2VJFA

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
SSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
publication title Structure of the Mdm2/Mdmx Ring Domain Heterodimer Reveals Dimerization is Required for Their Ubiquitylation in Trans.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjfA00
2ZETC 1X4IA 1WFKA 2YU4A 2CT2A 3HTKC 5TBNA 2VPGA 4GNEA 3FL2A 2KIZA 2MA5A 2L43A 2YUCA 3KNVA 2L80A 2CKLA 2VPBA 5FERA 3U5MA 2MD7B 1Z6UA 2MA6A 5FEYA 1HYIA 1JM7A 4PPEA 3O35A 3N9PA 2YW8A 4L7XA 5FB0A 1F62A 1LDJB 2MNYA 2YQLA 3M99A 5LKZA 4QF3A 4LK9A 2Y1MA 4ZQLA 3ZTGA 2CKLB 5H1VA 2YREA 4S3OC 3KV6A 3ZVYA 5B8DA 2KWKA 1WEOA 5H1TA 1JM7B 5FB1A 1K2FA 1FP0A 2Y1NA 4I7DA 4ZDTA 1VYXA 5I3LA 5D1KB 3ZPVE 2LDRA 4S3OB 3PURA 1WGMA 2L5UA 4I7BA 3T6RA 2OXQC 4AUQB 2HDPA 4YBTA 3IHPA 2LRIC 2QJ0A 4W4UA 2E6SA 4YATA 4QF2A 1WEPA 2L0BA 1G25A 3KV5A 3LQHA 3ZPV1 2KGIA 2LGKA 2F42A 5D1MB 5DINA 4YADA 3M62A 5B76A 5LKTA 1T1HA 2LN0A 3L11A 5AIUA 4A49A 2F6NA 4FO9A 2M3HA 3GV4A 3ZYQA 2JMIA 3U5OA 2KYUA 4AYCA 3O36A 4UI9B 3HCUA 5KH3A 3O37A 4A4BA 2ECGA 2LGVA 2KWJA 4CA1A 1Z60A 5D1LB 2JMDA 3N9OA 1MM2A 2G6QA 2VNFA 2YQMA 4N4FA 2D8SA 1VD4A 4FK5A 3KQIA 2KFTA 1WEMA 1X4JA 4O64A 3MHSA 3NG2A 1V87A 2YT5A 2YSMA 3L1XA 1FBVA 2XB1A 2ECWA 2YSJA 2RI7A 1Z2QA 3T7LA 4WA6A 2QIZA 4WZ2A 4AYCB 4GNFA 1VFYA 2ECNA 2KE1A 2K4DA 1IYMA 2C2LA 1DVPA 3O34A 5G0FA 4LLBA 4CCGX 2K16A 4FJCA 2VP7A 2VPDA 3O7AA 2BAYA 1XWHA 1HYJA 3O70A 4IC3A 5TRBA 5TABA 2VPEA 2PNXA 2M1RA 4X3GA 3RPGC 2UZGA 2YHOA 4Q6FA 1WESA 2ECVA 3GL6A 3M63A 4B86C 4A0CD 3QZVA 2C2VS 5H1UA 1WIMA 2JMJA 3V43A 2K17A 3RPGB 1WEQA 1BORA 3L1ZB 4IC2A 5KH7A 2PUYA 3SOWA 2CSZA 4YBSA 5EYAF 2YHNA 2ECJA 4LADB 2MNZA 2EA6A 4I7CA 5B78A 3HCSA 2K1JA 5LKUA 4R8PK 1LDKC 5JG6A 4P5OB 4MVTA 3U5NA 2MUMA 2YURA 2M6MA 5B77A 1WEVA 2EGPA 5C13A 2NAAA 2E6RA 3SOXA 2G45A 3C5KA 5J3XA 5LKXA 2ECIA 2VJEA 4R7EA 2M85A 5B75A 4B7YC 1N87A 4BHWA 4PTBA 4YAXA 2LXPC 5TDRA 3N9LA 4BBQA 3U5PA 3N9QA 2XEUA 2VJFA 4V3LC 4WZ0A 4MSXA 3EB5A 3N9NA 5LCWB 2KREA 5H9MA 1E4UA 4UP5A 4GNGA 4R2YA 3O33A 2VJEB 3LQJA 2Y43A 4YABA 2KGGA 1MM3A 1U6GB 2MT5A 1ZBDB 4LKAA 2KR4A 1WILA 5B79A 4GNDA 2VJFB 4YBMA 2DX8A 4NN2A 3ZVZB 4AVXA 2EODA 4GB0A 4LJNA 5AITA 4XI1A 5TDWA 2FUIA 4V3KC 1WE9A 2IDAA 3LQIA 3LRQA 2KU3A 3DPLR 2MD8C 3PUQA 3ASLA 1JOCA 1RMDA 4FIPA 2LXHC 2JRJA 2FUUA 3DQVR 1WEWA 2H0DA 3SHBA 3RTRB 4L58A 1WENA 1CHCA 3HCTA 5KH9A 2ECTA 4YC9A 5G05B 4WZ3B 4C9ZA 2HYED 5G04B 1X4UA 3PHDA 3EB6A 2I50A 3I2DA 5DKAA 2RSDA 1WEEA 2FSAA 1WEUA 5C11A 2AN6A 3MHHA 4AP4A 2G43A 4ZUXU 4A4CA 2QICA 3N9MA 2F6JA 3SOUA 3C6WA 3VK6A 4TKPB 2LGGA 4N3WA 2YYRA 2LV9A 2MIQA 2KWNA 2H0DB 2LQ6A 4F52B 4UP0A 2LGLA 3ZNIA 2CSYA 2KWOA 2L75A
