52 B;  2ECT A;  1N87 A;  3N9O A;  2YUR A;  4C9Z A;  2FSA A;  1DVP A;  4O64 A;  1JOC A;  3M62 A;  5JG6 A;  4S3O C;  2FUU A;  2PUY A;  3QZV A;  1WEV A;  3I2D A;  2YYR A;  3LQJ A;  3SHB A;  3ZTG A;  2KU3 A;  2YSM A;  2YW8 A;  1RMD A;  2XB1 A;  3SOW A;  2KWO A;  3KV5 A;  1ZBD B;  1MM2 A;  3LQH A;  2CSZ A;  5B76 A;  2MIQ A;  1WEE A;  2C2L A;  4LAD B;  1FP0 A;  4X3G A;  5B8D A;  1X4I A;  2LDR A;  5B77 A;  5FB0 A;  2RI7 A;  3EB6 A;  2K17 A;  4BBQ A;  2LXP C;  2MNZ A;  2IDA A;  4GNE A;  2HYE D;  3U5O A;  4LLB A;  3FL2 A;  2YHN A;  2ECG A;  2MNY A;  3N9P A;  1LDK C;  1X4U A;  4CA1 A;  4YC9 A;  4YAX A;  4FIP A;  4FK5 A;  3O34 A;  2H0D B;  3N9N A;  4N3W A;  2VJF B;  2LGK A;  5TDR A;  2LGV A;  5H1V A;  4A4C A;  5TAB A;  3PUQ A;  4GNG A;  3HCU A;  2C2V S;  2M85 A;  4FJC A;  1WEP A;  2VJE A;  2VPE A;  2MA5 A;  4W4U A;  2ECI A;  1WE9 A;  3T7L A;  2CT2 A;  4QF2 A;  2VNF A;  5DIN A;  2FUI A;  2MD7 B;  2EGP A;  3RPG C;  3N9L A;  2ECJ A;  3NG2 A;  4B86 C;  4ZDT A;  3M99 A;  1Z60 A;  5FER A;  1T1H A;  2E6R A;  5DKA A;  4TKP B;  4AYC A;  3U5N A;  3ZPV E;  2QJ0 A;  2VPD A;  2LV9 A;  5LKX A;  2VPG A;  3T6R A;  3O36 A;  2JMI A;  1HYJ A;  4I7B A;  4R2Y A;  1JM7 B;  3GL6 A;  4ZQL A;  4YAB A;  2G43 A;  4LJN A;  3M63 A;  2XEU A;  3HTK C;  4LKA A;  3O33 A;  3EB5 A;  1WIL A;  2ECN A;  2KR4 A;  4PTB A;  1LDJ B;  4P5O B;  5B79 A;  3IHP A;  4A4B A;  4AUQ B;  1VYX A;  2EOD A;  5H1T A;  3HCT A;  3RTR B;  3KQI A;  4I7C A;  4WZ3 B;  5LKU A;  2YHO A;  4R7E A;  5B75 A;  3DPL R;  2L5U A;  3RPG B;  3GV4 A;  2QIZ A;  2YU4 A;  3MHS A;  4UI9 B;  4L7X A;  2KYU A;  3V43 A;  4L58 A;  4I7D A;  2M1R A;  2F42 A;  2NAA A;  4V3L C;  1IYM A;  2CKL B;  2L43 A;  1MM3 A;  4S3O B;  5J3X A;  5AIU A;  1WEN A;  5EYA F;  2L0B A;  3LRQ A;  2YUC A;  2LXH C;  2L80 A;  4WA6 A;  2OXQ C;  2EA6 A;  2UZG A;  2AN6 A;  4NN2 A;  1BOR A;  4GND A;  4LK9 A;  2JMJ A;  3KNV A;  2D8S A;  3VK6 A;  5G04 B;  2ECW A;  3DQV R;  4UP0 A;  2Y1M A;  3HCS A;  1CHC A;  1Z2Q A;  5G0F A;  4MVT A;  3N9Q A;  3O70 A;  1U6G B;  1WEU A;  1X4J A;  1VD4 A;  5LKT A;  2DX8 A;  3LQI A;  2H0D A;  2M3H A;  5TDW A;  4GNF A;  5FEY A;  2L75 A;  2VJF A;  2KGI A;  4QF3 A;  3U5P A;  2MD8 C;  2K1J A;  2KWK A;  5H1U A;  1K2F A;  4A0C D;  2JRJ A;  2G45 A;  3N9M A;  3L1Z B;  1E4U A;  1WEW A;  5G05 B;  4XI1 A;  3ZVY A;  3SOX A;  2MUM A;  2CSY A;  1HYI A;  5D1M B;  2HDP A;  2LGG A;  2E6S A;  3ASL A;  2K16 A;  4GB0 A;  2F6J A;  3SOU A;  3O35 A;  1Z6U A;  2Y1N A;  5LCW B;  3ZPV 1;  4AVX A;  1F62 A;  5C13 A;  4R8P K;  5TBN A;  5KH3 A;  5LKZ A;  4CCG X;  4BHW A;  3ZYQ A;  4UP5 A;  1WIM A;  2ECV A;  2M6M A;  5I3L A;  3C6W A;  1JM7 A;  2LN0 A;  4YAD A;  1VFY A;  5KH7 A;  3KV6 A;  2YSJ A;  4ZUX U;  1G25 A;  2MT5 A;  2YT5 A;  4IC3 A;  2JMD A;  4YBM A;  2PNX A;  1WEO A;  4WZ0 A;  1WES A;  2KIZ A;  5KH9 A;  3PUR A;  3O37 A;  1WGM A;  1FBV A;  4IC2 A;  5C11 A;  3MHH A;  2VPB A;  2QIC A;  2MA6 A;  1WEM A;  2VJE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...