chains in the Genus database with same CATH superfamily
2ZETC 1X4IA 1WFKA 2YU4A 2CT2A 3HTKC 5TBNA 2VPGA 4GNEA 3FL2A 2KIZA 2MA5A 2L43A 2YUCA 3KNVA 5SVIA 3O47A 2L80A 2CKLA 2VPBA 5FERA 3U5MA 2P57A 2E61A 2MD7B 1Z6UA 2MA6A 5FEYA 1HYIA 1JM7A 2MKEA 4PPEA 3O35A 3N9PA 4QQ4A 2YW8A 4L7XA 5FB0A 1F62A 1LDJB 2MNYA 2YQLA 3M99A 5LKZA 4QF3A 4LK9A 4Z0OA 2Y1MA 4ZQLA 5SVIB 3ZTGA 2CKLB 5H1VA 2D8UA 2YREA 4S3OC 3KV6A 3ZVYA 5B8DA 2KWKA 1WEOA 3DWDA 5H1TA 1JM7B 5FB1A 1K2FA 1FP0A 2Y1NA 4I7DA 4ZDTA 1VYXA 5I3LA 5D1KB 3ZPVE 2LDRA 4S3OB 3PURA 1WGMA 2L5UA 3LVRE 4I7BA 2OXQC 3T6RA 4AUQB 2HDPA 2M13A 2IQJA 3IHPA 4YBTA 5K3QA 1DCQA 2LRIC 2QJ0A 4W4UA 2E6SA 4YATA 4QF2A 1WEPA 2L0BA 1G25A 3KV5A 3LQHA 3ZPV1 2KGIA 2LGKA 2F42A 5D1MB 5DINA 4YADA 3M62A 5B76A 5LKTA 1T1HA 2LN0A 3L11A 5AIUA 2B0OE 4A49A 2F6NA 4FO9A 2M3HA 3GV4A 3ZYQA 2JMIA 3T9KA 3U5OA 2KYUA 4AYCA 3O36A 4UI9B 3HCUA 5KH3A 3O37A 4A4BA 2ECGA 2LGVA 2KWJA 4CA1A 1Z60A 5D1LB 2JMDA 3N9OA 4H9DA 1MM2A 2G6QA 5SVXA 2VNFA 2YQMA 4N4FA 2D8SA 1VD4A 2XOZA 2EXUA 4FK5A 3KQIA 2KFTA 1WEMA 1X4JA 4O64A 3MHSA 3NG2A 1V87A 2YT5A 2YSMA 3L1XA 1FBVA 2XB1A 2ECWA 3FEHA 2YSJA 2RI7A 1Z2QA 3T7LA 4WA6A 3FJUB 2QIZA 2FFWA 2FD4A 2XOYA 4WZ2A 4AYCB 4GNFA 1VFYA 2XP0A 2ECNA 2KE1A 2K4DA 1IYMA 2LAUA 2C2LA 1DVPA 3O34A 5G0FA 4LLBA 4CCGX 1MBMA 2CRWA 2K16A 4FJCA 2VP7A 3O7AA 2CRRA 2BAYA 2VPDA 1XWHA 1HYJA 2JM3A 3O70A 4IC3A 5TRBA 5TABA 2VPEA 2PNXA 2M1RA 4X3GA 3RPGC 2UZGA 2YHOA 4Q6FA 1WESA 2ECVA 2DJAA 3GL6A 3M63A 4B86C 4A0CD 3QZVA 2C2VS 5H1UA 1WIMA 2JMJA 3V43A 2OWAA 2K17A 3RPGB 1WEQA 2JUNA 1BORA 3L1ZB 4IC2A 5KH7A 3H7HA 2PUYA 3SOWA 2XOCA 2CSZA 2CONA 2YVRA 4YBSA 2RR4A 3MDBC 5EYAF 2YHNA 3LDYA 3FM8C 3Q1DA 2ECJA 3DDTA 4LADB 2MNZA 4OGCA 2EA6A 4I7CA 5B78A 3HCSA 2K1JA 5LKUA 4R8PK 1LDKC 5JG6A 3M7KA 4P5OB 4MVTA 3U5NA 2MUMA 2YURA 2M6MA 5B77A 1WEVA 2EGPA 2KKYA 2NAAA 4OGEA 2E6RA 5C13A 3SOXA 2G45A 3C5KA 5J3XA 5LKXA 2ECIA 2VJEA 4R7EA 2M85A 5B75A 4B7YC 1N87A 4BHWA 4PTBA 4YAXA 2LXPC 5TDRA 3N9LA 4BBQA 3U5PA 3N9QA 2XEUA 2VJFA 3LJUX 4V3LC 4WZ0A 4MSXA 2DSMA 3EB5A 3N9NA 5LCWB 2KREA 4F1PA 5H9MA 1E4UA 4UP5A 4GNGA 4R2YA 3O33A 2VJEB 3LQJA 2Y43A 4YABA 2KGGA 1MM3A 1U6GB 2MT5A 1ZBDB 4LKAA 2KR4A 1WILA 5B79A 4GNDA 3FAOA 2VJFB 4YBMA 2DX8A 4NN2A 3ZVZB 4AVXA 3FANA 2EODA 4GB0A 4LJNA 5AITA 4XI1A 2EGMA 5TDWA 2FUIA 4V3KC 1WE9A 2IDAA 3LQIA 3LRQA 2KU3A 3DPLR 4Z0RA 2MD8C 3PUQA 2KKXA 3ASLA 1JOCA 1RMDA 4FIPA 2LXHC 2JRJA 2FUUA 3DQVR 1WEWA 2H0DA 3SHBA 3RTRB 4L58A 4O62A 1WENA 1CHCA 3HCTA 5KH9A 2ECTA 4YC9A 5G05B 2CSVA 4WZ3B 3E2DA 4C9ZA 2HYED 5G04B 1X4UA 3PHDA 3EB6A 2I50A 2L7PA 3I2DA 5DKAA 2RSDA 1WEEA 2FSAA 1WEUA 5C11A 2AN6A 3MHHA 4AP4A 2G43A 4ZUXU 3KDEC 4A4CA 2QICA 3N9MA 2F6JA 3SOUA 3C6WA 3VK6A 4TKPB 3JUEA 2LGGA 4N3WA 2YYRA 2LV9A 2MIQA 2KWNA 2H0DB 2LQ6A 4F52B 4UP0A 2LGLA 3SUBA 3ZNIA 3PLWA 2CSYA 5SVYA 2KWOA 2L75A 3LVQE
chains in the Genus database with same CATH topology
2ZETC 1X4IA 1WFKA 2YU4A 2CT2A 3HTKC 5TBNA 2VPGA 4GNEA 3FL2A 2KIZA 2MA5A 2L43A 2YUCA 3KNVA 2L80A 2CKLA 2VPBA 5FERA 3U5MA 2MD7B 1Z6UA 2MA6A 5FEYA 1HYIA 1JM7A 4PPEA 3O35A 3N9PA 2YW8A 4L7XA 5FB0A 1F62A 1LDJB 2MNYA 2YQLA 3M99A 5LKZA 4QF3A 4LK9A 2Y1MA 4ZQLA 3ZTGA 2CKLB 5H1VA 2YREA 4S3OC 3KV6A 3ZVYA 5B8DA 2KWKA 1WEOA 5H1TA 1JM7B 5FB1A 1K2FA 1FP0A 2Y1NA 4I7DA 4ZDTA 1VYXA 5I3LA 5D1KB 3ZPVE 2LDRA 4S3OB 3PURA 1WGMA 2L5UA 4I7BA 3T6RA 2OXQC 4AUQB 2HDPA 4YBTA 3IHPA 2LRIC 2QJ0A 4W4UA 2E6SA 4YATA 4QF2A 1WEPA 2L0BA 1G25A 3KV5A 3LQHA 3ZPV1 2KGIA 2LGKA 2F42A 5D1MB 5DINA 4YADA 3M62A 5B76A 5LKTA 1T1HA 2LN0A 3L11A 5AIUA 4A49A 2F6NA 4FO9A 2M3HA 3GV4A 3ZYQA 2JMIA 3U5OA 2KYUA 4AYCA 3O36A 4UI9B 3HCUA 5KH3A 3O37A 4A4BA 2ECGA 2LGVA 2KWJA 4CA1A 1Z60A 5D1LB 2JMDA 3N9OA 1MM2A 2G6QA 2VNFA 2YQMA 4N4FA 2D8SA 1VD4A 4FK5A 3KQIA 2KFTA 1WEMA 1X4JA 4O64A 3MHSA 3NG2A 1V87A 2YT5A 2YSMA 3L1XA 1FBVA 2XB1A 2ECWA 2YSJA 2RI7A 1Z2QA 3T7LA 4WA6A 2QIZA 4WZ2A 4AYCB 4GNFA 1VFYA 2ECNA 2KE1A 2K4DA 1IYMA 2C2LA 1DVPA 3O34A 5G0FA 4LLBA 4CCGX 2K16A 4FJCA 2VP7A 2VPDA 3O7AA 2BAYA 1XWHA 1HYJA 3O70A 4IC3A 5TRBA 5TABA 2VPEA 2PNXA 2M1RA 4X3GA 3RPGC 2UZGA 2YHOA 4Q6FA 1WESA 2ECVA 3GL6A 3M63A 4B86C 4A0CD 3QZVA 2C2VS 5H1UA 1WIMA 2JMJA 3V43A 2K17A 3RPGB 1WEQA 1BORA 3L1ZB 4IC2A 5KH7A 2PUYA 3SOWA 2CSZA 4YBSA 5EYAF 2YHNA 2ECJA 4LADB 2MNZA 2EA6A 4I7CA 5B78A 3HCSA 2K1JA 5LKUA 4R8PK 1LDKC 5JG6A 4P5OB 4MVTA 3U5NA 2MUMA 2YURA 2M6MA 5B77A 1WEVA 2EGPA 5C13A 2NAAA 2E6RA 3SOXA 2G45A 3C5KA 5J3XA 5LKXA 2ECIA 2VJEA 4R7EA 2M85A 5B75A 4B7YC 1N87A 4BHWA 4PTBA 4YAXA 2LXPC 5TDRA 3N9LA 4BBQA 3U5PA 3N9QA 2XEUA 2VJFA 4V3LC 4WZ0A 4MSXA 3EB5A 3N9NA 5LCWB 2KREA 5H9MA 1E4UA 4UP5A 4GNGA 4R2YA 3O33A 2VJEB 3LQJA 2Y43A 4YABA 2KGGA 1MM3A 1U6GB 2MT5A 1ZBDB 4LKAA 2KR4A 1WILA 5B79A 4GNDA 2VJFB 4YBMA 2DX8A 4NN2A 3ZVZB 4AVXA 2EODA 4GB0A 4LJNA 5AITA 4XI1A 5TDWA 2FUIA 4V3KC 1WE9A 2IDAA 3LQIA 3LRQA 2KU3A 3DPLR 2MD8C 3PUQA 3ASLA 1JOCA 1RMDA 4FIPA 2LXHC 2JRJA 2FUUA 3DQVR 1WEWA 2H0DA 3SHBA 3RTRB 4L58A 1WENA 1CHCA 3HCTA 5KH9A 2ECTA 4YC9A 5G05B 4WZ3B 4C9ZA 2HYED 5G04B 1X4UA 3PHDA 3EB6A 2I50A 3I2DA 5DKAA 2RSDA 1WEEA 2FSAA 1WEUA 5C11A 2AN6A 3MHHA 4AP4A 2G43A 4ZUXU 4A4CA 2QICA 3N9MA 2F6JA 3SOUA 3C6WA 3VK6A 4TKPB 2LGGA 4N3WA 2YYRA 2LV9A 2MIQA 2KWNA 2H0DB 2LQ6A 4F52B 4UP0A 2LGLA 3ZNIA 2CSYA 2KWOA 2L75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZET C;  1X4I A;  1WFK A;  2YU4 A;  2CT2 A;  3HTK C;  5TBN A;  2VPG A;  4GNE A;  3FL2 A;  2KIZ A;  2MA5 A;  2L43 A;  2YUC A;  3KNV A;  2L80 A;  2CKL A;  2VPB A;  5FER A;  3U5M A;  2MD7 B;  1Z6U A;  2MA6 A;  5FEY A;  1HYI A;  1JM7 A;  4PPE A;  3O35 A;  3N9P A;  2YW8 A;  4L7X A;  5FB0 A;  1F62 A;  1LDJ B;  2MNY A;  2YQL A;  3M99 A;  5LKZ A;  4QF3 A;  4LK9 A;  2Y1M A;  4ZQL A;  3ZTG A;  2CKL B;  5H1V A;  2YRE A;  4S3O C;  3KV6 A;  3ZVY A;  5B8D A;  2KWK A;  1WEO A;  5H1T A;  1JM7 B;  5FB1 A;  1K2F A;  1FP0 A;  2Y1N A;  4I7D A;  4ZDT A;  1VYX A;  5I3L A;  5D1K B;  3ZPV E;  2LDR A;  4S3O B;  3PUR A;  1WGM A;  2L5U A;  4I7B A;  3T6R A;  2OXQ C;  4AUQ B;  2HDP A;  4YBT A;  3IHP A;  2LRI C;  2QJ0 A;  4W4U A;  2E6S A;  4YAT A;  4QF2 A;  1WEP A;  2L0B A;  1G25 A;  3KV5 A;  3LQH A;  3ZPV 1;  2KGI A;  2LGK A;  2F42 A;  5D1M B;  5DIN A;  4YAD A;  3M62 A;  5B76 A;  5LKT A;  1T1H A;  2LN0 A;  3L11 A;  5AIU A;  4A49 A;  2F6N A;  4FO9 A;  2M3H A;  3GV4 A;  3ZYQ A;  2JMI A;  3U5O A;  2KYU A;  4AYC A;  3O36 A;  4UI9 B;  3HCU A;  5KH3 A;  3O37 A;  4A4B A;  2ECG A;  2LGV A;  2KWJ A;  4CA1 A;  1Z60 A;  5D1L B;  2JMD A;  3N9O A;  1MM2 A;  2G6Q A;  2VNF A;  2YQM A;  4N4F A;  2D8S A;  1VD4 A;  4FK5 A;  3KQI A;  2KFT A;  1WEM A;  1X4J A;  4O64 A;  3MHS A;  3NG2 A;  1V87 A;  2YT5 A;  2YSM A;  3L1X A;  1FBV A;  2XB1 A;  2ECW A;  2YSJ A;  2RI7 A;  1Z2Q A;  3T7L A;  4WA6 A;  2QIZ A;  4WZ2 A;  4AYC B;  4GNF A;  1VFY A;  2ECN A;  2KE1 A;  2K4D A;  1IYM A;  2C2L A;  1DVP A;  3O34 A;  5G0F A;  4LLB A;  4CCG X;  2K16 A;  4FJC A;  2VP7 A;  2VPD A;  3O7A A;  2BAY A;  1XWH A;  1HYJ A;  3O70 A;  4IC3 A;  5TRB A;  5TAB A;  2VPE A;  2PNX A;  2M1R A;  4X3G A;  3RPG C;  2UZG A;  2YHO A;  4Q6F A;  1WES A;  2ECV A;  3GL6 A;  3M63 A;  4B86 C;  4A0C D;  3QZV A;  2C2V S;  5H1U A;  1WIM A;  2JMJ A;  3V43 A;  2K17 A;  3RPG B;  1WEQ A;  1BOR A;  3L1Z B;  4IC2 A;  5KH7 A;  2PUY A;  3SOW A;  2CSZ A;  4YBS A;  5EYA F;  2YHN A;  2ECJ A;  4LAD B;  2MNZ A;  2EA6 A;  4I7C A;  5B78 A;  3HCS A;  2K1J A;  5LKU A;  4R8P K;  1LDK C;  5JG6 A;  4P5O B;  4MVT A;  3U5N A;  2MUM A;  2YUR A;  2M6M A;  5B77 A;  1WEV A;  2EGP A;  5C13 A;  2NAA A;  2E6R A;  3SOX A;  2G45 A;  3C5K A;  5J3X A;  5LKX A;  2ECI A;  2VJE A;  4R7E A;  2M85 A;  5B75 A;  4B7Y C;  1N87 A;  4BHW A;  4PTB A;  4YAX A;  2LXP C;  5TDR A;  3N9L A;  4BBQ A;  3U5P A;  3N9Q A;  2XEU A;  2VJF A;  4V3L C;  4WZ0 A;  4MSX A;  3EB5 A;  3N9N A;  5LCW B;  2KRE A;  5H9M A;  1E4U A;  4UP5 A;  4GNG A;  4R2Y A;  3O33 A;  2VJE B;  3LQJ A;  2Y43 A;  4YAB A;  2KGG A;  1MM3 A;  1U6G B;  2MT5 A;  1ZBD B;  4LKA A;  2KR4 A;  1WIL A;  5B79 A;  4GND A;  2VJF B;  4YBM A;  2DX8 A;  4NN2 A;  3ZVZ B;  4AVX A;  2EOD A;  4GB0 A;  4LJN A;  5AIT A;  4XI1 A;  5TDW A;  2FUI A;  4V3K C;  1WE9 A;  2IDA A;  3LQI A;  3LRQ A;  2KU3 A;  3DPL R;  2MD8 C;  3PUQ A;  3ASL A;  1JOC A;  1RMD A;  4FIP A;  2LXH C;  2JRJ A;  2FUU A;  3DQV R;  1WEW A;  2H0D A;  3SHB A;  3RTR B;  4L58 A;  1WEN A;  1CHC A;  3HCT A;  5KH9 A;  2ECT A;  4YC9 A;  5G05 B;  4WZ3 B;  4C9Z A;  2HYE D;  5G04 B;  1X4U A;  3PHD A;  3EB6 A;  2I50 A;  3I2D A;  5DKA A;  2RSD A;  1WEE A;  2FSA A;  1WEU A;  5C11 A;  2AN6 A;  3MHH A;  4AP4 A;  2G43 A;  4ZUX U;  4A4C A;  2QIC A;  3N9M A;  2F6J A;  3SOU A;  3C6W A;  3VK6 A;  4TKP B;  2LGG A;  4N3W A;  2YYR A;  2LV9 A;  2MIQ A;  2KWN A;  2H0D B;  2LQ6 A;  4F52 B;  4UP0 A;  2LGL A;  3ZNI A;  2CSY A;  2KWO A;  2L75 A; 
#chains in the Genus database with same CATH topology
 2ZET C;  1X4I A;  1WFK A;  2YU4 A;  2CT2 A;  3HTK C;  5TBN A;  2VPG A;  4GNE A;  3FL2 A;  2KIZ A;  2MA5 A;  2L43 A;  2YUC A;  3KNV A;  5SVI A;  3O47 A;  2L80 A;  2CKL A;  2VPB A;  5FER A;  3U5M A;  2P57 A;  2E61 A;  2MD7 B;  1Z6U A;  2MA6 A;  5FEY A;  1HYI A;  1JM7 A;  2MKE A;  4PPE A;  3O35 A;  3N9P A;  4QQ4 A;  2YW8 A;  4L7X A;  5FB0 A;  1F62 A;  1LDJ B;  2MNY A;  2YQL A;  3M99 A;  5LKZ A;  4QF3 A;  4LK9 A;  4Z0O A;  2Y1M A;  4ZQL A;  5SVI B;  3ZTG A;  2CKL B;  5H1V A;  2D8U A;  2YRE A;  4S3O C;  3KV6 A;  3ZVY A;  5B8D A;  2KWK A;  1WEO A;  3DWD A;  5H1T A;  1JM7 B;  5FB1 A;  1K2F A;  1FP0 A;  2Y1N A;  4I7D A;  4ZDT A;  1VYX A;  5I3L A;  5D1K B;  3ZPV E;  2LDR A;  4S3O B;  3PUR A;  1WGM A;  2L5U A;  3LVR E;  4I7B A;  2OXQ C;  3T6R A;  4AUQ B;  2HDP A;  2M13 A;  2IQJ A;  3IHP A;  4YBT A;  5K3Q A;  1DCQ A;  2LRI C;  2QJ0 A;  4W4U A;  2E6S A;  4YAT A;  4QF2 A;  1WEP A;  2L0B A;  1G25 A;  3KV5 A;  3LQH A;  3ZPV 1;  2KGI A;  2LGK A;  2F42 A;  5D1M B;  5DIN A;  4YAD A;  3M62 A;  5B76 A;  5LKT A;  1T1H A;  2LN0 A;  3L11 A;  5AIU A;  2B0O E;  4A49 A;  2F6N A;  4FO9 A;  2M3H A;  3GV4 A;  3ZYQ A;  2JMI A;  3T9K A;  3U5O A;  2KYU A;  4AYC A;  3O36 A;  4UI9 B;  3HCU A;  5KH3 A;  3O37 A;  4A4B A;  2ECG A;  2LGV A;  2KWJ A;  4CA1 A;  1Z60 A;  5D1L B;  2JMD A;  3N9O A;  4H9D A;  1MM2 A;  2G6Q A;  5SVX A;  2VNF A;  2YQM A;  4N4F A;  2D8S A;  1VD4 A;  2XOZ A;  2EXU A;  4FK5 A;  3KQI A;  2KFT A;  1WEM A;  1X4J A;  4O64 A;  3MHS A;  3NG2 A;  1V87 A;  2YT5 A;  2YSM A;  3L1X A;  1FBV A;  2XB1 A;  2ECW A;  3FEH A;  2YSJ A;  2RI7 A;  1Z2Q A;  3T7L A;  4WA6 A;  3FJU B;  2QIZ A;  2FFW A;  2FD4 A;  2XOY A;  4WZ2 A;  4AYC B;  4GNF A;  1VFY A;  2XP0 A;  2ECN A;  2KE1 A;  2K4D A;  1IYM A;  2LAU A;  2C2L A;  1DVP A;  3O34 A;  5G0F A;  4LLB A;  4CCG X;  1MBM A;  2CRW A;  2K16 A;  4FJC A;  2VP7 A;  3O7A A;  2CRR A;  2BAY A;  2VPD A;  1XWH A;  1HYJ A;  2JM3 A;  3O70 A;  4IC3 A;  5TRB A;  5TAB A;  2VPE A;  2PNX A;  2M1R A;  4X3G A;  3RPG C;  2UZG A;  2YHO A;  4Q6F A;  1WES A;  2ECV A;  2DJA A;  3GL6 A;  3M63 A;  4B86 C;  4A0C D;  3QZV A;  2C2V S;  5H1U A;  1WIM A;  2JMJ A;  3V43 A;  2OWA A;  2K17 A;  3RPG B;  1WEQ A;  2JUN A;  1BOR A;  3L1Z B;  4IC2 A;  5KH7 A;  3H7H A;  2PUY A;  3SOW A;  2XOC A;  2CSZ A;  2CON A;  2YVR A;  4YBS A;  2RR4 A;  3MDB C;  5EYA F;  2YHN A;  3LDY A;  3FM8 C;  3Q1D A;  2ECJ A;  3DDT A;  4LAD B;  2MNZ A;  4OGC A;  2EA6 A;  4I7C A;  5B78 A;  3HCS A;  2K1J A;  5LKU A;  4R8P K;  1LDK C;  5JG6 A;  3M7K A;  4P5O B;  4MVT A;  3U5N A;  2MUM A;  2YUR A;  2M6M A;  5B77 A;  1WEV A;  2EGP A;  2KKY A;  2NAA A;  4OGE A;  2E6R A;  5C13 A;  3SOX A;  2G45 A;  3C5K A;  5J3X A;  5LKX A;  2ECI A;  2VJE A;  4R7E A;  2M85 A;  5B75 A;  4B7Y C;  1N87 A;  4BHW A;  4PTB A;  4YAX A;  2LXP C;  5TDR A;  3N9L A;  4BBQ A;  3U5P A;  3N9Q A;  2XEU A;  2VJF A;  3LJU X;  4V3L C;  4WZ0 A;  4MSX A;  2DSM A;  3EB5 A;  3N9N A;  5LCW B;  2KRE A;  4F1P A;  5H9M A;  1E4U A;  4UP5 A;  4GNG A;  4R2Y A;  3O33 A;  2VJE B;  3LQJ A;  2Y43 A;  4YAB A;  2KGG A;  1MM3 A;  1U6G B;  2MT5 A;  1ZBD B;  4LKA A;  2KR4 A;  1WIL A;  5B79 A;  4GND A;  3FAO A;  2VJF B;  4YBM A;  2DX8 A;  4NN2 A;  3ZVZ B;  4AVX A;  3FAN A;  2EOD A;  4GB0 A;  4LJN A;  5AIT A;  4XI1 A;  2EGM A;  5TDW A;  2FUI A;  4V3K C;  1WE9 A;  2IDA A;  3LQI A;  3LRQ A;  2KU3 A;  3DPL R;  4Z0R A;  2MD8 C;  3PUQ A;  2KKX A;  3ASL A;  1JOC A;  1RMD A;  4FIP A;  2LXH C;  2JRJ A;  2FUU A;  3DQV R;  1WEW A;  2H0D A;  3SHB A;  3RTR B;  4L58 A;  4O62 A;  1WEN A;  1CHC A;  3HCT A;  5KH9 A;  2ECT A;  4YC9 A;  5G05 B;  2CSV A;  4WZ3 B;  3E2D A;  4C9Z A;  2HYE D;  5G04 B;  1X4U A;  3PHD A;  3EB6 A;  2I50 A;  2L7P A;  3I2D A;  5DKA A;  2RSD A;  1WEE A;  2FSA A;  1WEU A;  5C11 A;  2AN6 A;  3MHH A;  4AP4 A;  2G43 A;  4ZUX U;  3KDE C;  4A4C A;  2QIC A;  3N9M A;  2F6J A;  3SOU A;  3C6W A;  3VK6 A;  4TKP B;  3JUE A;  2LGG A;  4N3W A;  2YYR A;  2LV9 A;  2MIQ A;  2KWN A;  2H0D B;  2LQ6 A;  4F52 B;  4UP0 A;  2LGL A;  3SUB A;  3ZNI A;  3PLW A;  2CSY A;  5SVY A;  2KWO A;  2L75 A;  3LVQ E; 
#chains in the Genus database with same CATH homology
 2ZET C;  1X4I A;  1WFK A;  2YU4 A;  2CT2 A;  3HTK C;  5TBN A;  2VPG A;  4GNE A;  3FL2 A;  2KIZ A;  2MA5 A;  2L43 A;  2YUC A;  3KNV A;  2L80 A;  2CKL A;  2VPB A;  5FER A;  3U5M A;  2MD7 B;  1Z6U A;  2MA6 A;  5FEY A;  1HYI A;  1JM7 A;  4PPE A;  3O35 A;  3N9P A;  2YW8 A;  4L7X A;  5FB0 A;  1F62 A;  1LDJ B;  2MNY A;  2YQL A;  3M99 A;  5LKZ A;  4QF3 A;  4LK9 A;  2Y1M A;  4ZQL A;  3ZTG A;  2CKL B;  5H1V A;  2YRE A;  4S3O C;  3KV6 A;  3ZVY A;  5B8D A;  2KWK A;  1WEO A;  5H1T A;  1JM7 B;  5FB1 A;  1K2F A;  1FP0 A;  2Y1N A;  4I7D A;  4ZDT A;  1VYX A;  5I3L A;  5D1K B;  3ZPV E;  2LDR A;  4S3O B;  3PUR A;  1WGM A;  2L5U A;  4I7B A;  3T6R A;  2OXQ C;  4AUQ B;  2HDP A;  4YBT A;  3IHP A;  2LRI C;  2QJ0 A;  4W4U A;  2E6S A;  4YAT A;  4QF2 A;  1WEP A;  2L0B A;  1G25 A;  3KV5 A;  3LQH A;  3ZPV 1;  2KGI A;  2LGK A;  2F42 A;  5D1M B;  5DIN A;  4YAD A;  3M62 A;  5B76 A;  5LKT A;  1T1H A;  2LN0 A;  3L11 A;  5AIU A;  4A49 A;  2F6N A;  4FO9 A;  2M3H A;  3GV4 A;  3ZYQ A;  2JMI A;  3U5O A;  2KYU A;  4AYC A;  3O36 A;  4UI9 B;  3HCU A;  5KH3 A;  3O37 A;  4A4B A;  2ECG A;  2LGV A;  2KWJ A;  4CA1 A;  1Z60 A;  5D1L B;  2JMD A;  3N9O A;  1MM2 A;  2G6Q A;  2VNF A;  2YQM A;  4N4F A;  2D8S A;  1VD4 A;  4FK5 A;  3KQI A;  2KFT A;  1WEM A;  1X4J A;  4O64 A;  3MHS A;  3NG2 A;  1V87 A;  2YT5 A;  2YSM A;  3L1X A;  1FBV A;  2XB1 A;  2ECW A;  2YSJ A;  2RI7 A;  1Z2Q A;  3T7L A;  4WA6 A;  2QIZ A;  4WZ2 A;  4AYC B;  4GNF A;  1VFY A;  2ECN A;  2KE1 A;  2K4D A;  1IYM A;  2C2L A;  1DVP A;  3O34 A;  5G0F A;  4LLB A;  4CCG X;  2K16 A;  4FJC A;  2VP7 A;  2VPD A;  3O7A A;  2BAY A;  1XWH A;  1HYJ A;  3O70 A;  4IC3 A;  5TRB A;  5TAB A;  2VPE A;  2PNX A;  2M1R A;  4X3G A;  3RPG C;  2UZG A;  2YHO A;  4Q6F A;  1WES A;  2ECV A;  3GL6 A;  3M63 A;  4B86 C;  4A0C D;  3QZV A;  2C2V S;  5H1U A;  1WIM A;  2JMJ A;  3V43 A;  2K17 A;  3RPG B;  1WEQ A;  1BOR A;  3L1Z B;  4IC2 A;  5KH7 A;  2PUY A;  3SOW A;  2CSZ A;  4YBS A;  5EYA F;  2YHN A;  2ECJ A;  4LAD B;  2MNZ A;  2EA6 A;  4I7C A;  5B78 A;  3HCS A;  2K1J A;  5LKU A;  4R8P K;  1LDK C;  5JG6 A;  4P5O B;  4MVT A;  3U5N A;  2MUM A;  2YUR A;  2M6M A;  5B77 A;  1WEV A;  2EGP A;  5C13 A;  2NAA A;  2E6R A;  3SOX A;  2G45 A;  3C5K A;  5J3X A;  5LKX A;  2ECI A;  2VJE A;  4R7E A;  2M85 A;  5B75 A;  4B7Y C;  1N87 A;  4BHW A;  4PTB A;  4YAX A;  2LXP C;  5TDR A;  3N9L A;  4BBQ A;  3U5P A;  3N9Q A;  2XEU A;  2VJF A;  4V3L C;  4WZ0 A;  4MSX A;  3EB5 A;  3N9N A;  5LCW B;  2KRE A;  5H9M A;  1E4U A;  4UP5 A;  4GNG A;  4R2Y A;  3O33 A;  2VJE B;  3LQJ A;  2Y43 A;  4YAB A;  2KGG A;  1MM3 A;  1U6G B;  2MT5 A;  1ZBD B;  4LKA A;  2KR4 A;  1WIL A;  5B79 A;  4GND A;  2VJF B;  4YBM A;  2DX8 A;  4NN2 A;  3ZVZ B;  4AVX A;  2EOD A;  4GB0 A;  4LJN A;  5AIT A;  4XI1 A;  5TDW A;  2FUI A;  4V3K C;  1WE9 A;  2IDA A;  3LQI A;  3LRQ A;  2KU3 A;  3DPL R;  2MD8 C;  3PUQ A;  3ASL A;  1JOC A;  1RMD A;  4FIP A;  2LXH C;  2JRJ A;  2FUU A;  3DQV R;  1WEW A;  2H0D A;  3SHB A;  3RTR B;  4L58 A;  1WEN A;  1CHC A;  3HCT A;  5KH9 A;  2ECT A;  4YC9 A;  5G05 B;  4WZ3 B;  4C9Z A;  2HYE D;  5G04 B;  1X4U A;  3PHD A;  3EB6 A;  2I50 A;  3I2D A;  5DKA A;  2RSD A;  1WEE A;  2FSA A;  1WEU A;  5C11 A;  2AN6 A;  3MHH A;  4AP4 A;  2G43 A;  4ZUX U;  4A4C A;  2QIC A;  3N9M A;  2F6J A;  3SOU A;  3C6W A;  3VK6 A;  4TKP B;  2LGG A;  4N3W A;  2YYR A;  2LV9 A;  2MIQ A;  2KWN A;  2H0D B;  2LQ6 A;  4F52 B;  4UP0 A;  2LGL A;  3ZNI A;  2CSY A;  2KWO A;  2L75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...